Diaphorina citri psyllid: psy14703

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MEDRFVINENIDDTGVSLIAVFDGHGGEFAANFARDNLMTSLNDKVIELKKIIAQGLHKLYPMYTPNKPPPSPRPSQKSPKPSLRKNATTDECSGTKNSSSSQITDPELLSRINSLSRPITREVHNTSNTSSVVETVEISSYIEVNGKINYIKLVTDEVLLVDQRIVENAKKTYDVAGTTALIAILEGTRLIVANVGDSRGVMCDSKGNAIPLSFDHKPQQMRERKRIKEAGGFIAFNGVWRVAGILATSRALGDYPLKDKKLVIADPDILTFDLSDHKPQFLILASDGLWDIFSNEEAVNFIKQRLGEELFGAKSLTLQAYYKGSLDNITVIVINLMNYDWAKAAQEDRKKNLSR
ccccEEEcccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccHHHHHccccEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccEEEEEEccccCEEEEccccCEEEcccccccccHHHHHHHHHcccEEEEccEEEcccHHHHHHHcccccccccccECccccEEEEEccccccEEEEEEcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHHccc
MEDRFVINENIDDTGVSLIAVFDGHGGEFAANFARDNLMTSLNDKVIELKKIIAQGLHKLYPMYTPN**************PSLRKNATTDECSGTKNSSSSQITDPELLSRINSLSRPITREVHNTSNTSSVVETVEISSYIEVNGKINYIKLVTDEVLLVDQRIVENAKKTYDVAGTTALIAILEGTRLIVANVGDSRGVMCDSKGNAIPLSFDHKPQQMRERKRIKEAGGFIAFNGVWRVAGILATSRALGDYPLKDKKLVIADPDILTFDLSDHKPQFLILASDGLWDIFSNEEAVNFIKQRLGEELFGAKSLTLQAYYKGSLDNITVIVINLMNY****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDRFVINENIDDTGVSLIAVFDGHGGEFAANFARDNLMTSLNDKVIELKKIIAQGLHKLYPMYTPNKPPPSPRPSQKSPKPSLRKNATTDECSGTKNSSSSQITDPELLSRINSLSRPITREVHNTSNTSSVVETVEISSYIEVNGKINYIKLVTDEVLLVDQRIVENAKKTYDVAGTTALIAILEGTRLIVANVGDSRGVMCDSKGNAIPLSFDHKPQQMRERKRIKEAGGFIAFNGVWRVAGILATSRALGDYPLKDKKLVIADPDILTFDLSDHKPQFLILASDGLWDIFSNEEAVNFIKQRLGEELFGAKSLTLQAYYKGSLDNITVIVINLMNYDWAKAAQEDRKKNLSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein phosphatase 1L Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6.confidentQ8BHN0
Probable protein phosphatase 2C 59 Protein phosphatase that modulates defense response to pathogenic bacteria, conferring resistance and promoting salicylic acid (SA) accumulation.confidentQ8RXV3
Protein phosphatase 1L Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6.confidentQ5SGD2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007178 [BP]transmembrane receptor protein serine/threonine kinase signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0008360 [BP]regulation of cell shapeprobableGO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0006469 [BP]negative regulation of protein kinase activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0009892, GO:0043086, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0050789, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0045859, GO:0045936, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0051348, GO:0042325, GO:0032269, GO:0042326, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0035970 [BP]peptidyl-threonine dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004722 [MF]protein serine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I44, chain A
Confidence level:very confident
Coverage over the Query: 1-56,117,134-338
View the alignment between query and template
View the model in PyMOL