Diaphorina citri psyllid: psy14704


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MLEPYMGQLNNLKIVLASSSPRRSQILKSIGLKFEVIPSNFDESSIPVSKFKSNYGEYVSELAYKKALEVSQHLKEDNVEPDLIIGADTVVSINDMMLGKPEDEEEAKEFLSKLSGNTHSVFTGVAILTKDKDSRFYNQTQVTFANLTPAVISAYVKTREPL
ccHHHHHccccccEEEEcccHHHHHHHHHccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccEEEEccEEEcccccHHHHHHHHHHHccccEEEEEEEEEEEccEEEEEEEEEEEEEccccHHHHHHHHHccccc
*******QLNNLKIVLASSSPRRSQILKSIGLKFEVIPSNFDESSIPVSKFKSNYGEYVSELAYKKALEVSQHLKEDNVEPDLIIGADTVVSINDMMLGKPEDEEEAKEFLSKLSGNTHSVFTGVAILTKDKDSRFYNQTQVTFANLTPAVISAYVKTREPL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEPYMGQLNNLKIVLASSSPRRSQILKSIGLKFEVIPSNFDESSIPVSKFKSNYGEYVSELAYKKALEVSQHLKEDNVEPDLIIGADTVVSINDMMLGKPEDEEEAKEFLSKLSGNTHSVFTGVAILTKDKDSRFYNQTQVTFANLTPAVISAYVKTREPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Maf-like protein aq_1718 confidentO67613
Maf-like protein STH370 confidentQ67SI8
Maf-like protein Athe_1300 confidentB9MRU6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P5X, chain A
Confidence level:very confident
Coverage over the Query: 9-162
View the alignment between query and template
View the model in PyMOL