RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy14718
         (87 letters)



>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase.  Protein kinases (PKs), MAP/ERK
           kinase (MEK) subfamily, catalytic (c) domain. PKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine or tyrosine residues on protein
           substrates. The MEK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1
           and MEK2 are dual-specificity PKs that phosphorylate and
           activate the downstream targets, ERK(extracellular
           signal-regulated kinase) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK1/2, and finally to ERK1/2. The ERK
           cascade plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. This cascade has also been
           implicated in synaptic plasticity, migration,
           morphological determination, and stress response
           immunological reactions. Gain-of-function mutations in
           genes encoding ERK cascade proteins, including MEK1/2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 308

 Score =  148 bits (376), Expect = 5e-46
 Identities = 57/75 (76%), Positives = 66/75 (88%)

Query: 1   LIHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
           LIHLE+KP I+ QIIRELKVLHECN  +IVGFYGAF SD +ISICME+MDGGSLD +LKK
Sbjct: 33  LIHLEIKPAIRNQIIRELKVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKK 92

Query: 61  AGKIPEHILGTITSA 75
           AG+IPE+ILG I+ A
Sbjct: 93  AGRIPENILGKISIA 107


>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 1.  Protein kinases (PKs),
           MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK1 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK1, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding ERK cascade proteins, including MEK1,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients. MEK1 also plays a role in cell
           cycle control.
          Length = 333

 Score =  127 bits (319), Expect = 2e-37
 Identities = 57/87 (65%), Positives = 69/87 (79%)

Query: 1   LIHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
           LIHLE+KP I+ QIIREL+VLHECN  +IVGFYGAF SD +ISICME+MDGGSLD +LKK
Sbjct: 37  LIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKK 96

Query: 61  AGKIPEHILGTITSATHSSLIVIYYKY 87
           AG+IPE ILG ++ A    L  +  K+
Sbjct: 97  AGRIPEQILGKVSIAVIKGLTYLREKH 123


>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 2.  Protein kinases (PKs),
           MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK2 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK2, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding  ERK cascade proteins, including MEK2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 331

 Score =  121 bits (304), Expect = 4e-35
 Identities = 55/87 (63%), Positives = 68/87 (78%)

Query: 1   LIHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
           LIHLE+KP I+ QIIREL+VLHECN  +IVGFYGAF SD +ISICME+MDGGSLD +LK+
Sbjct: 37  LIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKE 96

Query: 61  AGKIPEHILGTITSATHSSLIVIYYKY 87
           A +IPE ILG ++ A    L  +  K+
Sbjct: 97  AKRIPEEILGKVSIAVLRGLAYLREKH 123


>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
           Protein Kinase, Mitogen-Activated Protein Kinase Kinase.
            Protein kinases (PKs), MAP kinase kinase (MAPKK)
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK or MAP2K), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK or
           MAP3K). MAPKKs are dual-specificity PKs that
           phosphorylate their downstream targets, MAPKs, at
           specific threonine and tyrosine residues. There are
           three MAPK subfamilies: extracellular signal-regulated
           kinase (ERK), c-Jun N-terminal kinase (JNK), and p38. In
           mammalian cells, there are seven MAPKKs (named MKK1-7)
           and 20 MAPKKKs. Each MAPK subfamily can be activated by
           at least two cognate MAPKKs and by multiple MAPKKKs.
          Length = 265

 Score =  115 bits (290), Expect = 1e-33
 Identities = 51/88 (57%), Positives = 64/88 (72%), Gaps = 1/88 (1%)

Query: 1   LIHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
            I LE+   I+KQI+REL +LH+CN  +IVGFYGAF ++ DISICMEYMDGGSLD ILK+
Sbjct: 33  TIRLEINEAIQKQILRELDILHKCNSPYIVGFYGAFYNNGDISICMEYMDGGSLDKILKE 92

Query: 61  A-GKIPEHILGTITSATHSSLIVIYYKY 87
             G+IPE ILG I  A    L  ++ K+
Sbjct: 93  VQGRIPERILGKIAVAVLKGLTYLHEKH 120


>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           Byr1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Byr1 from
           Schizosaccharomyces pombe, FUZ7 from Ustilago maydis,
           and related proteins. Byr1 phosphorylates its downstream
           target, the MAPK Spk1, and is regulated by the MAPKKK
           Byr2. The Spk1 cascade is pheromone-responsive and is
           essential for sporulation and sexual differentiation in
           fission yeast. FUZ7 phosphorylates and activates its
           target, the MAPK Crk1, which is required in mating and
           virulence in U. maydis.
          Length = 284

 Score =  113 bits (285), Expect = 1e-32
 Identities = 41/86 (47%), Positives = 59/86 (68%)

Query: 2   IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKA 61
           +H+  K +++KQI+REL+++HEC   +IV FYGAF+++ +I +CME+MD GSLD I KK 
Sbjct: 38  VHIGAKSSVRKQILRELQIMHECRSPYIVSFYGAFLNENNICMCMEFMDCGSLDRIYKKG 97

Query: 62  GKIPEHILGTITSATHSSLIVIYYKY 87
           G IP  ILG I  A    L  +Y  +
Sbjct: 98  GPIPVEILGKIAVAVVEGLTYLYNVH 123


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
           dual-specificity MAP kinase kinases and similar
           proteins.  Protein kinases (PKs), MAP kinase kinase
           (MAPKK) subfamily, Plant MAPKKs and similar proteins,
           catalytic (c) domain. PKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine or
           tyrosine residues on protein substrates. The MAPKK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein serine/threonine
           kinases, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The mitogen-activated protein
           (MAP) kinase signaling pathways are important mediators
           of cellular responses to extracellular signals. The
           pathways involve a triple kinase core cascade comprising
           of the MAP kinase (MAPK), which is phosphorylated and
           activated by a MAPK kinase (MAPKK or MKK), which itself
           is phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). Members of this group include MAPKKs
           from plants, kinetoplastids, alveolates, and mycetozoa.
           The MAPKK, LmxPK4, from Leishmania mexicana, is
           important in differentiation and virulence.
           Dictyostelium discoideum MEK1 is required for proper
           chemotaxis. MEK1 null mutants display severe defects in
           cell polarization and directional movement. Plants
           contain multiple MAPKKs like other eukaryotes. The
           Arabidopsis genome encodes for 10 MAPKKs while poplar
           and rice contain 13 MAPKKs each. The functions of these
           proteins have not been fully elucidated. There is
           evidence to suggest that MAPK cascades are involved in
           plant stress responses. In Arabidopsis, MKK3 plays a
           role in pathogen signaling, MKK2 is involved in cold and
           salt stress signaling, MKK4/MKK5 participates in innate
           immunity, and MKK7 regulates basal and systemic acquired
           resistance.
          Length = 264

 Score = 91.9 bits (229), Expect = 2e-24
 Identities = 36/73 (49%), Positives = 48/73 (65%)

Query: 2   IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKA 61
           IH++     +KQ++RELK L  C   ++V  YGAF  + +ISI +EYMDGGSL  +LKK 
Sbjct: 34  IHVDGDEEFRKQLLRELKTLRSCESPYVVKCYGAFYKEGEISIVLEYMDGGSLADLLKKV 93

Query: 62  GKIPEHILGTITS 74
           GKIPE +L  I  
Sbjct: 94  GKIPEPVLAYIAR 106


>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 5.  Protein kinases (PKs), MAP
           kinase kinase 5 (MKK5) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK5 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising of the MAP
           kinase (MAPK), which is phosphorylated and activated by
           a MAPK kinase (MAPKK or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a
           dual-specificity PK that phosphorylates its downstream
           target, extracellular signal-regulated kinase 5 (ERK5),
           on specific threonine and tyrosine residues. MKK5 is
           activated by MEKK2 and MEKK3 in response to mitogenic
           and stress stimuli. The ERK5 cascade promotes cell
           proliferation, differentiation, neuronal survival, and
           neuroprotection. This cascade plays an essential role in
           heart development. Mice deficient in either ERK5 or MKK5
           die around embryonic day 10 due to cardiovascular
           defects including underdevelopment of the myocardium. In
           addition, MKK5 is associated with metastasis and
           unfavorable prognosis in prostate cancer.
          Length = 279

 Score = 84.9 bits (210), Expect = 1e-21
 Identities = 37/75 (49%), Positives = 54/75 (72%), Gaps = 4/75 (5%)

Query: 1   LIHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
           +I L++   ++KQI+ EL++L++C+  +I+GFYGAF  +  ISIC E+MDGGSLD+    
Sbjct: 33  VIPLDITVELQKQIMSELEILYKCDSPYIIGFYGAFFVENRISICTEFMDGGSLDVY--- 89

Query: 61  AGKIPEHILGTITSA 75
             KIPEH+LG I  A
Sbjct: 90  -RKIPEHVLGRIAVA 103


>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase(MAPKK) subfamily, fungal
           Pek1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Pek1/Skh1 from
           Schizosaccharomyces pombe and MKK2 from Saccharomyces
           cerevisiae, and related proteins. Both fission yeast
           Pek1 and baker's yeast MKK2 are components of the cell
           integrity MAPK pathway. In fission yeast, Pek1
           phosphorylates and activates the MAPK Pmk1/Spm1 and is
           regulated by the MAPKKK Mkh1. In baker's yeast, the
           pathway involves the MAPK Slt2, the MAPKKs MKK1 and
           MKK2, and the MAPKKK Bck1. The cell integrity MAPK
           cascade is activated by multiple stress conditions, and
           is essential  in cell wall construction, morphogenesis,
           cytokinesis, and ion homeostasis.
          Length = 287

 Score = 80.2 bits (198), Expect = 7e-20
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 6/79 (7%)

Query: 8   PTIKKQIIRELKVLHECNFAHIVGFYGAFISDQD--ISICMEYMDGGSLDLILKK----A 61
           P ++KQI+REL++   C   +IV +YGAF+ +    I I MEY +GGSLD I KK     
Sbjct: 40  PDLQKQILRELEINKSCKSPYIVKYYGAFLDESSSSIGIAMEYCEGGSLDSIYKKVKKRG 99

Query: 62  GKIPEHILGTITSATHSSL 80
           G+I E +LG I  +    L
Sbjct: 100 GRIGEKVLGKIAESVLKGL 118


>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           PBS2-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Polymyxin B
           resistance protein 2 (PBS2) from Saccharomyces
           cerevisiae, Wis1 from Schizosaccharomyces pombe, and
           related proteins. PBS2 and Wis1 are components of
           stress-activated MAPK cascades in budding and fission
           yeast, respectively. PBS2 is the specific activator of
           the MAPK Hog1, which plays a central role in the
           response of budding yeast to stress including exposure
           to arsenite and hyperosmotic environments. Wis1
           phosphorylates and activates the MAPK Sty1 (also called
           Spc1 or Phh1), which stimulates a transcriptional
           response to a wide range of cellular insults through the
           bZip transcription factors Atf1, Pcr1, and Pap1.
          Length = 286

 Score = 75.3 bits (185), Expect = 6e-18
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 2   IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLIL--- 58
           I LE+  +   QII EL +LH+    +IV FYGAF  +  + +CMEYMD GSLD +    
Sbjct: 34  IRLELDESKFNQIIMELDILHKAVSPYIVDFYGAFFIEGAVYMCMEYMDAGSLDKLYAGG 93

Query: 59  KKAGKIPEHILGTITSAT 76
                IPE +L  IT A 
Sbjct: 94  VATEGIPEDVLRRITYAV 111


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 66.0 bits (162), Expect = 1e-14
 Identities = 21/72 (29%), Positives = 37/72 (51%)

Query: 2   IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKA 61
           I  +     +++I+RE+K+L +    +IV  Y  F  +  + + MEY +GG L  +LKK 
Sbjct: 32  IKKKKIKKDRERILREIKILKKLKHPNIVRLYDVFEDEDKLYLVMEYCEGGDLFDLLKKR 91

Query: 62  GKIPEHILGTIT 73
           G++ E       
Sbjct: 92  GRLSEDEARFYL 103


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The STE family is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases (STKs), protein
           tyrosine kinases (PTKs), RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This family is composed of STKs, and
           some dual-specificity PKs that phosphorylate both
           threonine and tyrosine residues of target proteins. Most
           members are kinases involved in mitogen-activated
           protein kinase (MAPK) signaling cascades, acting as MAPK
           kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
           kinase kinase kinases (MAP4Ks). The MAPK signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAPK, which is
           phosphorylated and activated by a MAPKK, which itself is
           phosphorylated and activated by a MAPKKK. Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAPKKK to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. Other STE family members include
           p21-activated kinases (PAKs) and class III myosins,
           among others. PAKs are Rho family GTPase-regulated
           kinases that serve as important mediators in the
           function of Cdc42 (cell division cycle 42) and Rac.
           Class III myosins are motor proteins containing an
           N-terminal kinase catalytic domain and a C-terminal
           actin-binding domain, which can phosphorylate several
           cytoskeletal proteins, conventional myosin regulatory
           light chains, as well as autophosphorylate the
           C-terminal motor domain. They play an important role in
           maintaining the structural integrity of photoreceptor
           cell microvilli.
          Length = 253

 Score = 66.1 bits (162), Expect = 1e-14
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 2   IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL-DLILKK 60
           I LE K   K++II E+++L +C   +IV +YG+++   ++ I ME+  GGSL DL+   
Sbjct: 33  IKLESK-EKKEKIINEIQILKKCKHPNIVKYYGSYLKKDELWIVMEFCSGGSLKDLLKST 91

Query: 61  AGKIPEHILGTITSATHSSLIVI 83
              + E  +  +       L  +
Sbjct: 92  NQTLTESQIAYVCKELLKGLEYL 114


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 60.0 bits (146), Expect = 2e-12
 Identities = 18/68 (26%), Positives = 29/68 (42%)

Query: 5   EVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKI 64
             K    +   RE+++L   +  +IV    AF     + + MEY +GG L   L + G +
Sbjct: 36  SEKSKKDQTARREIRILRRLSHPNIVRLIDAFEDKDHLYLVMEYCEGGDLFDYLSRGGPL 95

Query: 65  PEHILGTI 72
            E     I
Sbjct: 96  SEDEAKKI 103


>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 7.  Protein kinases (PKs), MAP
           kinase kinase 7 (MKK7) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK7 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK7 is a dual-specificity PK that phosphorylates and
           activates its downstream target, c-Jun N-terminal kinase
           (JNK), on specific threonine and tyrosine residues.
           Although MKK7 is capable of dual phosphorylation, it
           prefers to phosphorylate the threonine residue of JNK.
           Thus, optimal activation of JNK requires both MKK4 (not
           included in this subfamily) and MKK7. MKK7 is primarily
           activated by cytokines. MKK7 is essential for liver
           formation during embryogenesis. It plays roles in G2/M
           cell cycle arrest and cell growth. In addition, it is
           involved in the control of programmed cell death, which
           is crucial in oncogenesis, cancer chemoresistance, and
           antagonism to TNFalpha-induced killing, through its
           inhibition by Gadd45beta and the subsequent suppression
           of the JNK cascade.
          Length = 296

 Score = 57.4 bits (139), Expect = 2e-11
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 7/74 (9%)

Query: 11  KKQIIRELKVL---HECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKA-GKIPE 66
            K+I+ +L V+   H+C   +IV  YG FI+D D+ ICME M    LD +LK+  G IPE
Sbjct: 57  NKRILMDLDVVLKSHDC--PYIVKCYGYFITDSDVFICMELM-STCLDKLLKRIQGPIPE 113

Query: 67  HILGTITSATHSSL 80
            ILG +T A   +L
Sbjct: 114 DILGKMTVAIVKAL 127


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein
          Kinases (PKs), catalytic (c) domain. PKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine or tyrosine residues on protein
          substrates. The PK family is part of a larger
          superfamily that includes the catalytic domains of RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, phosphoinositide 3-kinase (PI3K), and
          actin-fragmin kinase. PKs make up a large family of
          serine/threonine kinases, protein tyrosine kinases
          (PTKs), and dual-specificity PKs that phosphorylate
          both serine/threonine and tyrosine residues of target
          proteins. Majority of protein phosphorylation, about
          95%, occurs on serine residues while only 1% occurs on
          tyrosine residues. Protein phosphorylation is a
          mechanism by which a wide variety of cellular proteins,
          such as enzymes and membrane channels, are reversibly
          regulated in response to certain stimuli. PKs often
          function as components of signal transduction pathways
          in which one kinase activates a second kinase, which in
          turn, may act on other kinases; this sequential action
          transmits a signal from the cell surface to target
          proteins, which results in cellular responses. The PK
          family is one of the largest known protein families
          with more than 100 homologous yeast enzymes and 550
          human proteins. A fraction of PK family members are
          pseudokinases that lack crucial residues for catalytic
          activity. The mutiplicity of kinases allows for
          specific regulation according to substrate, tissue
          distribution, and cellular localization. PKs regulate
          many cellular processes including proliferation,
          division, differentiation, motility, survival,
          metabolism, cell-cycle progression, cytoskeletal
          rearrangement, immunity, and neuronal functions. Many
          kinases are implicated in the development of various
          human diseases including different types of cancer.
          Length = 215

 Score = 56.5 bits (137), Expect = 2e-11
 Identities = 23/66 (34%), Positives = 41/66 (62%), Gaps = 1/66 (1%)

Query: 2  IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL-DLILKK 60
          I  E   ++ ++++RE+++L + N  +IV  YG F  +  + + MEY +GGSL DL+ + 
Sbjct: 26 IKKEDSSSLLEELLREIEILKKLNHPNIVKLYGVFEDENHLYLVMEYCEGGSLKDLLKEN 85

Query: 61 AGKIPE 66
           GK+ E
Sbjct: 86 EGKLSE 91


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 53.8 bits (130), Expect = 4e-10
 Identities = 20/63 (31%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL-DLILKKAGKIPEHIL 69
           K+ II E+ ++ +C   +IV +Y +++   ++ + MEYMDGGSL D+I +   ++ E  +
Sbjct: 59  KELIINEILIMKDCKHPNIVDYYDSYLVGDELWVVMEYMDGGSLTDIITQNFVRMNEPQI 118

Query: 70  GTI 72
             +
Sbjct: 119 AYV 121


>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
           protein kinase 3-like Protein Serine/Threonine Kinases. 
           Serine/threonine kinases (STKs), mammalian Ste20-like
           protein kinase 3 (MST3)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST3-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST3, MST4,
           STK25, Schizosaccharomyces pombe Nak1 and Sid1,
           Saccharomyces cerevisiae sporulation-specific protein 1
           (SPS1), and related proteins. Nak1 is required by
           fission yeast for polarizing the tips of actin
           cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Sid1 is a component in the septation initiation network
           (SIN) signaling pathway, and plays a role in
           cytokinesis. SPS1 plays a role in regulating proteins
           required for spore wall formation. MST4 plays a role in
           mitogen-activated protein kinase (MAPK) signaling during
           cytoskeletal rearrangement, morphogenesis, and
           apoptosis. MST3 phosphorylates the STK NDR and may play
           a role in cell cycle progression and cell morphology.
           STK25 may play a role in the regulation of cell
           migration and polarization.
          Length = 274

 Score = 52.6 bits (127), Expect = 1e-09
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 14  IIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGS-LDLILKKAGKIPEHILGTI 72
           I +E++ L +C   +I  +YG+F+    + I MEY  GGS LDL+  K GK+ E  +  I
Sbjct: 46  IQQEIQFLSQCRSPYITKYYGSFLKGSKLWIIMEYCGGGSCLDLL--KPGKLDETYIAFI 103

Query: 73  T 73
            
Sbjct: 104 L 104


>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
          protein kinase kinase kinase kinase-like Protein
          Serine/Threonine Kinases.  Serine/threonine kinases
          (STKs), mitogen-activated protein kinase (MAPK) kinase
          kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAP4K3-like
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily includes
          MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins.
          Vertebrate members contain an N-terminal catalytic
          domain and a C-terminal citron homology (CNH)
          regulatory domain, similar to MAP4K4/6. MAP4Ks are
          involved in some MAPK signaling pathways that are
          important in mediating cellular responses to
          extracellular signals by activating a MAPK kinase
          kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
          activated either by a small GTP-binding protein or by
          an adaptor protein, which transmits the signal either
          directly to a MAP3K to start the triple kinase core
          cascade or indirectly through a mediator kinase, a
          MAP4K. MAP4K1, also called haematopoietic progenitor
          kinase 1 (HPK1), is a hematopoietic-specific STK
          involved in many cellular signaling cascades including
          MAPK, antigen receptor, apoptosis, growth factor, and
          cytokine signaling. It participates in the regulation
          of T cell receptor signaling and T cell-mediated immune
          responses. MAP4K2 was referred to as germinal center
          (GC) kinase because of its preferred location in GC B
          cells. MAP4K3 plays a role in the nutrient-responsive
          pathway of mTOR (mammalian target of rapamycin)
          signaling. It is required in the activation of S6
          kinase by amino acids and for the phosphorylation of
          the mTOR-regulated inhibitor of eukaryotic initiation
          factor 4E. MAP4K5, also called germinal center
          kinase-related enzyme (GCKR), has been shown to
          activate the MAPK c-Jun N-terminal kinase (JNK).
          Length = 262

 Score = 52.3 bits (126), Expect = 1e-09
 Identities = 17/49 (34%), Positives = 29/49 (59%)

Query: 12 KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          + I +E+ +L EC   +IV ++G+++    + I MEY  GGSL  I + 
Sbjct: 45 EIIQQEISMLKECRHPNIVAYFGSYLRRDKLWIVMEYCGGGSLQDIYQV 93


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
           Kinase, Never In Mitosis gene A-related kinase.
           Serine/Threonine Kinases (STKs), Never In Mitosis gene A
           (NIMA)-related kinase (Nek) family, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek family is
           composed of 11 different mammalian members (Nek1-11)
           with similarity to the catalytic domain of Aspergillus
           nidulans NIMA kinase, the founding member of the Nek
           family which was identified in a screen for cell cycle
           mutants that were prevented from entering mitosis. Neks
           contain a conserved N-terminal catalytic domain and a
           more divergent C-terminal regulatory region of various
           sizes and structures. They are involved in the
           regulation of downstream processes following the
           activation of Cdc2, and many of their functions are cell
           cycle-related. They play critical roles in microtubule
           dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 51.3 bits (124), Expect = 3e-09
 Identities = 18/58 (31%), Positives = 31/58 (53%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHI 68
           ++  + E+K+L + N  +I+ +Y +F     + I MEY DGG L   +KK  K  +  
Sbjct: 43  REDALNEVKILKKLNHPNIIKYYESFEEKGKLCIVMEYADGGDLSQKIKKQKKEGKPF 100


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
          Serine/Threonine Kinases, Mammalian Ste20-like protein
          kinase 1 and 2.  Serine/threonine kinases (STKs),
          mammalian Ste20-like protein kinase 1 (MST1) and MST2
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MST1/2 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of MST1, MST2, and related proteins including
          Drosophila Hippo and Dictyostelium discoideum Krs1
          (kinase responsive to stress 1). MST1/2 and Hippo are
          involved in a conserved pathway that governs cell
          contact inhibition, organ size control, and tumor
          development. MST1 activates the mitogen-activated
          protein kinases (MAPKs) p38 and c-Jun N-terminal kinase
          (JNK) through MKK7 (a MAPK kinase) and MEKK1 (a MAPK
          kinase kinase) by acting as a MAPK kinase kinase kinase
          (MAPKKKK). Activation of JNK by MST1 leads to caspase
          activation and apoptosis. MST1 has also been implicated
          in cell proliferation and differentiation. Krs1 may
          regulate cell growth arrest and apoptosis in response
          to cellular stress.
          Length = 256

 Score = 50.0 bits (120), Expect = 7e-09
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 4  LEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGK 63
          + V+  ++ +II+E+ +L +C+  +IV +YG++  + D+ I MEY   GS+  I+K   K
Sbjct: 36 VPVEEDLQ-EIIKEISILKQCDSPYIVKYYGSYFKNTDLWIVMEYCGAGSVSDIMKITNK 94


>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
           Serine/Threonine Kinases, Oxidative stress response
           kinase and Ste20-related proline alanine-rich kinase.
           Serine/threonine kinases (STKs), oxidative stress
           response kinase (OSR1) and Ste20-related proline
           alanine-rich kinase (SPAK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The OSR1 and SPAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. SPAK is also referred to as STK39 or PASK
           (proline-alanine-rich STE20-related kinase). OSR1 and
           SPAK regulate the activity of cation-chloride
           cotransporters through direct interaction and
           phosphorylation. They are also implicated in
           cytoskeletal rearrangement, cell differentiation,
           transformation and proliferation. OSR1 and SPAK contain
           a conserved C-terminal (CCT) domain, which recognizes a
           unique motif ([RK]FX[VI]) present in their activating
           kinases (WNK1/WNK4) and their substrates.
          Length = 267

 Score = 50.0 bits (120), Expect = 8e-09
 Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 2   IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILK-- 59
           I LE   T   ++ +E++ + +CN  ++V +Y +F+   ++ + M Y+ GGSL  I+K  
Sbjct: 34  IDLEKCQTSVDELRKEVQAMSQCNHPNVVKYYTSFVVGDELWLVMPYLSGGSLLDIMKSS 93

Query: 60  -KAGKIPEHILGTI 72
              G + E I+ T+
Sbjct: 94  YPRGGLDEAIIATV 107


>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 4.  Protein kinases (PKs), MAP
           kinase kinase 4 (MKK4) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK4 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising of the MAP
           kinase (MAPK), which is phosphorylated and activated by
           a MAPK kinase (MAPKK or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). MKK4 is a dual-specificity PK that
           phosphorylates and activates the downstream targets,
           c-Jun N-terminal kinase (JNK) and p38 MAPK, on specific
           threonine and tyrosine residues. JNK and p38 are
           collectively known as stress-activated MAPKs, as they
           are activated in response to a variety of environmental
           stresses and pro-inflammatory cytokines. Their
           activation is associated with the induction of cell
           death. Mice deficient in MKK4 die during embryogenesis
           and display anemia, severe liver hemorrhage, and
           abnormal hepatogenesis. MKK4 may also play roles in the
           immune system and in cardiac hypertrophy. It plays a
           major role in cancer as a tumor and metastasis
           suppressor. Under certain conditions, MKK4 is
           pro-oncogenic.
          Length = 288

 Score = 49.7 bits (119), Expect = 9e-09
 Identities = 32/83 (38%), Positives = 41/83 (49%), Gaps = 11/83 (13%)

Query: 2   IHLEVKPTIKKQIIRELKVL---HECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLIL 58
           I   V    +K+++ +L V+    +C +  IV FYGA   + D  ICME MD  SLD   
Sbjct: 37  IRSTVDEKEQKRLLMDLDVVMRSSDCPY--IVKFYGALFREGDCWICMELMD-ISLDKFY 93

Query: 59  K-----KAGKIPEHILGTITSAT 76
           K         IPE ILG I  AT
Sbjct: 94  KYVYEVLKSVIPEEILGKIAVAT 116


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-Activated Protein
           Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
           mitogen-activated protein kinase (MAPK) kinase kinase
           (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
           MAP/ERK kinase kinases (MEKKs) in some cases. They
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           This subfamily is composed of the Apoptosis
           Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
           MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
           and fungal MAPKKKs. Also included in this subfamily are
           the cell division control proteins Schizosaccharomyces
           pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 49.1 bits (118), Expect = 2e-08
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISIC--MEYMDGGSLDLILKKAGKIPEH 67
           + + RE+++L      +IV +YG+   ++  ++   +EY+ GGSL  +LKK GK+PE 
Sbjct: 44  EALEREIRILSSLQHPNIVRYYGSERDEEKNTLNIFLEYVSGGSLSSLLKKFGKLPEP 101


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control
           protein 7-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs),  (Cdc7)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Cdc7-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include
           Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae
           Cdc15, Arabidopsis thaliana mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK) epsilon, and
           related proteins. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Fission yeast Cdc7
           is essential for cell division by playing a key role in
           the initiation of septum formation and cytokinesis.
           Budding yeast Cdc15 functions to coordinate mitotic exit
           with cytokinesis. Arabidopsis MAPKKK epsilon is required
           for pollen development in the plasma membrane.
          Length = 254

 Score = 48.8 bits (117), Expect = 2e-08
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHI 68
           K I++E+ +L      +IV + G+  +   + I +EY + GSL  I+KK G  PE +
Sbjct: 44  KSIMQEIDLLKNLKHPNIVKYIGSIETSDSLYIILEYAENGSLRQIIKKFGPFPESL 100


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4
           (MEKK4) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK4 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK4 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK4 activates the c-Jun
           N-terminal kinase (JNK) and p38 MAPK signaling pathways
           by directly activating their respective MAPKKs,
           MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively
           known as stress-activated MAPKs, as they are activated
           in response to a variety of environmental stresses and
           pro-inflammatory cytokines. MEKK4 also plays roles in
           the re-polarization of the actin cytoskeleton in
           response to osmotic stress, in the proper closure of the
           neural tube, in cardiovascular development, and in
           immune responses.
          Length = 264

 Score = 46.2 bits (110), Expect = 2e-07
 Identities = 21/67 (31%), Positives = 36/67 (53%)

Query: 7   KPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
            P   K+I  E+KVL      ++V +YG  +  + + I MEY  GG+L+ +L+    + E
Sbjct: 39  DPKTIKEIADEMKVLELLKHPNLVKYYGVEVHREKVYIFMEYCSGGTLEELLEHGRILDE 98

Query: 67  HILGTIT 73
           H++   T
Sbjct: 99  HVIRVYT 105


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
          Phosphotransferases. Tyrosine-specific kinase
          subfamily.
          Length = 257

 Score = 46.4 bits (111), Expect = 2e-07
 Identities = 14/53 (26%), Positives = 29/53 (54%)

Query: 11 KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGK 63
           ++ +RE +++ + +  ++V   G    ++ + I MEYM+GG L   L+K   
Sbjct: 45 IEEFLREARIMRKLDHPNVVKLLGVCTEEEPLYIVMEYMEGGDLLSYLRKNRP 97


>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
          Phosphotransferases. The specificity of this class of
          kinases can not be predicted. Possible dual-specificity
          Ser/Thr/Tyr kinase.
          Length = 258

 Score = 46.0 bits (110), Expect = 2e-07
 Identities = 15/53 (28%), Positives = 28/53 (52%)

Query: 11 KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGK 63
           ++ +RE +++ + +  +IV   G    ++ + I MEYM GG L   L+K   
Sbjct: 45 IEEFLREARIMRKLDHPNIVKLLGVCTEEEPLMIVMEYMPGGDLLDYLRKNRP 97


>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity
           Protein Kinases, MAP kinase kinases 3 and 6.  Protein
           kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MKK3 and MKK6 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK3 and MKK6 are dual-specificity PKs that
           phosphorylate and activate their downstream target, p38
           MAPK, on specific threonine and tyrosine residues.
           MKK3/6 plays roles in the regulation of cell cycle
           progression, cytokine- and stress-induced apoptosis,
           oncogenic transformation, and adult tissue regeneration.
           In addition, MKK6 plays a critical role in osteoclast
           survival in inflammatory disease while MKK3 is
           associated with tumor invasion, progression, and poor
           patient survival in glioma.
          Length = 283

 Score = 46.3 bits (110), Expect = 2e-07
 Identities = 33/95 (34%), Positives = 45/95 (47%), Gaps = 13/95 (13%)

Query: 2   IHLEVKPTIKKQIIRELKV-LHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
           I   V    +K+++ +L + +   +  + V FYGA   + D+ ICME MD  SLD   KK
Sbjct: 34  IRATVNSQEQKRLLMDLDISMRSVDCPYTVTFYGALFREGDVWICMEVMD-TSLDKFYKK 92

Query: 61  AGK----IPEHILGTIT-------SATHSSLIVIY 84
                  IPE ILG I           HS L VI+
Sbjct: 93  VYDKGLTIPEDILGKIAVSIVKALEYLHSKLSVIH 127


>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
           Protein Tyrosine Kinase (PTK) family, catalytic domain.
           This PTKc family is part of a larger superfamily that
           includes the catalytic domains of protein
           serine/threonine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. They can be classified
           into receptor and non-receptor tyr kinases. PTKs play
           important roles in many cellular processes including,
           lymphocyte activation, epithelium growth and
           maintenance, metabolism control, organogenesis
           regulation, survival, proliferation, differentiation,
           migration, adhesion, motility, and morphogenesis.
           Receptor tyr kinases (RTKs) are integral membrane
           proteins which contain an extracellular ligand-binding
           region, a transmembrane segment, and an intracellular
           tyr kinase domain. RTKs are usually activated through
           ligand binding, which causes dimerization and
           autophosphorylation of the intracellular tyr kinase
           catalytic domain, leading to intracellular signaling.
           Some RTKs are orphan receptors with no known ligands.
           Non-receptor (or cytoplasmic) tyr kinases are
           distributed in different intracellular compartments and
           are usually multi-domain proteins containing a catalytic
           tyr kinase domain as well as various regulatory domains
           such as SH3 and SH2. PTKs are usually autoinhibited and
           require a mechanism for activation. In many PTKs, the
           phosphorylation of tyr residues in the activation loop
           is essential for optimal activity. Aberrant expression
           of PTKs is associated with many development
           abnormalities and cancers.
          Length = 262

 Score = 45.6 bits (109), Expect = 2e-07
 Identities = 15/66 (22%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL-DLILKKAGKIPEHIL 69
           +K  ++E +V+ +    ++V   G    ++ + + +EYM+GG L D + K     P    
Sbjct: 40  RKDFLKEARVMKKLGHPNVVRLLGVCTEEEPLYLVLEYMEGGDLLDYLRKSRPVFPSPEK 99

Query: 70  GTITSA 75
            T++  
Sbjct: 100 STLSLK 105


>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-activated protein
           kinase kinase kinase kinase 5.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to MAP4K4/6. MAP4Ks are involved in some MAPK
           signaling pathways that are important in mediating
           cellular responses to extracellular signals by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). Each MAPK cascade is activated either by a small
           GTP-binding protein or by an adaptor protein, which
           transmits the signal either directly to a MAP3K to start
           the triple kinase core cascade or indirectly through a
           mediator kinase, a MAP4K. MAP4K5, also called germinal
           center kinase-related enzyme (GCKR), has been shown to
           activate the MAPK c-Jun N-terminal kinase (JNK). MAP4K5
           also facilitates Wnt signaling in B cells, and may
           therefore be implicated in the control of cell fate,
           proliferation, and polarity.
          Length = 267

 Score = 45.4 bits (107), Expect = 3e-07
 Identities = 23/73 (31%), Positives = 40/73 (54%)

Query: 14  IIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHILGTIT 73
           I +E+ ++ EC   +IV ++G+++S + + ICMEY  GGSL  I    G + E  +  + 
Sbjct: 53  IQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYVC 112

Query: 74  SATHSSLIVIYYK 86
             T   L  ++ K
Sbjct: 113 RETLQGLAYLHSK 125


>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase. 
          Length = 258

 Score = 45.2 bits (108), Expect = 4e-07
 Identities = 13/50 (26%), Positives = 25/50 (50%)

Query: 11 KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          +++ + E  ++ + +  +IV   G     + + I  EYM GG L   L+K
Sbjct: 45 REEFLEEASIMKKLSHPNIVRLLGVCTQGEPLYIVTEYMPGGDLLDFLRK 94


>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 2.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek2 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek2
           subfamily includes Aspergillus nidulans NIMA kinase, the
           founding member of the Nek family, which was identified
           in a screen for cell cycle mutants prevented from
           entering mitosis. NIMA is essential for mitotic entry
           and progression through mitosis, and its degradation is
           essential for mitotic exit. NIMA is involved in nuclear
           membrane fission. Vertebrate Nek2 is a cell
           cycle-regulated STK, localized in centrosomes and
           kinetochores, that regulates centrosome splitting at the
           G2/M phase. It also interacts with other mitotic kinases
           such as Polo-like kinase 1 and may play a role in
           spindle checkpoint. An increase in the expression of the
           human NEK2 gene is strongly associated with the
           progression of non-Hodgkin lymphoma.
          Length = 265

 Score = 43.4 bits (103), Expect = 2e-06
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 6/64 (9%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFI--SDQDISICMEYMDGGSLDLILKKAGK----I 64
           K+Q++ E+ +L E    +IV +Y   I  S+Q + I MEY +GG L  +++K  K    I
Sbjct: 43  KQQLVSEVNILRELKHPNIVRYYDRIIDRSNQTLYIVMEYCEGGDLAQLIQKCKKERKYI 102

Query: 65  PEHI 68
            E  
Sbjct: 103 EEEF 106


>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase;
           Provisional.
          Length = 353

 Score = 43.3 bits (102), Expect = 2e-06
 Identities = 17/47 (36%), Positives = 33/47 (70%)

Query: 9   TIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLD 55
           T+++QI RE+++L + N  ++V  +  F  + +I + +E+MDGGSL+
Sbjct: 114 TVRRQICREIEILRDVNHPNVVKCHDMFDHNGEIQVLLEFMDGGSLE 160


>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mammalian Ste20-like protein
           kinase 3.  Serine/threonine kinases (STKs), mammalian
           Ste20-like protein kinase 3 (MST3) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MST3
           phosphorylates the STK NDR and may play a role in cell
           cycle progression and cell morphology. It may also
           regulate paxillin and consequently, cell migration. MST3
           is present in human placenta, where it plays an
           essential role in the oxidative stress-induced apoptosis
           of trophoblasts in normal spontaneous delivery.
           Dysregulation of trophoblast apoptosis may result in
           pregnancy complications such as preeclampsia and
           intrauterine growth retardation.
          Length = 277

 Score = 43.1 bits (101), Expect = 3e-06
 Identities = 25/73 (34%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 1   LIHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGS-LDLILK 59
           +I LE      + I +E+ VL +C+  ++  +YG+++ D  + I MEY+ GGS LDL+  
Sbjct: 36  IIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLL-- 93

Query: 60  KAGKIPEHILGTI 72
           + G + E  + TI
Sbjct: 94  EPGPLDETQIATI 106


>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, STK25 or Yeast
           Sps1/Ste20-related kinase 1.  Serine/threonine kinases
           (STKs), STK25 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The STK25 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. STK25 is also called Ste20/oxidant stress
           response kinase 1 (SOK1) or yeast Sps1/Ste20-related
           kinase 1 (YSK1). STK25 is localized in the Golgi
           apparatus through its interaction with the Golgi matrix
           protein GM130. It may play a role in the regulation of
           cell migration and polarization. STK25 binds and
           phosphorylates CCM3 (cerebral cavernous malformation 3),
           also called PCD10 (programmed cell death 10), and may
           play a role in apoptosis. Human STK25 is a candidate
           gene responsible for pseudopseudohypoparathyroidism
           (PPHP), a disease that shares features with the Albright
           hereditary osteodystrophy (AHO) phenotype.
          Length = 277

 Score = 42.7 bits (100), Expect = 3e-06
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 1   LIHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGS-LDLILK 59
           +I LE      + I +E+ VL +C+  +I  +YG+++    + I MEY+ GGS LDL+  
Sbjct: 36  IIDLEEAEDEIEDIQQEITVLSQCDSPYITRYYGSYLKGTKLWIIMEYLGGGSALDLL-- 93

Query: 60  KAGKIPEHILGTI 72
           K G + E  + TI
Sbjct: 94  KPGPLEETYIATI 106


>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like
          kinase-like Protein Serine/Threonine Kinases.
          Serine/threonine kinases (STKs), Ste20-like kinase
          (SLK)-like subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The SLK-like subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Members of the
          subfamily include SLK, STK10 (also called LOK for
          lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni
          SLK), and related proteins. SLK promotes apoptosis
          through apoptosis signal-regulating kinase 1 (ASK1) and
          the mitogen-activated protein kinase (MAPK) p38. It
          also plays a role in mediating actin reorganization.
          STK10 is responsible in regulating the CD28 responsive
          element in T cells, as well as leukocyte function
          associated antigen (LFA-1)-mediated lymphocyte
          adhesion. SmSLK is capable of activating the MAPK Jun
          N-terminal kinase (JNK) pathway in human embryonic
          kidney (HEK) cells as well as in Xenopus oocytes. It
          may participate in regulating MAPK cascades during
          host-parasite interactions.
          Length = 280

 Score = 42.0 bits (99), Expect = 5e-06
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 17 ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGK 63
          E+ +L EC   +IVG Y A+  +  + I +E+ DGG+LD I+ +  +
Sbjct: 52 EIDILSECKHPNIVGLYEAYFYENKLWILIEFCDGGALDSIMLELER 98


>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
          Serine/Threonine Kinase, cGMP-dependent protein kinase.
           Serine/Threonine Kinases (STKs), cGMP-dependent
          protein kinase (cGK or PKG) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The cGK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Mammals have two cGK
          isoforms from different genes, cGKI and cGKII. cGKI
          exists as two splice variants, cGKI-alpha and
          cGKI-beta. cGK consists of an N-terminal regulatory
          domain containing a dimerization and an autoinhibitory
          pseudosubstrate region, two cGMP-binding domains, and a
          C-terminal catalytic domain. Binding of cGMP to both
          binding sites releases the inhibition of the catalytic
          center by the pseudosubstrate region, allowing
          autophosphorylation and activation of the kinase. cGKI
          is a  soluble protein expressed in all smooth muscles,
          platelets, cerebellum, and kidney. It is also expressed
          at lower concentrations in other tissues. cGKII is a
          membrane-bound protein that is most abundantly
          expressed in the intestine. It is also present in the
          brain nuclei, adrenal cortex, kidney, lung, and
          prostate. cGKI is involved in the regulation of smooth
          muscle tone, smooth cell proliferation, and platelet
          activation. cGKII plays a role in the regulation of
          secretion, such as renin secretion by the kidney and
          aldosterone secretion by the adrenal. It also regulates
          bone growth and the circadian rhythm.
          Length = 262

 Score = 41.8 bits (99), Expect = 6e-06
 Identities = 22/61 (36%), Positives = 30/61 (49%)

Query: 6  VKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIP 65
          V+   ++ I  E ++L ECN   IV  Y  F   + I + MEY  GG L  IL+  G   
Sbjct: 32 VETGQQEHIFSEKEILEECNHPFIVKLYRTFKDKKYIYMLMEYCLGGELWTILRDRGLFD 91

Query: 66 E 66
          E
Sbjct: 92 E 92


>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 1.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1
           (MEKK1) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK1 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK1 activates the extracellular
           signal-regulated kinase 1/2 (ERK1/2) and c-Jun
           N-terminal kinase (JNK) pathways by activating their
           respective MAPKKs, MEK1/2 and MKK4/MKK7, respectively.
           MEKK1 is important in regulating cell survival and
           apoptosis. MEKK1 also plays a role in cell migration,
           tissue maintenance and homeostasis, and wound healing.
          Length = 268

 Score = 41.8 bits (98), Expect = 7e-06
 Identities = 16/58 (27%), Positives = 32/58 (55%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHIL 69
           + + +E++++   N  HI+   GA   D   ++ +E+M GGS+  +L K G   E ++
Sbjct: 48  EALRKEIRLMARLNHPHIIRMLGATCEDSHFNLFVEWMAGGSVSHLLSKYGAFKEAVI 105


>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mammalian Ste20-like protein
           kinase 4.  Serine/threonine kinases (STKs), mammalian
           Ste20-like protein kinase 4 (MST4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MST4 is sometimes
           referred to as MASK (MST3 and SOK1-related kinase). It
           plays a role in mitogen-activated protein kinase (MAPK)
           signaling during cytoskeletal rearrangement,
           morphogenesis, and apoptosis. It influences cell growth
           and transformation by modulating the extracellular
           signal-regulated kinase (ERK) pathway. MST4 may also
           play a role in tumor formation and progression. It
           localizes in the Golgi apparatus by interacting with the
           Golgi matrix protein GM130 and may play a role in cell
           migration.
          Length = 277

 Score = 41.6 bits (97), Expect = 7e-06
 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 1   LIHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGS-LDLILK 59
           +I LE      + I +E+ VL +C+  ++  +YG+++    + I MEY+ GGS LDL+  
Sbjct: 36  IIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLL-- 93

Query: 60  KAGKIPEHILGTI 72
           +AG   E  + T+
Sbjct: 94  RAGPFDEFQIATM 106


>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein
          Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2
          and similar domains.  Serine/Threonine Kinases (STKs),
          Chlamydomonas reinhardtii FA2-like subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The Chlamydomonas
          reinhardtii FA2-like subfamily belongs to the
          (NIMA)-related kinase (Nek) family. The Nek family
          includes seven different Chlamydomonas Neks (CNKs 1-6
          and Fa2). This subfamily includes FA2 and CNK4.  The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase.  Chlamydomonas reinhardtii
          FA2 was discovered in a genetic screen for
          deflagellation-defective mutants. It is essential for
          basal-body/centriole-associated microtubule severing,
          and plays a role in cell cycle progression. No cellular
          function has yet been ascribed to CNK4.
          Length = 256

 Score = 41.3 bits (97), Expect = 8e-06
 Identities = 16/55 (29%), Positives = 32/55 (58%)

Query: 11 KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIP 65
          +++ I E +VL + + ++I+ +Y +F+    ++I MEY + G L  +LK     P
Sbjct: 43 REEAIDEARVLAKLDSSYIIRYYESFLDKGKLNIVMEYAENGDLHKLLKMQRGRP 97


>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-activated protein
           kinase kinase kinase kinase 3.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to MAP4K4/6. MAP4Ks are involved in some MAPK
           signaling pathways that are important in mediating
           cellular responses to extracellular signals by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). Each MAPK cascade is activated either by a small
           GTP-binding protein or by an adaptor protein, which
           transmits the signal either directly to a MAP3K to start
           the triple kinase core cascade or indirectly through a
           mediator kinase, a MAP4K. MAP4K3 plays a role in the
           nutrient-responsive pathway of mTOR (mammalian target of
           rapamycin) signaling. MAP4K3 is required in the
           activation of S6 kinase by amino acids and for the
           phosphorylation of the mTOR-regulated inhibitor of
           eukaryotic initiation factor 4E. mTOR regulates ribosome
           biogenesis and protein translation, and is frequently
           deregulated in cancer.
          Length = 267

 Score = 41.2 bits (96), Expect = 1e-05
 Identities = 19/71 (26%), Positives = 39/71 (54%)

Query: 16  RELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHILGTITSA 75
           +E+ ++ +C  ++IV ++G+++    + ICME+  GGSL  I    G + E  +  ++  
Sbjct: 55  QEIIMMKDCKHSNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSESQIAYVSRE 114

Query: 76  THSSLIVIYYK 86
           T   L  ++ K
Sbjct: 115 TLQGLYYLHSK 125


>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
           Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. 
           Serine/threonine kinases (STKs), plant MAP/ERK kinase
           kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The plant MEKK1 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of plant mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
           including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
           is a MAPKKK that phosphorylates and activates MAPK
           kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Arabidopsis thaliana
           MEKK1 activates MPK4, a MAPK that regulates systemic
           acquired resistance. MEKK1 also participates in the
           regulation of temperature-sensitive and tissue-specific
           cell death.
          Length = 258

 Score = 41.3 bits (97), Expect = 1e-05
 Identities = 19/55 (34%), Positives = 32/55 (58%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
           KQ+ +E+ +L +    +IV + G    + ++ I +E + GGSL  +LKK G  PE
Sbjct: 47  KQLEQEIALLSKLQHPNIVQYLGTEREEDNLYIFLELVPGGSLAKLLKKYGSFPE 101


>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 7.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 7 (CDK7) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK7 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK7 plays essential roles in the cell cycle
          and in transcription. It associates with cyclin H and
          MAT1 and acts as a CDK-Activating Kinase (CAK) by
          phosphorylating and activating cell cycle CDKs
          (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is
          also a component of the general transcription factor
          TFIIH, which phosphorylates the C-terminal domain (CTD)
          of RNA polymerase II when it is bound with
          unphosphorylated DNA, as present in the pre-initiation
          complex. Following phosphorylation, the CTD dissociates
          from the DNA which allows transcription initiation.
          Length = 298

 Score = 40.3 bits (95), Expect = 2e-05
 Identities = 11/37 (29%), Positives = 21/37 (56%)

Query: 15 IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDG 51
          +RE+K+L E    +I+G    F    +I++  E+M+ 
Sbjct: 50 LREIKLLQELKHPNIIGLLDVFGHKSNINLVFEFMET 86


>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
           myosin-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), Class III myosin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins with an N-terminal kinase catalytic domain and
           a C-terminal actin-binding motor domain. Class III
           myosins are present in the photoreceptors of
           invertebrates and vertebrates and in the auditory hair
           cells of mammals. The kinase domain of myosin III can
           phosphorylate several cytoskeletal proteins,
           conventional myosin regulatory light chains, and can
           autophosphorylate the C-terminal motor domain. Myosin
           III may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           It may also function as a cargo carrier during
           light-dependent translocation, in photoreceptor cells,
           of proteins such as transducin and arrestin. The
           Drosophila class III myosin, called NinaC (Neither
           inactivation nor afterpotential protein C), is critical
           in normal adaptation and termination of photoresponse.
           Vertebrates contain two isoforms of class III myosin,
           IIIA and IIIB. This subfamily also includes mammalian
           NIK-like embryo-specific kinase (NESK), Traf2- and
           Nck-interacting kinase (TNIK), mitogen-activated protein
           kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or
           MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are involved in
           some MAPK signaling pathways by activating a MAPK kinase
           kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
          Length = 275

 Score = 39.6 bits (93), Expect = 4e-05
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 11/80 (13%)

Query: 4   LEVKPTIKKQIIRELKVL-HECNFAHIVGFYGAFIS------DQDISICMEYMDGGSL-D 55
           +++    +++I  E  +L    N  +I  FYGAFI       D  + + ME   GGS+ D
Sbjct: 39  MDIIEDEEEEIKEEYNILRKYSNHPNIATFYGAFIKKNPPGNDDQLWLVMELCGGGSVTD 98

Query: 56  LI---LKKAGKIPEHILGTI 72
           L+    KK  ++ E  +  I
Sbjct: 99  LVKGLRKKGKRLKEEWIAYI 118


>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase
           3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3)-like subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MEKK3-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           MEKK3, MEKK2, and related proteins, all containing an
           N-terminal PB1 domain, which mediates oligomerization,
           and a C-terminal catalytic domain. MEKK2 and MEKK3 are
           mitogen-activated protein kinase (MAPK) kinase kinases
           (MAPKKKs or MKKKs or MAP3Ks), proteins that
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           MEKK2 and MEKK3 activate MEK5 (also called MKK5), which
           activates extracellular signal-regulated kinase 5
           (ERK5). The ERK5 cascade plays roles in promoting cell
           proliferation, differentiation, neuronal survival, and
           neuroprotection. MEKK3 plays an essential role in
           embryonic angiogenesis and early heart development.
           MEKK2 and MEKK3 can also activate the MAPKs, c-Jun
           N-terminal kinase (JNK) and p38, through their
           respective MAPKKs.
          Length = 263

 Score = 39.4 bits (92), Expect = 5e-05
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 25  NFAH--IVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHILGTIT-------SA 75
           N  H  IV +YG    D+ +SI MEYM GGS+   LK  G + E +    T         
Sbjct: 60  NLQHERIVQYYGCLRDDETLSIFMEYMPGGSVKDQLKAYGALTETVTRKYTRQILEGVEY 119

Query: 76  THSSLIV 82
            HS++IV
Sbjct: 120 LHSNMIV 126


>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase
           4.  Serine/threonine kinases (STKs), yeast
           Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The YSK4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. YSK4 is a
           putative MAPKKK, whose mammalian gene has been isolated.
           MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals.
          Length = 265

 Score = 38.7 bits (90), Expect = 8e-05
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 17  ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHIL 69
           E+ +L      +IV + G  + D  ISI ME++ GGS+  IL + G +PE + 
Sbjct: 52  EVDLLKSLKHVNIVQYLGTCLDDNTISIFMEFVPGGSISSILNRFGPLPEPVF 104


>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
          Kinase, Cell Cycle-Related Kinase.  Serine/Threonine
          Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CCRK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CCRK was previously called
          p42. It is a Cyclin-Dependent Kinase (CDK)-Activating
          Kinase (CAK) which is essential for the activation of
          CDK2. It is indispensable for cell growth and has been
          implicated in the progression of glioblastoma
          multiforme. In the heart, a splice variant of CCRK with
          a different C-terminal half is expressed, this variant
          promotes cardiac cell growth and survival and is
          significantly down-regulated during the development of
          heart failure.
          Length = 286

 Score = 38.8 bits (91), Expect = 9e-05
 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 1/51 (1%)

Query: 10 IKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          I  Q +RE+K L  C   ++V     F       + MEYM    L  +L+ 
Sbjct: 42 IPNQALREIKALQACQHPYVVKLLDVFPHGSGFVLVMEYM-PSDLSEVLRD 91


>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
          Length = 1021

 Score = 38.6 bits (89), Expect = 1e-04
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 6/69 (8%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFI--SDQDISICMEYMDGGSLDLILKKA----GKI 64
           K Q++ E+ V+ E    +IV +   F+  ++Q + I ME+ D G L   ++K     GKI
Sbjct: 56  KSQLVIEVNVMRELKHKNIVRYIDRFLNKANQKLYILMEFCDAGDLSRNIQKCYKMFGKI 115

Query: 65  PEHILGTIT 73
            EH +  IT
Sbjct: 116 EEHAIVDIT 124


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), CMGC family, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The CMGC family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. The CMGC family
          consists of Cyclin-Dependent protein Kinases (CDKs),
          Mitogen-activated protein kinases (MAPKs) such as
          Extracellular signal-regulated kinase (ERKs), c-Jun
          N-terminal kinases (JNKs), and p38, and similar
          proteins. CDKs belong to a large subfamily of STKs that
          are regulated by their cognate cyclins. Together, they
          are involved in the control of cell-cycle progression,
          transcription, and neuronal function. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation.
          Length = 283

 Score = 38.1 bits (89), Expect = 1e-04
 Identities = 18/60 (30%), Positives = 28/60 (46%)

Query: 8  PTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEH 67
            I K  +RE+K+L E N  +I+     F    D+ +  E+MD     LI  +   +PE 
Sbjct: 39 EGIPKTALREIKLLKELNHPNIIKLLDVFRHKGDLYLVFEFMDTDLYKLIKDRQRGLPES 98


>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of
          Microtubule-associated serine/threonine kinase-like
          proteins.  Serine/Threonine Kinases (STKs),
          Microtubule-associated serine/threonine (MAST) kinase
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAST kinase subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The MAST kinase subfamily
          includes MAST kinases, MAST-like (MASTL) kinases, and
          fungal kinases with similarity to Saccharomyces
          cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
          MAST kinases contain an N-terminal domain of unknown
          function, a central catalytic domain, and a C-terminal
          PDZ domain that mediates protein-protein interactions.
          MASTL kinases carry only a catalytic domain which
          contains a long insert relative to other kinases. The
          fungal kinases in this subfamily harbor other domains
          in addition to a central catalytic domain, which also
          contains an insert relative to MAST kinases like MASTL.
          Rim15 contains a C-terminal signal receiver (REC)
          domain while cek1 contains an N-terminal PAS domain.
          MAST kinases are cytoskeletal associated kinases of
          unknown function that are also expressed at
          neuromuscular junctions and postsynaptic densities. The
          fungal proteins Rim15 and cek1 are involved in the
          regulation of meiosis and mitosis, respectively.
          Length = 265

 Score = 38.4 bits (90), Expect = 1e-04
 Identities = 15/58 (25%), Positives = 31/58 (53%)

Query: 11 KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHI 68
            Q++ E  +L +    ++V  Y +F   +++ + MEY+ GG L  +L+  G + E +
Sbjct: 37 VDQVLTERDILSQAQSPYVVKLYYSFQGKKNLYLVMEYLPGGDLASLLENVGSLDEDV 94


>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss
          of cAMP-dependent protein kinase-like Protein
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), Fission yeast Suppressor of loss of
          cAMP-dependent protein kinase (Sck1)-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The Sck1-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of fungal proteins with similarity to the
          Schizosaccharomyces pombe STK Sck1. Sck1 plays a role
          in trehalase activation triggered by glucose and a
          nitrogen source. Trehalase catalyzes the cleavage of
          the disaccharide trehalose to glucose. Trehalose, as a
          carbohydrate reserve and stress metabolite, plays an
          important role in the response of yeast to
          environmental changes.
          Length = 330

 Score = 38.0 bits (88), Expect = 1e-04
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 5  EVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKI 64
          EV  TI ++ I    +L E  F  IVG   +F +D D+ +  +YM GG L   L+K G+ 
Sbjct: 36 EVAHTIGERNILVRTLLDESPF--IVGLKFSFQTDSDLYLVTDYMSGGELFWHLQKEGRF 93

Query: 65 PE 66
           E
Sbjct: 94 SE 95


>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 7.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek7 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek7 is required
           for mitotic spindle formation and cytokinesis. It is
           enriched in the centrosome and is critical for
           microtubule nucleation. Nek7 is activated by Nek9 during
           mitosis, and may regulate the p70 ribosomal S6 kinase.
          Length = 267

 Score = 37.3 bits (86), Expect = 3e-04
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGK----IPE 66
           +   I+E+ +L + N  +++ +Y +FI D +++I +E  D G L  ++K   K    IPE
Sbjct: 46  RADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPE 105


>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein
           Serine/Threonine Kinase, STK10 or Lymphocyte-oriented
           kinase.  Serine/threonine kinases (STKs), STK10
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           STK10 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Other names for STK10 include
           lymphocyte-oriented kinase (LOK) and Xenopus polo-like
           kinase kinase 1 (xPlkk1). STK10 is highly expressed in
           lymphocytes and is responsible in regulating leukocyte
           function associated antigen (LFA-1)-mediated lymphocyte
           adhesion. It plays a role in regulating the CD28
           responsive element in T cells, and may also function as
           a regulator of polo-like kinase 1 (Plk1), a protein
           which is overexpressed in multiple tumor types.
          Length = 292

 Score = 37.3 bits (86), Expect = 3e-04
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 17  ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLIL 58
           E+++L  CN  +IV   GAF  D  + I +E+  GG++D I+
Sbjct: 59  EIEILATCNHPYIVKLLGAFYWDGKLWIMIEFCPGGAVDAIM 100


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
           prediction only / Signal transduction mechanisms /
           Transcription / DNA replication, recombination, and
           repair].
          Length = 384

 Score = 37.4 bits (85), Expect = 3e-04
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 4   LEVKPTIKKQIIRELKVLHECNFA-HIVGFYGAFISDQDISICMEYMDGGSLDLILKK-- 60
           LE K    ++ +RE+++L   N   +IV  Y  F  +  + + MEY+DGGSL+ +LKK  
Sbjct: 34  LESKSKEVERFLREIQILASLNHPPNIVKLYDFFQDEGSLYLVMEYVDGGSLEDLLKKIG 93

Query: 61  -AGKIPEHILGTITSATHSSLIVIYYK 86
             G + E     I +   S+L  ++ K
Sbjct: 94  RKGPLSESEALFILAQILSALEYLHSK 120


>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase,
           REarranged during Transfection protein.  Protein
           Tyrosine Kinase (PTK) family; RET (REarranged during
           Transfection) protein; catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. RET is a
           receptor tyr kinase (RTK) containing an extracellular
           region with four cadherin-like repeats, a
           calcium-binding site, and a cysteine-rich domain, a
           transmembrane segment, and an intracellular catalytic
           domain. It is part of a multisubunit complex that binds
           glial-derived neurotropic factor (GDNF) family ligands
           (GFLs) including GDNF, neurturin, artemin, and
           persephin. GFLs bind RET along with four GPI-anchored
           coreceptors, bringing two RET molecules together,
           leading to autophosphorylation, activation, and
           intracellular signaling. RET is essential for the
           development of the sympathetic, parasympathetic and
           enteric nervous systems, and the kidney. RET disruption
           by germline mutations causes diseases in humans
           including congenital aganglionosis of the
           gastrointestinal tract (Hirschsprung's disease) and
           three related inherited cancers: multiple endocrine
           neoplasia type 2A (MEN2A), MEN2B, and familial medullary
           thyroid carcinoma (FMTC).
          Length = 290

 Score = 36.9 bits (85), Expect = 3e-04
 Identities = 19/69 (27%), Positives = 35/69 (50%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHILGT 71
           + ++ E  +L + N  H++  YGA   D  + + +EY   GSL   L+++ K+    LG+
Sbjct: 48  RDLLSEFNLLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRSFLRESRKVGPSYLGS 107

Query: 72  ITSATHSSL 80
             +   S L
Sbjct: 108 DGNRNSSYL 116


>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 9.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek9 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek9, also called Nercc1, is
          primarily a cytoplasmic protein but can also localize
          in the nucleus. It is involved in modulating chromosome
          alignment and splitting during mitosis. It interacts
          with the gamma-tubulin ring complex and the Ran GTPase,
          and is implicated in microtubule organization. Nek9
          associates with FACT (FAcilitates Chromatin
          Transcription) and modulates interphase progression. It
          also interacts with Nek6, and Nek7, during mitosis,
          resulting in their activation.
          Length = 256

 Score = 36.3 bits (84), Expect = 5e-04
 Identities = 16/49 (32%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 17 ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL-DLILKKAGKI 64
          E+ +L      +I+ +Y  F+ D  + I MEY +GG+L D I+++ G++
Sbjct: 49 EIVILSLLQHPNIIAYYNHFMDDNTLLIEMEYANGGTLYDKIVRQKGQL 97


>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Nak1 subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The Nak1 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae
           Kic1p (kinase that interacts with Cdc31p) and related
           proteins. Nak1 (also known as N-rich kinase 1), is
           required by fission yeast for polarizing the tips of
           actin cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Kic1p is required by budding yeast for cell integrity
           and morphogenesis. Kic1p interacts with Cdc31p, the
           yeast homologue of centrin, and phosphorylates
           substrates in a Cdc31p-dependent manner.
          Length = 277

 Score = 36.3 bits (84), Expect = 5e-04
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 14  IIRELKVLHECNFA---HIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHILG 70
           I RE+ +L +   +   +I  +YG+++    + I MEY +GGS+   L KAG I E  + 
Sbjct: 46  IQREVALLSQLRQSQPPNITKYYGSYLKGPRLWIIMEYAEGGSV-RTLMKAGPIAEKYIS 104

Query: 71  TIT 73
            I 
Sbjct: 105 VII 107


>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 2.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 2, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK2 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK2 plays a
           role in pro-apoptotic signaling. It is cleaved and
           activated by caspases leading to morphological changes
           during apoptosis. PAK2 is also activated in response to
           a variety of stresses including DNA damage,
           hyperosmolarity, serum starvation, and contact
           inhibition, and may play a role in coordinating the
           stress response. PAK2 also contributes to cancer cell
           invasion through a mechanism distinct from that of PAK1.
          Length = 296

 Score = 36.6 bits (84), Expect = 5e-04
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 2   IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
           I+L+ +P  K+ II E+ V+ E    +IV F  +F+   ++ + MEY+ GGSL
Sbjct: 52  INLQKQPK-KELIINEILVMKELKNPNIVNFLDSFLVGDELFVVMEYLAGGSL 103


>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine
           Kinase, cAMP-dependent protein kinase.  Serine/Threonine
           Kinases (STKs), cAMP-dependent protein kinase (PKA)
           subfamily, catalytic (c) subunit. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This subfamily is composed of the
           cAMP-dependent proteins kinases, PKA and PRKX. The
           inactive PKA holoenzyme is a heterotetramer composed of
           two phosphorylated and active catalytic (C) subunits
           with a dimer of regulatory (R) subunits. Activation is
           achieved through the binding of the important second
           messenger cAMP to the R subunits, which leads to the
           dissociation of PKA into the R dimer and two active C
           subunits. PKA is present ubiquitously in cells and
           interacts with many different downstream targets. It
           plays a role in the regulation of diverse processes such
           as growth, development, memory, metabolism, gene
           expression, immunity, and lipolysis.
          Length = 290

 Score = 36.4 bits (85), Expect = 6e-04
 Identities = 18/55 (32%), Positives = 32/55 (58%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
           + ++ E ++L       +V  YG+F  D ++ + MEY+ GG L   L+K+G+ PE
Sbjct: 46  EHVLNEKRILQSIRHPFLVNLYGSFQDDSNLYLVMEYVPGGELFSHLRKSGRFPE 100


>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), AGC (Protein Kinases A, G and C) family,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The AGC family is part
          of a larger superfamily that includes the catalytic
          domains of other protein STKs, protein tyrosine
          kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          Phosphoinositide 3-Kinase (PI3K). Members of this
          family include cAMP-dependent Protein Kinase (PKA),
          cGMP-dependent Protein Kinase (PKG), Protein Kinase C
          (PKC), Protein Kinase B (PKB), G protein-coupled
          Receptor Kinase (GRK), Serum- and
          Glucocorticoid-induced Kinase (SGK), and 70 kDa
          ribosomal Protein S6 Kinase (p70S6K or S6K), among
          others. AGC kinases share an activation mechanism based
          on the phosphorylation of up to three sites: the
          activation loop (A-loop), the hydrophobic motif (HM)
          and the turn motif. Phosphorylation at the A-loop is
          required of most AGC kinases, which results in a
          disorder-to-order transition of the A-loop. The ordered
          conformation results in the access of substrates and
          ATP to the active site. A subset of AGC kinases with
          C-terminal extensions containing the HM also requires
          phosphorylation at this site. Phosphorylation at the HM
          allows the C-terminal extension to form an ordered
          structure that packs into the hydrophobic pocket of the
          catalytic domain, which then reconfigures the kinase
          into an active bi-lobed state. In addition, growth
          factor-activated AGC kinases such as PKB, p70S6K, RSK,
          MSK, PKC, and SGK, require phosphorylation at the turn
          motif (also called tail or zipper site), located
          N-terminal to the HM at the C-terminal extension. AGC
          kinases regulate many cellular processes including
          division, growth, survival, metabolism, motility, and
          differentiation. Many are implicated in the development
          of various human diseases.
          Length = 250

 Score = 36.0 bits (84), Expect = 8e-04
 Identities = 16/55 (29%), Positives = 26/55 (47%)

Query: 13 QIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEH 67
            + E  +L   N   IV  + AF +++ + + +EY  GG L   L K G+  E 
Sbjct: 39 HTLTERNILSRINHPFIVKLHYAFQTEEKLYLVLEYAPGGELFSHLSKEGRFSEE 93


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
           Kinase Like Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Cyclin-dependent protein kinase like
           (CDKL) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDKL subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDKL1-5 and similar proteins. Some CDKLs,
           like CDKL1 and CDKL3, may be implicated in
           transformation and others, like CDKL3 and CDKL5, are
           associated with mental retardation when impaired. CDKL2
           plays a role in learning and memory.
          Length = 288

 Score = 35.8 bits (83), Expect = 0.001
 Identities = 17/64 (26%), Positives = 31/64 (48%)

Query: 10  IKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHIL 69
           +KK  +RE+KVL +    +IV    AF     + +  EY++   L+L+    G +P   +
Sbjct: 43  VKKTALREVKVLRQLRHENIVNLKEAFRRKGRLYLVFEYVERTLLELLEASPGGLPPDAV 102

Query: 70  GTIT 73
            +  
Sbjct: 103 RSYI 106


>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit;
           Provisional.
          Length = 329

 Score = 35.6 bits (82), Expect = 0.001
 Identities = 15/54 (27%), Positives = 28/54 (51%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIP 65
           + + +E  +L E +   IV    +F  +  +   +E++ GG L   L+KAG+ P
Sbjct: 63  QHVAQEKSILMELSHPFIVNMMCSFQDENRVYFLLEFVVGGELFTHLRKAGRFP 116


>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 8.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek8 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek8 contains an N-terminal
          kinase catalytic domain and a C-terminal RCC1
          (regulator of chromosome condensation) domain. A double
          point mutation in Nek8 causes cystic kidney disease in
          mice that genetically resembles human autosomal
          recessive polycystic kidney disease (ARPKD). Nek8 is
          also associated with a rare form of juvenile renal
          cystic disease, nephronophthisis type 9. It has been
          suggested that a defect in the ciliary localization of
          Nek8 contributes to the development of cysts manifested
          by these diseases.
          Length = 256

 Score = 35.6 bits (82), Expect = 0.001
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 17 ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGK 63
          E +VL   +  +I+ +Y  F+ D+ + I MEY  GG+L   ++K   
Sbjct: 49 ECQVLKLLSHPNIIEYYENFLEDKALMIVMEYAPGGTLAEYIQKRCN 95


>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal
           Byr2-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Byr2-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae
           and Cryptococcus neoformans Ste11, and related proteins.
           They contain an N-terminal SAM (sterile alpha-motif)
           domain, which mediates protein-protein interaction, and
           a C-terminal catalytic domain. MAPKKKs phosphorylate and
           activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
           in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Fission
           yeast Byr2 is regulated by Ras1. It responds to
           pheromone signaling and controls mating through the MAPK
           pathway. Budding yeast Ste11 functions in MAPK cascades
           that regulate mating, high osmolarity glycerol, and
           filamentous growth responses.
          Length = 267

 Score = 35.6 bits (82), Expect = 0.001
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 16  RELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
           RE+ +L E    +IV + G+ +    ++I +EY+ GGS+  +L   G   E
Sbjct: 55  REIALLKELQHENIVQYLGSSLDADHLNIFLEYVPGGSVAALLNNYGAFEE 105


>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group I p21-activated kinase.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group I, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs are
           implicated in the regulation of many cellular processes
           including growth factor receptor-mediated proliferation,
           cell polarity, cell motility, cell death and survival,
           and actin cytoskeleton organization. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs, also called conventional PAKs, include
           PAK1, PAK2, and PAK3. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). They interact
           with the SH3 domain containing proteins Nck, Grb2 and
           PIX. Binding of group I PAKs to activated GTPases leads
           to conformational changes that destabilize the AID,
           allowing autophosphorylation and full activation of the
           kinase domain. Known group I PAK substrates include
           MLCK, Bad, Raf, MEK1, LIMK, Merlin, Vimentin, Myc,
           Stat5a, and Aurora A, among others.
          Length = 293

 Score = 35.6 bits (82), Expect = 0.001
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 2   IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
           ++L+ +P  K+ II E+ V+ E    +IV +  +++   ++ + MEY+ GGSL
Sbjct: 52  MNLQQQPK-KELIINEILVMRENKHPNIVNYLDSYLVGDELWVVMEYLAGGSL 103


>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Fes subfamily; catalytic (c) domain. Fes
          subfamily members include Fes (or Fps), Fer, and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. Fes subfamily proteins are cytoplasmic (or
          nonreceptor) tyr kinases containing an N-terminal
          region with FCH (Fes/Fer/CIP4 homology) and coiled-coil
          domains, followed by a SH2 domain, and a C-terminal
          catalytic domain. The genes for Fes (feline sarcoma)
          and Fps (Fujinami poultry sarcoma) were first isolated
          from tumor-causing retroviruses. The viral oncogenes
          encode chimeric Fes proteins consisting of Gag
          sequences at the N-termini, resulting in unregulated
          tyr kinase activity. Fes and Fer kinases play roles in
          haematopoiesis, inflammation and immunity, growth
          factor signaling, cytoskeletal regulation, cell
          migration and adhesion, and the regulation of cell-cell
          interactions. Fes and Fer show redundancy in their
          biological functions.
          Length = 251

 Score = 35.5 bits (82), Expect = 0.001
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 8  PTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGS-LDLILKKAGKIP 65
          P +K++ ++E ++L + +  +IV   G  +  Q I I ME + GGS L  + KK  ++ 
Sbjct: 33 PDLKRKFLQEAEILKQYDHPNIVKLIGVCVQKQPIYIVMELVPGGSLLTFLRKKKNRLT 91


>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group II p21-activated kinase. 
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group II, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group II PAKs, also called non-conventional PAKs,
           include PAK4, PAK5, and PAK6. Group II PAKs contain PBD
           (p21-binding domain) and catalytic domains, but lack
           other motifs found in group I PAKs, such as an AID
           (autoinhibitory domain) and SH3 binding sites. Since
           group II PAKs do not contain an obvious AID, they may be
           regulated differently from group I PAKs. While group I
           PAKs interact with the SH3 containing proteins Nck, Grb2
           and PIX, no such binding has been demonstrated for group
           II PAKs. Some known substrates of group II PAKs are also
           substrates of group I PAKs such as Raf, BAD, LIMK and
           GEFH1. Unique group II substrates include MARK/Par-1 and
           PDZ-RhoGEF. Group II PAKs play important roles in
           filopodia formation, neuron extension, cytoskeletal
           organization, and cell survival.
          Length = 285

 Score = 35.1 bits (81), Expect = 0.001
 Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 7   KPTIKKQIIREL-----KVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKA 61
           K  ++KQ  REL      ++ +    +IV  Y +++   ++ + ME+++GG+L  I+   
Sbjct: 51  KMDLRKQQRRELLFNEVVIMRDYQHPNIVEMYSSYLVGDELWVVMEFLEGGALTDIV-TH 109

Query: 62  GKIPEHILGTITSA 75
            ++ E  + T+  A
Sbjct: 110 TRMNEEQIATVCLA 123


>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
           Serine/Threonine Kinases, Never In Mitosis gene
           A-related kinase 6 and 7.  Serine/Threonine Kinases
           (STKs), Never In Mitosis gene A (NIMA)-related kinase 6
           (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The Nek6/7 subfamily is part of a family of 11 different
           Neks (Nek1-11) that are involved in cell cycle control.
           The Nek family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Nek6 and Nek7 are the shortest Neks,
           consisting only of the catalytic domain and a very short
           N-terminal extension. They show distinct expression
           patterns and both appear to be downstream substrates of
           Nek9. They are required for mitotic spindle formation
           and cytokinesis. They may also be regulators of the p70
           ribosomal S6 kinase.
          Length = 267

 Score = 35.1 bits (81), Expect = 0.001
 Identities = 14/56 (25%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 15  IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGK----IPE 66
           ++E+ +L + +  +++ +  +FI + +++I +E  D G L  ++K   K    IPE
Sbjct: 50  LKEIDLLKQLDHPNVIKYLASFIENNELNIVLELADAGDLSRMIKHFKKQKRLIPE 105


>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine
           Kinase, Thousand-and-one amino acids proteins.
           Serine/threonine kinases (STKs), thousand-and-one amino
           acids (TAO) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. They activate the MAPKs, p38 and c-Jun
           N-terminal kinase (JNK), by phosphorylating and
           activating the respective MAP/ERK kinases (MEKs, also
           known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK
           signaling cascades are important in mediating cellular
           responses to extracellular signals. Vertebrates contain
           three TAO subfamily members, named TAO1, TAO2, and TAO3.
          Length = 307

 Score = 35.2 bits (81), Expect = 0.002
 Identities = 10/44 (22%), Positives = 24/44 (54%)

Query: 14  IIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLI 57
           II+E++ L +    + + + G ++ +    + MEY  G + D++
Sbjct: 62  IIKEVRFLQQLRHPNTIEYKGCYLREHTAWLVMEYCLGSASDIL 105


>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 3.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK3 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK3 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates the MAPK kinase MEK5 (or
           MKK5), which in turn phosphorylates and activates
           extracellular signal-regulated kinase 5 (ERK5). The ERK5
           cascade plays roles in promoting cell proliferation,
           differentiation, neuronal survival, and neuroprotection.
           MEKK3 plays an essential role in embryonic angiogenesis
           and early heart development. In addition, MEKK3 is
           involved in interleukin-1 receptor and Toll-like
           receptor 4 signaling. It is also a specific regulator of
           the proinflammatory cytokines IL-6 and GM-CSF in some
           immune cells. MEKK3 also regulates calcineurin, which
           plays a critical role in T cell activation, apoptosis,
           skeletal myocyte differentiation, and cardiac
           hypertrophy.
          Length = 266

 Score = 35.0 bits (80), Expect = 0.002
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 9/75 (12%)

Query: 17  ELKVLHECNFAHIVGFYGAFI--SDQDISICMEYMDGGSLDLILKKAGKIPEHILGTIT- 73
           E+++L       IV +YG     +++ ++I MEYM GGS+   LK  G + E +    T 
Sbjct: 54  EIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTR 113

Query: 74  ------SATHSSLIV 82
                 S  HS++IV
Sbjct: 114 QILEGMSYLHSNMIV 128


>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal
           Bck1-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Bck1-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Saccharomyces cerevisiae Bck1 and Schizosaccharomyces
           pombe Mkh1, and related proteins. MAPKKKs phosphorylate
           and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks),
           which in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Budding
           yeast Bck1 is part of the cell integrity MAPK pathway,
           which is activated by stresses and aggressions to the
           cell wall. The MAPKKK Bck1, MAPKKs Mkk1 and Mkk2, and
           the MAPK Slt2 make up the cascade that is important in
           the maintenance of cell wall homeostasis. Fission yeast
           Mkh1 is involved in MAPK cascades regulating cell
           morphology, cell wall integrity, salt resistance, and
           filamentous growth in response to stress.
          Length = 272

 Score = 34.4 bits (79), Expect = 0.003
 Identities = 20/84 (23%), Positives = 42/84 (50%)

Query: 3   HLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAG 62
           H   +  + K +  E++ L + +  +IV + G   +++ +SI +EY+ GGS+   L+  G
Sbjct: 44  HDSRQKDMVKALRSEIETLKDLDHLNIVQYLGFETTEEYLSIFLEYVPGGSIGSCLRTYG 103

Query: 63  KIPEHILGTITSATHSSLIVIYYK 86
           +  E ++   T      L  ++ K
Sbjct: 104 RFEEQLVRFFTEQVLEGLAYLHSK 127


>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine
           Kinase, Tropomyosin Related Kinase B.  Protein Tyrosine
           Kinase (PTK) family; Tropomyosin Related Kinase B
           (TrkB); catalytic (c) domain. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. TrkB is a member of the
           Trk subfamily of proteins, which are receptor tyr
           kinases (RTKs) containing an extracellular region with
           arrays of leucine-rich motifs flanked by two
           cysteine-rich clusters followed by two
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. Binding of TrkB
           to its ligands, brain-derived neurotrophic factor (BDNF)
           or neurotrophin 4 (NT4), results in receptor
           oligomerization and activation of the catalytic domain.
           TrkB is broadly expressed in the nervous system and in
           some non-neural tissues. It plays important roles in
           cell proliferation, differentiation, and survival.
           BDNF/Trk signaling plays a key role in regulating
           activity-dependent synaptic plasticity. TrkB also
           contributes to protection against gp120-induced neuronal
           cell death. TrkB overexpression is associated with poor
           prognosis in neuroblastoma (NB) and other human cancers.
           It acts as a suppressor of anoikis (detachment-induced
           apoptosis) and contributes to tumor metastasis.
          Length = 288

 Score = 34.7 bits (79), Expect = 0.003
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHIL 69
           +K   RE ++L      HIV FYG  +    + +  EYM  G L+  L+  G  P+ +L
Sbjct: 51  RKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHG--PDAVL 107


>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine
          Kinase, Fes.  Protein Tyrosine Kinase (PTK) family; Fes
          (or Fps) kinase subfamily; catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Fes
          subfamily proteins are cytoplasmic (or nonreceptor) tyr
          kinases containing an N-terminal region with FCH
          (Fes/Fer/CIP4 homology) and coiled-coil domains,
          followed by a SH2 domain, and a C-terminal catalytic
          domain. The genes for Fes (feline sarcoma) and Fps
          (Fujinami poultry sarcoma) were first isolated from
          tumor-causing retroviruses. The viral oncogenes encode
          chimeric Fes proteins consisting of Gag sequences at
          the N-termini, resulting in unregulated tyr kinase
          activity. Fes kinase is expressed in myeloid, vascular
          endothelial, epithelial, and neuronal cells. It plays
          important roles in cell growth and differentiation,
          angiogenesis, inflammation and immunity, and
          cytoskeletal regulation. A recent study implicates Fes
          kinase as a tumor suppressor in colorectal cancer.
          Length = 252

 Score = 33.8 bits (77), Expect = 0.004
 Identities = 16/55 (29%), Positives = 27/55 (49%)

Query: 8  PTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAG 62
          P +K + ++E ++L + +  +IV   G     Q I I ME + GG     L+  G
Sbjct: 34 PDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEG 88


>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 3.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 3, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK3 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK3 is
           highly expressed in the brain. It is implicated in
           neuronal plasticity, synapse formation, dendritic spine
           morphogenesis, cell cycle progression, neuronal
           migration, and apoptosis. Inactivating mutations in the
           PAK3 gene cause X-linked non-syndromic mental
           retardation, the severity of which depends on the site
           of the mutation.
          Length = 297

 Score = 33.9 bits (77), Expect = 0.005
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 2   IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
           ++L+ +P  K+ II E+ V+ E    +IV +  +++   ++ + MEY+ GGSL
Sbjct: 52  MNLQQQPK-KELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSL 103


>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 1.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 1, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK1 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK1 is
           important in the regulation of many cellular processes
           including cytoskeletal dynamics, cell motility, growth,
           and proliferation. Although PAK1 has been regarded
           mainly as a cytosolic protein, recent reports indicate
           that PAK1 also exists in significant amounts in the
           nucleus, where it is involved in transcription
           modulation and in cell cycle regulatory events. PAK1 is
           also involved in transformation and tumorigenesis. Its
           overexpression, hyperactivation and increased nuclear
           accumulation is correlated to breast cancer invasiveness
           and progression. Nuclear accumulation is also linked to
           tamoxifen resistance in breast cancer cells.
          Length = 296

 Score = 33.9 bits (77), Expect = 0.005
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 2   IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
           ++L+ +P  K+ II E+ V+ E    +IV +  +++   ++ + MEY+ GGSL
Sbjct: 53  MNLQQQPK-KELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSL 104


>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 6.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek6 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek6 is required
           for the transition from metaphase to anaphase. It also
           plays important roles in mitotic spindle formation and
           cytokinesis.  Activated by Nek9 during mitosis, Nek6
           phosphorylates Eg5, a kinesin that is important for
           spindle bipolarity. Nek6 localizes to spindle
           microtubules during metaphase and anaphase, and to the
           midbody during cytokinesis.
          Length = 267

 Score = 33.8 bits (77), Expect = 0.005
 Identities = 16/60 (26%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGK----IPE 66
           ++  ++E+ +L + N  +++ +  +FI D +++I +E  D G L  ++K   K    IPE
Sbjct: 46  RQDCVKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPE 105


>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,
            and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii Never In Mitosis gene A
           (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii CNK2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes CNK1, and -2.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii CNK2 has both
           cilliary and cell cycle functions. It influences
           flagellar length through promoting flagellar
           disassembly, and it regulates cell size, through
           influencing the size threshold at which cells commit to
           mitosis.
          Length = 256

 Score = 33.6 bits (77), Expect = 0.006
 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGK----IPE 66
           ++  + E+++L   N  +I+ +  AF+    + I MEY   G L   + K  K    IPE
Sbjct: 43  REDAVNEIRILASVNHPNIISYKEAFLDGNKLCIVMEYAPFGDLSKAISKRKKKRKLIPE 102

Query: 67  HIL 69
             +
Sbjct: 103 QEI 105


>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase
           kinase 3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3)-like subfamily, catalytic (c) domain,
           functionally uncharacterized subgroup 1. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK3-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The MEKK3-like subfamily is
           composed of MEKK3, MEKK2, and related proteins, all
           containing an N-terminal PB1 domain, which mediates
           oligomerization, and a C-terminal catalytic domain.
           MEKK2 and MEKK3 are mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks),
           proteins that phosphorylate and activate MAPK kinases
           (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
           and activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK2 and MEKK3 activate MEK5
           (also called MKK5), which activates extracellular
           signal-regulated kinase 5 (ERK5). The ERK5 cascade plays
           roles in promoting cell proliferation, differentiation,
           neuronal survival, and neuroprotection. MEKK3 plays an
           essential role in embryonic angiogenesis and early heart
           development. MEKK2 and MEKK3 can also activate the
           MAPKs, c-Jun N-terminal kinase (JNK) and p38, through
           their respective MAPKKs.
          Length = 264

 Score = 33.5 bits (76), Expect = 0.007
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 9/75 (12%)

Query: 17  ELKVLHECNFAHIVGFYGAF--ISDQDISICMEYMDGGSLDLILKKAGKIPEHILGTIT- 73
           E+++L       IV +YG      ++ +SI +EYM GGS+   LK  G + E++    T 
Sbjct: 54  EIQLLKNLRHDRIVQYYGCLRDPEEKKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTR 113

Query: 74  ------SATHSSLIV 82
                 S  HS++IV
Sbjct: 114 QILQGVSYLHSNMIV 128


>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional.
          Length = 335

 Score = 33.2 bits (76), Expect = 0.008
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 14  IIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDG 51
            +RELK+++E    +I+G    ++    I++ M+ M  
Sbjct: 67  TLRELKIMNEIKHENIMGLVDVYVEGDFINLVMDIMAS 104



 Score = 28.2 bits (63), Expect = 0.46
 Identities = 9/19 (47%), Positives = 11/19 (57%)

Query: 10  IKKQIIRELKVLHECNFAH 28
           I  QI+  L VLH+  F H
Sbjct: 124 ILLQILNGLNVLHKWYFMH 142


>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain
           Receptor-like Protein Tyrosine Kinases.  Protein
           Tyrosine Kinase (PTK) family; Discoidin Domain Receptor
           (DDR)-like proteins; catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. DDR-like
           proteins are members of the DDR subfamily, which are
           receptor tyr kinases (RTKs) containing an extracellular
           discoidin homology domain, a transmembrane segment, an
           extended juxtamembrane region, and an intracellular
           catalytic domain. The binding of the ligand, collagen,
           to DDRs results in a slow but sustained receptor
           activation. DDRs regulate cell adhesion, proliferation,
           and extracellular matrix remodeling. They have been
           linked to a variety of human cancers including breast,
           colon, ovarian, brain, and lung. There is no evidence
           showing that DDRs act as transforming oncogenes. They
           are more likely to play a role in the regulation of
           tumor growth and metastasis.
          Length = 295

 Score = 33.0 bits (75), Expect = 0.008
 Identities = 14/56 (25%), Positives = 29/56 (51%)

Query: 5   EVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
           +V  T +   ++E+K++      +I+   G  +SD  + +  EYM+ G L+  L +
Sbjct: 55  DVTKTARNDFLKEIKIMSRLKNPNIIRLLGVCVSDDPLCMITEYMENGDLNQFLSQ 110


>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 2.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2
           (MEKK2) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK2 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates the MAPK kinase MEK5 (or
           MKK5), which in turn phosphorylates and activates
           extracellular signal-regulated kinase 5 (ERK5). The ERK5
           cascade plays roles in promoting cell proliferation,
           differentiation, neuronal survival, and neuroprotection.
           MEKK2 also activates ERK1/2, c-Jun N-terminal kinase
           (JNK) and p38 through their respective MAPKKs MEK1/2,
           JNK-activating kinase 2 (JNKK2), and MKK3/6. MEKK2 plays
           roles in T cell receptor signaling, immune synapse
           formation, cytokine gene expression, as well as in EGF
           and FGF receptor signaling.
          Length = 265

 Score = 33.1 bits (75), Expect = 0.008
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 15/79 (18%)

Query: 13  QIIRELKVLHECNFAHIVGFYGAFISDQD--ISICMEYMDGGSLDLILKKAGKIPEHILG 70
           Q+++ L  LHE     IV +YG      +  +SI ME+M GGS+   LK  G + E++  
Sbjct: 56  QLLKNL--LHE----RIVQYYGCLRDPMERTLSIFMEHMPGGSIKDQLKSYGALTENVTR 109

Query: 71  TIT-------SATHSSLIV 82
             T       S  HS++IV
Sbjct: 110 KYTRQILEGVSYLHSNMIV 128


>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein
          Serine/Threonine Kinase, Microtubule-associated
          serine/threonine kinase.  Serine/Threonine Kinases
          (STKs), Microtubule-associated serine/threonine (MAST)
          kinase subfamily, MAST, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The MAST kinase subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MAST kinases
          contain an N-terminal domain of unknown function, a
          central catalytic domain, and a C-terminal PDZ domain
          that mediates protein-protein interactions. There are
          four mammalian MAST kinases, named MAST1-MAST4. MAST1
          is also referred to as syntrophin-associated STK
          (SAST), while MAST2 is also called MAST205. MAST
          kinases are cytoskeletal associated kinases of unknown
          function that are also expressed at neuromuscular
          junctions and postsynaptic densities. MAST1, MAST2, and
          MAST3 bind and phosphorylate the tumor suppressor PTEN,
          and may contribute to the regulation and stabilization
          of PTEN. MAST2 is involved in the regulation of the
          Fc-gamma receptor of the innate immune response in
          macrophages, and may also be involved in the regulation
          of the Na+/H+ exchanger NHE3.
          Length = 305

 Score = 33.2 bits (76), Expect = 0.008
 Identities = 11/37 (29%), Positives = 22/37 (59%)

Query: 29 IVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIP 65
          +V  + +F + + + + MEY++GG    +LK  G +P
Sbjct: 63 VVSMFCSFETKRHLCMVMEYVEGGDCATLLKNIGALP 99


>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine
           Kinase, Tropomyosin Related Kinase C.  Protein Tyrosine
           Kinase (PTK) family; Tropomyosin Related Kinase C
           (TrkC); catalytic (c) domain. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. TrkC is a member of the
           Trk subfamily of proteins, which are receptor tyr
           kinases (RTKs) containing an extracellular region with
           arrays of leucine-rich motifs flanked by two
           cysteine-rich clusters followed by two
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. Binding of TrkC
           to its ligand, neurotrophin 3 (NT3), results in receptor
           oligomerization and activation of the catalytic domain.
           TrkC is broadly expressed in the nervous system and in
           some non-neural tissues including the developing heart.
           NT3/TrkC signaling plays an important role in the
           innervation of the cardiac conducting system and the
           development of smooth muscle cells. Mice deficient with
           NT3 and TrkC have multiple heart defects. NT3/TrkC
           signaling is also critical for the development and
           maintenance of enteric neurons that are important for
           the control of gut peristalsis.
          Length = 291

 Score = 33.1 bits (75), Expect = 0.009
 Identities = 17/52 (32%), Positives = 24/52 (46%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAG 62
           +K   RE ++L      HIV FYG       + +  EYM  G L+  L+  G
Sbjct: 51  RKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHG 102


>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 5.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek5 subfamily is one of a family of 11 different Neks
          (Nek1-11). The Nek family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Neks are
          involved in the regulation of downstream processes
          following the activation of Cdc2, and many of their
          functions are cell cycle-related. They play critical
          roles in microtubule dynamics during ciliogenesis and
          mitosis. The specific function of Nek5 is unknown.
          Length = 257

 Score = 32.6 bits (74), Expect = 0.011
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 2  IHLEVKPTIKKQIIR-ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
          I L   P  +K+  + E+ +L +    +IV F+ +F  +  + I MEY DGG L
Sbjct: 33 IDLTKMPVKEKEASKKEVILLAKMKHPNIVTFFASFQENGRLFIVMEYCDGGDL 86


>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine
           Kinase, Tropomyosin Related Kinase A.  Protein Tyrosine
           Kinase (PTK) family; Tropomyosin Related Kinase A
           (TrkA); catalytic (c) domain. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. TrkA is a member of the
           Trk subfamily of proteins, which are receptor tyr
           kinases (RTKs) containing an extracellular region with
           arrays of leucine-rich motifs flanked by two
           cysteine-rich clusters followed by two
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. Binding of TrkA
           to its ligand, nerve growth factor (NGF), results in
           receptor oligomerization and activation of the catalytic
           domain. TrkA is expressed mainly in neural-crest-derived
           sensory and sympathetic neurons of the peripheral
           nervous system, and in basal forebrain cholinergic
           neurons of the central nervous system. It is critical
           for neuronal growth, differentiation and survival.
           Alternative TrkA splicing has been implicated as a
           pivotal regulator of neuroblastoma (NB) behavior. Normal
           TrkA expression is associated with better NB prognosis,
           while the hypoxia-regulated TrkAIII splice variant
           promotes NB pathogenesis and progression. Aberrant TrkA
           expression has also been demonstrated in non-neural
           tumors including prostate, breast, lung, and pancreatic
           cancers.
          Length = 280

 Score = 32.3 bits (73), Expect = 0.016
 Identities = 17/58 (29%), Positives = 27/58 (46%)

Query: 5   EVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAG 62
           E   + ++   RE ++L      HIV FYG     + + +  EYM  G L+  L+  G
Sbjct: 45  EASESARQDFQREAELLTVLQHQHIVRFYGVCTEGRPLLMVFEYMRHGDLNRFLRSHG 102


>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Ste20-like kinase.
          Serine/threonine kinases (STKs), Ste20-like kinase
          (SLK) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          SLK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. SLK promotes apoptosis
          through apoptosis signal-regulating kinase 1 (ASK1) and
          the mitogen-activated protein kinase (MAPK) p38. It
          acts as a MAPK kinase kinase (MAPKKK) by
          phosphorylating ASK1, resulting in the phosphorylation
          of p38. SLK also plays a role in mediating actin
          reorganization. It is part of a microtubule-associated
          complex that is targeted at adhesion sites, and is
          required in focal adhesion turnover and in regulating
          cell migration.
          Length = 282

 Score = 31.9 bits (72), Expect = 0.021
 Identities = 12/42 (28%), Positives = 25/42 (59%)

Query: 17 ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLIL 58
          E+ +L  C+  +IV    AF  + ++ I +E+  GG++D ++
Sbjct: 52 EIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVM 93


>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yank1.  Serine/Threonine
           Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Yank1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily
           contains uncharacterized STKs with similarity to the
           human protein designated Yank1 or STK32A.
          Length = 258

 Score = 31.9 bits (73), Expect = 0.022
 Identities = 12/57 (21%), Positives = 29/57 (50%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHI 68
           + ++ E ++L E N   +V  + +F  ++++ + ++ + GG L   L +  K  E  
Sbjct: 45  RNVLNERRILQELNHPFLVNLWYSFQDEENMYLVVDLLLGGDLRYHLSQKVKFSEEQ 101


>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine
          Kinase, C-ros.  Protein Tyrosine Kinases (PTK) family;
          C-ros and Drosophila Sevenless proteins; catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. The
          proto-oncogene c-ros encodes an orphan receptor tyr
          kinase (RTK) with an unknown ligand. RTKs contain an
          extracellular ligand-binding domain, a transmembrane
          region, and an intracellular tyr kinase domain. RTKs
          are usually activated through ligand binding, which
          causes dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain. C-ros is
          expressed in embryonic cells of the kidney, intestine
          and lung, but disappears soon after birth. It persists
          only in the adult epididymis. Male mice bearing
          inactive mutations of c-ros lack the initial segment of
          the epididymis and are infertile. The Drosophila
          protein, Sevenless, is required for the specification
          of the R7 photoreceptor cell during eye development.
          Length = 269

 Score = 31.8 bits (72), Expect = 0.024
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 11 KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKA 61
          KK+ ++E  ++   N  +IV   G  + ++   I ME M+GG L   L+ A
Sbjct: 43 KKEFLKEAHLMSNFNHPNIVKLLGVCLLNEPQYIIMELMEGGDLLSYLRDA 93


>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine
          Kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
          Kinase (PTK) family; Spleen Tyrosine Kinase (Syk)
          subfamily; catalytic (c) domain. The Syk subfamily is
          composed of Syk, ZAP-70, Shark, and similar proteins.
          The PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Syk
          subfamily kinases are cytoplasmic (or nonreceptor) tyr
          kinases containing two Src homology 2 (SH2) domains
          N-terminal to the catalytic tyr kinase domain. They are
          involved in the signaling downstream of activated
          receptors (including B-cell, T-cell, and Fc receptors)
          that contain ITAMs (immunoreceptor tyr activation
          motifs), leading to processes such as cell
          proliferation, differentiation, survival, adhesion,
          migration, and phagocytosis. Syk is important in B-cell
          receptor (BCR) signaling, while Zap-70 is primarily
          expressed in T-cells and NK cells, and is a crucial
          component in T-cell receptor (TCR) signaling. Syk also
          plays a central role in Fc receptor-mediated
          phagocytosis in the adaptive immune system. Shark is
          exclusively expressed in ectodermally derived
          epithelia, and is localized preferentially to the
          apical surface of the epithelial cells, it may play a
          role in a signaling pathway for epithelial cell
          polarity.
          Length = 257

 Score = 31.6 bits (72), Expect = 0.025
 Identities = 18/66 (27%), Positives = 28/66 (42%), Gaps = 1/66 (1%)

Query: 2  IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKA 61
          +  E     KK+ +RE  V+ + +   IV   G    +  + + ME    G L   LKK 
Sbjct: 31 LKQEHIAAGKKEFLREASVMAQLDHPCIVRLIGVCKGEP-LMLVMELAPLGPLLKYLKKR 89

Query: 62 GKIPEH 67
           +IP  
Sbjct: 90 REIPVS 95


>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 11.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 11 (Nek11)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Nek11 subfamily is one of a family of 11 different Neks
           (Nek1-11) that are involved in cell cycle control. The
           Nek family is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Nek11 is involved, through direct
           phosphorylation, in regulating the degradation of Cdc25A
           (Cell Division Cycle 25 homolog A), which plays a role
           in cell cycle progression and in activating cyclin
           dependent kinases. Nek11 is activated by CHK1
           (CHeckpoint Kinase 1) and may be involved in the G2/M
           checkpoint. Nek11 may also play a role in the S-phase
           checkpoint as well as in DNA replication and genotoxic
           stress responses.
          Length = 260

 Score = 31.8 bits (72), Expect = 0.026
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 3/63 (4%)

Query: 5   EVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLIL---KKA 61
           E+ P    Q  +E ++L + +   IV F+ +F+      I  EY +G  LD  L   K  
Sbjct: 40  ELNPNETVQANQEAQLLSKLDHPAIVKFHASFLERDAFCIITEYCEGRDLDCKLEELKHT 99

Query: 62  GKI 64
           GK 
Sbjct: 100 GKT 102


>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase
          adapter protein.  Protein Kinase family, STE20-related
          kinase adapter protein (STRAD) subfamily, pseudokinase
          domain. The STRAD subfamily is part of a larger
          superfamily that includes the catalytic domains of
          serine/threonine kinases (STKs), protein tyrosine
          kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The pseudokinase domain
          shows similarity to protein kinases but lacks crucial
          residues for catalytic activity. STRAD forms a complex
          with the scaffolding protein MO25, and the STK, LKB1,
          resulting in the activation of the kinase. In the
          complex, LKB1 phosphorylates and activates adenosine
          monophosphate-activated protein kinases (AMPKs), which
          regulate cell energy metabolism and cell polarity. LKB1
          is a tumor suppressor linked to the rare inherited
          disease, Peutz-Jeghers syndrome, which is characterized
          by a predisposition to benign polyps and
          hyperpigmentation of the buccal mucosa. There are two
          forms of STRAD, alpha and beta, that complex with LKB1
          and MO25. The structure of STRAD-alpha is available and
          shows that this protein binds ATP, has an ordered
          activation loop, and adopts a closed conformation
          typical of fully active protein kinases. It does not
          possess activity due to nonconservative substitutions
          of essential catalytic residues. ATP binding enhances
          the affinity of STRAD for MO25.  The conformation of
          STRAD-alpha stabilized through ATP and MO25 may be
          needed to activate LKB1.
          Length = 314

 Score = 31.2 bits (71), Expect = 0.038
 Identities = 13/59 (22%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 2  IHLEVKPTIK-KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILK 59
          I+L+       K + +E+    +    +I+ +  +FI D ++ +    M  GS + +LK
Sbjct: 33 INLDSCSKEDLKLLQQEIITSRQLQHPNILPYVTSFIVDSELYVVSPLMAYGSCEDLLK 91


>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Ephrin Receptor (EphR) subfamily; catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). They can be classified into two classes (EphA
          and EphB), according to their extracellular sequences,
          which largely correspond to binding preferences for
          either GPI-anchored ephrin-A ligands or transmembrane
          ephrin-B ligands. Vertebrates have ten EphA and six
          EhpB receptors, which display promiscuous ligand
          interactions within each class. EphRs contain an ephrin
          binding domain and two fibronectin repeats
          extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. This allows
          ephrin/EphR dimers to form, leading to the activation
          of the intracellular tyr kinase domain. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling). The main
          effect of ephrin/EphR interaction is cell-cell
          repulsion or adhesion. Ephrin/EphR signaling is
          important in neural development and plasticity, cell
          morphogenesis and proliferation, cell-fate
          determination, embryonic development, tissue
          patterning, and angiogenesis.
          Length = 266

 Score = 31.2 bits (71), Expect = 0.041
 Identities = 12/46 (26%), Positives = 24/46 (52%)

Query: 15 IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          + E  ++ + +  +I+   G     + + I  EYM+ GSLD  L++
Sbjct: 53 LTEASIMGQFDHPNIIRLEGVVTKSRPVMIITEYMENGSLDKFLRE 98


>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional.
          Length = 478

 Score = 31.1 bits (70), Expect = 0.046
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 17  ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHI 68
           EL  L  C+   IV  +  F SD  + + MEY  GG L+  +K+  ++ EH+
Sbjct: 115 ELHCLAACDHFGIVKHFDDFKSDDKLLLIMEYGSGGDLNKQIKQ--RLKEHL 164


>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine
           Kinase, Discoidin Domain Receptor 1.  Protein Tyrosine
           Kinase (PTK) family; mammalian Discoidin Domain Receptor
           1 (DDR1) and homologs; catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. DDR1 is a
           member of the DDR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular discoidin
           homology domain, a transmembrane segment, an extended
           juxtamembrane region, and an intracellular catalytic
           domain. The binding of the ligand, collagen, to DDRs
           results in a slow but sustained receptor activation.
           DDR1 binds to all collagens tested to date (types I-IV).
           It is widely expressed in many tissues. It is abundant
           in the brain and is also found in keratinocytes, colonic
           mucosa epithelium, lung epithelium, thyroid follicles,
           and the islets of Langerhans. During embryonic
           development, it is found in the developing
           neuroectoderm. DDR1 is a key regulator of cell
           morphogenesis, differentiation and proliferation. It is
           important in the development of the mammary gland, the
           vasculator and the kidney. DDR1 is also found in human
           leukocytes, where it facilitates cell adhesion,
           migration, maturation, and cytokine production.
          Length = 304

 Score = 31.1 bits (70), Expect = 0.049
 Identities = 11/48 (22%), Positives = 24/48 (50%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLIL 58
           +   ++E+K+L      +I+   G  + +  + +  EYM+ G L+  L
Sbjct: 63  RNDFLKEVKILSRLKDPNIIRLLGVCVDEDPLCMITEYMENGDLNQFL 110


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
           protein Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase (CDK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKs are partly
           regulated by their subcellular localization, which
           defines substrate phosphorylation and the resulting
           specific function. CDK1, CDK2, CDK4, and CDK6 have
           well-defined functions in the cell cycle, such as the
           regulation of the early G1 phase by CDK4 or CDK6, the
           G1/S phase transition by CDK2, or the entry of mitosis
           by CDK1. They also exhibit overlapping cyclin
           specificity and functions in certain conditions.
           Knockout mice with a single CDK deleted remain viable
           with specific phenotypes, showing that some CDKs can
           compensate for each other. For example, CDK4 can
           compensate for the loss of CDK6, however, double
           knockout mice with both CDK4 and CDK6 deleted die in
           utero. CDK8 and CDK9 are mainly involved in
           transcription while CDK5 is implicated in neuronal
           function. CDK7 plays essential roles in both the cell
           cycle as a CDK-Activating Kinase (CAK) and in
           transcription as a component of the general
           transcription factor TFIIH.
          Length = 282

 Score = 30.5 bits (70), Expect = 0.054
 Identities = 14/61 (22%), Positives = 31/61 (50%), Gaps = 6/61 (9%)

Query: 15  IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDL---ILKKAGKIPEHILGT 71
           +RE+ +L E    +IV       +++ + +  EY D   +DL   + K+ G +  +++ +
Sbjct: 46  LREISLLKELKHPNIVKLLDVIHTERKLYLVFEYCD---MDLKKYLDKRPGPLSPNLIKS 102

Query: 72  I 72
           I
Sbjct: 103 I 103


>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine
           Kinases, Discoidin Domain Receptors.  Protein Tyrosine
           Kinase (PTK) family; Discoidin Domain Receptor (DDR)
           subfamily; catalytic (c) domain. The DDR subfamily
           consists of homologs of mammalian DDR1, DDR2, and
           similar proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           DDR subfamily members are receptor tyr kinases (RTKs)
           containing an extracellular discoidin homology domain, a
           transmembrane segment, an extended juxtamembrane region,
           and an intracellular catalytic domain. The binding of
           the ligand, collagen, to DDRs results in a slow but
           sustained receptor activation. DDRs regulate cell
           adhesion, proliferation, and extracellular matrix
           remodeling. They have been linked to a variety of human
           cancers including breast, colon, ovarian, brain, and
           lung. There is no evidence showing that DDRs act as
           transforming oncogenes. They are more likely to play a
           role in the regulation of tumor growth and metastasis.
          Length = 296

 Score = 30.4 bits (69), Expect = 0.062
 Identities = 14/53 (26%), Positives = 27/53 (50%)

Query: 9   TIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKA 61
             ++  ++E+K+L   +  +I    G    D  + + MEYM+ G L+  L+K 
Sbjct: 61  NAREDFLKEVKILSRLSDPNIARLLGVCTVDPPLCMIMEYMENGDLNQFLQKH 113


>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine
          Kinases, Class EphA Ephrin Receptors.  Protein Tyrosine
          Kinase (PTK) family; Ephrin Receptor (EphR) subfamily;
          most class EphA receptors including EphA3, EphA4,
          EphA5, and EphA7, but excluding EphA1, EphA2 and
          EphA10; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). In general, class EphA receptors bind
          GPI-anchored ephrin-A ligands. There are ten vertebrate
          EphA receptors (EphA1-10), which display promiscuous
          interactions with six ephrin-A ligands. One exception
          is EphA4, which also binds ephrins-B2/B3. EphRs contain
          an ephrin-binding domain and two fibronectin repeats
          extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling).
          Ephrin/EphR interaction mainly results in cell-cell
          repulsion or adhesion, making it important in neural
          development and plasticity, cell morphogenesis,
          cell-fate determination, embryonic development, tissue
          patterning, and angiogenesis. EphARs and ephrin-A
          ligands are expressed in multiple areas of the
          developing brain, especially in the retina and tectum.
          They are part of a system controlling retinotectal
          mapping.
          Length = 267

 Score = 30.6 bits (69), Expect = 0.064
 Identities = 13/50 (26%), Positives = 26/50 (52%)

Query: 11 KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          ++  + E  ++ + +  +I+   G     + + I  EYM+ GSLD  L+K
Sbjct: 49 RRDFLSEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDAFLRK 98


>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine
           Kinases, Tropomyosin Related Kinases.  Protein Tyrosine
           Kinase (PTK) family; Tropomyosin Related Kinase (Trk)
           subfamily; catalytic (c) domain. The Trk subfamily
           consists of TrkA, TrkB, TrkC, and similar proteins. The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Trk
           subfamily members are receptor tyr kinases (RTKs)
           containing an extracellular region with arrays of
           leucine-rich motifs flanked by two cysteine-rich
           clusters followed by two immunoglobulin-like domains, a
           transmembrane segment, and an intracellular catalytic
           domain. Binding to their ligands, the nerve growth
           factor (NGF) family of neutrotrophins, leads to Trk
           receptor oligomerization and activation of the catalytic
           domain. Trk receptors are mainly expressed in the
           peripheral and central nervous systems. They play
           important roles in cell fate determination, neuronal
           survival and differentiation, as well as in the
           regulation of synaptic plasticity. Altered expression of
           Trk receptors is associated with many human diseases.
          Length = 280

 Score = 30.5 bits (69), Expect = 0.077
 Identities = 16/55 (29%), Positives = 24/55 (43%)

Query: 8   PTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAG 62
              +K   RE ++L      +IV FYG         +  EYM+ G L+  L+  G
Sbjct: 49  NDARKDFEREAELLTNFQHENIVKFYGVCTEGDPPIMVFEYMEHGDLNKFLRSHG 103


>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein
          Serine/Threonine Kinase, Atypical Protein Kinase C
          iota.  Serine/Threonine Kinases (STKs), Atypical
          Protein Kinase C (aPKC) subfamily, iota isoform,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The aPKC subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. PKCs are classified into
          three groups (classical, atypical, and novel) depending
          on their mode of activation and the structural
          characteristics of their regulatory domain. aPKCs only
          require phosphatidylserine (PS) for activation. There
          are two aPKC isoforms, zeta and iota. PKC-iota is
          directly implicated in carcinogenesis. It is critical
          to oncogenic signaling mediated by Ras and Bcr-Abl. The
          PKC-iota gene is the target of tumor-specific gene
          amplification in many human cancers, and has been
          identified as a human oncogene. In addition to its role
          in transformed growth, PKC-iota also promotes invasion,
          chemoresistance, and tumor cell survival. Expression
          profiling of PKC-iota is a prognostic marker of poor
          clinical outcome in several human cancers. PKC-iota
          also plays a role in establishing cell polarity, and
          has critical embryonic functions.
          Length = 329

 Score = 30.4 bits (68), Expect = 0.082
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 25 NFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
          N   +VG +  F ++  +   +EY++GG L   +++  K+PE
Sbjct: 54 NHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPE 95


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
          cell-Associated Kinase-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Male germ
          cell-Associated Kinase (MAK)-like subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAK-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of human MAK and MAK-related kinase (MRK),
          Saccharomyces cerevisiae Ime2p, Schizosaccharomyces
          pombe Mei4-dependent protein 3 (Mde3) and Pit1,
          Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK,
          and similar proteins. These proteins play important
          roles during meiosis. MAK is highly expressed in
          testicular cells specifically in the meiotic phase, but
          is not essential for spermatogenesis and fertility. It
          functions as a coactivator of the androgen receptor in
          prostate cells. MRK, also called Intestinal Cell Kinase
          (ICK), is expressed ubiquitously, with highest
          expression in the ovary and uterus. A missense mutation
          in MRK causes endocrine-cerebro-osteodysplasia (ECO),
          suggesting that this protein plays an important role in
          the development of many organs. MAK and MRK may be
          involved in regulating cell cycle and cell fate. Ime2p
          is a meiosis-specific kinase that is important during
          meiotic initiation and during the later stages of
          meiosis. Mde3 functions downstream of the transcription
          factor Mei-4 which is essential for meiotic prophase I.
          Length = 283

 Score = 30.2 bits (69), Expect = 0.083
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 16 RELKVLHECNF-AHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGK-IPEH 67
          RE+K L + N   +IV     F  + ++    EYM+G    L+  + GK   E 
Sbjct: 46 REVKSLRKLNEHPNIVKLKEVFRENDELYFVFEYMEGNLYQLMKDRKGKPFSES 99


>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic
           subunit; Provisional.
          Length = 340

 Score = 30.3 bits (68), Expect = 0.084
 Identities = 16/75 (21%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 13  QIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHILGTI 72
            +  E K+L+  N    V  YG+F  +  + + +E++ GG     L++  + P  +    
Sbjct: 77  HVFSERKILNYINHPFCVNLYGSFKDESYLYLVLEFVIGGEFFTFLRRNKRFPNDV---- 132

Query: 73  TSATHSSLIVIYYKY 87
               +++ IV+ ++Y
Sbjct: 133 -GCFYAAQIVLIFEY 146


>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
          Protein Serine/Threonine Kinases.  Serine/Threonine
          Kinases (STKs), Microtubule-associated serine/threonine
          (MAST) kinase subfamily, fungal Rim15-like kinases,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAST kinase
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this group
          include Saccharomyces cerevisiae Rim15,
          Schizosaccharomyces pombe cek1, and similar fungal
          proteins. They contain a central catalytic domain,
          which contains an insert relative to MAST kinases. In
          addition, Rim15 contains a C-terminal signal receiver
          (REC) domain while cek1 contains an N-terminal PAS
          domain. Rim15 (or Rim15p) functions as a regulator of
          meiosis. It acts as a downstream effector of PKA and
          regulates entry into stationary phase (G0). Thus, it
          plays a crucial role in regulating yeast proliferation,
          differentiation, and aging. Cek1 may facilitate
          progression of mitotic anaphase.
          Length = 260

 Score = 30.1 bits (68), Expect = 0.092
 Identities = 12/38 (31%), Positives = 21/38 (55%)

Query: 29 IVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
          +   Y +F S   + + MEY++GG    ++K  G +PE
Sbjct: 59 VAKLYYSFQSKDYLYLVMEYLNGGDCASLIKTLGGLPE 96


>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase,
           c-Jun N-terminal Kinase.  Serine/Threonine Kinases
           (STKs), c-Jun N-terminal kinase (JNK) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The JNK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. JNKs are
           mitogen-activated protein kinases (MAPKs) that are
           involved in many stress-activated responses including
           those during inflammation, neurodegeneration, apoptosis,
           and persistent pain sensitization, among others. They
           are also essential regulators of physiological and
           pathological processes and are involved in the
           pathogenesis of several diseases such as diabetes,
           atherosclerosis, stroke, Parkinson's and Alzheimer's.
           Vetebrates harbor three different JNK genes (Jnk1, Jnk2,
           and Jnk3) that are alternatively spliced to produce at
           least 10 isoforms. JNKs are specifically activated by
           the MAPK kinases MKK4 and MKK7, which are in turn
           activated by upstream MAPK kinase kinases as a result of
           different stimuli including stresses such as ultraviolet
           (UV) irradiation, hyperosmolarity, heat shock, or
           cytokines. JNKs activate a large number of different
           substrates based on specific stimulus, cell type, and
           cellular condition, and may be implicated in seemingly
           contradictory functions.
          Length = 353

 Score = 30.1 bits (68), Expect = 0.11
 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 6/49 (12%)

Query: 8   PTIKKQIIRELKVLHECNFAHIVGFYGAFISD------QDISICMEYMD 50
            T  K+  REL ++   N  +I+G    F         QD+ + ME MD
Sbjct: 56  VTHAKRAYRELVLMKLVNHKNIIGLLNVFTPQKSLEEFQDVYLVMELMD 104


>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor 2.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, LATS2 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The LATS subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. LATS functions as a tumor
           suppressor and is implicated in cell cycle regulation.
           LATS2 is an essential mitotic regulator responsible for
           coordinating accurate cytokinesis completion and
           governing the stabilization of other mitotic regulators.
           It is also critical in the maintenance of proper
           chromosome number, genomic stability, mitotic fidelity,
           and the integrity of centrosome duplication.
           Downregulation of LATS2 is associated with poor
           prognosis in acute lymphoblastic leukemia and breast
           cancer.
          Length = 381

 Score = 30.0 bits (67), Expect = 0.12
 Identities = 13/52 (25%), Positives = 25/52 (48%)

Query: 17  ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHI 68
           E  +L E +   +V  Y +F    ++   M+Y+ GG +  +L +    PE +
Sbjct: 51  ERDILAEADNEWVVKLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMEVFPEVL 102


>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine
          Kinase, Src.  Protein Tyrosine Kinase (PTK) family; Src
          kinase; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Src (or
          c-Src) is a cytoplasmic (or non-receptor) tyr kinase,
          containing an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          with a conserved tyr. It is activated by
          autophosphorylation at the tyr kinase domain, and is
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is
          the vertebrate homolog of the oncogenic protein (v-Src)
          from Rous sarcoma virus. Together with other Src
          subfamily proteins, it is involved in signaling
          pathways that regulate cytokine and growth factor
          responses, cytoskeleton dynamics, cell proliferation,
          survival, and differentiation. Src also play a role in
          regulating cell adhesion, invasion, and motility in
          cancer cells and tumor vasculature, contributing to
          cancer progression and metastasis. Elevated levels of
          Src kinase activity have been reported in a variety of
          human cancers. Several inhibitors of Src have been
          developed as anti-cancer drugs. Src is also implicated
          in acute inflammatory responses and osteoclast
          function.
          Length = 262

 Score = 29.6 bits (66), Expect = 0.16
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 15 IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILK 59
          ++E +V+ +     +V  Y A +S++ I I  EYM  GSL   LK
Sbjct: 49 LQEAQVMKKLRHEKLVQLY-AVVSEEPIYIVTEYMSKGSLLDFLK 92


>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine
          Kinases, Bruton's tyrosine kinase and Bone marrow
          kinase on the X chromosome.  Protein Tyrosine Kinase
          (PTK) family; Bruton's tyrosine kinase (Btk) and Bone
          marrow kinase on the X chromosome (Bmx); catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Btk and
          Bmx (also named Etk) are members of the Tec subfamily
          of proteins, which are cytoplasmic (or nonreceptor) tyr
          kinases with similarity to Src kinases in that they
          contain Src homology protein interaction domains (SH3,
          SH2) N-terminal to the catalytic tyr kinase domain.
          Unlike Src kinases, most Tec subfamily members (except
          Rlk) also contain an N-terminal pleckstrin homology
          (PH) domain, which binds the products of PI3K and
          allows membrane recruitment and activation. In
          addition, Btk contains the Tec homology (TH) domain
          with proline-rich and zinc-binding regions. Tec kinases
          are expressed mainly by haematopoietic cells. Btk is
          expressed in B-cells, and a variety of myeloid cells
          including mast cells, platelets, neutrophils, and
          dendrictic cells. It interacts with a variety of
          partners, from cytosolic proteins to nuclear
          transcription factors, suggesting a diversity of
          functions. Stimulation of a diverse array of cell
          surface receptors, including antigen engagement of the
          B-cell receptor (BCR), leads to PH-mediated membrane
          translocation of Btk and subsequent phosphorylation by
          Src kinase and activation. Btk plays an important role
          in the life cycle of B-cells including their
          development, differentiation, proliferation, survival,
          and apoptosis. Mutations in Btk cause the primary
          immunodeficiency disease, X-linked agammaglobulinaemia
          (XLA) in humans. Bmx is primarily expressed in bone
          marrow and the arterial endothelium, and plays an
          important role in ischemia-induced angiogenesis. It
          facilitates arterial growth, capillary formation,
          vessel maturation, and bone marrow-derived endothelial
          progenitor cell mobilization.
          Length = 256

 Score = 29.1 bits (65), Expect = 0.18
 Identities = 17/54 (31%), Positives = 26/54 (48%)

Query: 13 QIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
          + I E KV+ + +   +V  YG     + I I  EYM  G L   L++ GK  +
Sbjct: 45 EFIEEAKVMMKLSHEKLVQLYGVCTKQRPIYIVTEYMSNGCLLNYLREHGKRFQ 98


>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine
          Kinase, Ephrin Receptor A10.  Protein Tyrosine Kinase
          (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10
          receptor; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). In general, class EphA receptors bind
          GPI-anchored ephrin-A ligands. There are ten vertebrate
          EphA receptors (EphA1-10), which display promiscuous
          interactions with six ephrin-A ligands. EphRs contain
          an ephrin binding domain and two fibronectin repeats
          extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling). EphA10,
          which contains an inactive tyr kinase domain, may
          function to attenuate signals of co-clustered active
          receptors. EphA10 is mainly expressed in the testis.
          Ephrin/EphR interaction results in cell-cell repulsion
          or adhesion, making it important in neural development
          and plasticity, cell morphogenesis, cell-fate
          determination, embryonic development, tissue
          patterning, and angiogenesis.
          Length = 266

 Score = 29.1 bits (65), Expect = 0.18
 Identities = 14/44 (31%), Positives = 21/44 (47%)

Query: 17 ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          E   L + + ++IV   G       + I  EYM  G+LD  L+K
Sbjct: 56 EALTLGQFDHSNIVRLEGVITRGNTMMIVTEYMSNGALDSFLRK 99


>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine
           Kinases, Tyrosine kinase expressed in hepatocellular
           carcinoma and Resting lymphocyte kinase.  Protein
           Tyrosine Kinase (PTK) family; Tyrosine kinase expressed
           in hepatocellular carcinoma (Tec) and Resting lymphocyte
           kinase (Rlk); catalytic (c) domain. The PTKc family is
           part of a larger superfamily, that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Tec and
           Rlk (also named Txk) are members of the Tec subfamily of
           proteins, which are cytoplasmic (or nonreceptor) tyr
           kinases with similarity to Src kinases in that they
           contain Src homology protein interaction domains (SH3,
           SH2) N-terminal to the catalytic tyr kinase domain.
           Unlike Src kinases, most Tec subfamily members (except
           Rlk) also contain an N-terminal pleckstrin homology (PH)
           domain, which binds the products of PI3K and allows
           membrane recruitment and activation. Instead of PH, Rlk
           contains an N-terminal cysteine-rich region. In addition
           to PH, Tec also contains the Tec homology (TH) domain
           with proline-rich and zinc-binding regions. Tec kinases
           are expressed mainly by haematopoietic cells. Tec is
           more widely-expressed than other Tec subfamily kinases.
           It is found in endothelial cells, both B- and T-cells,
           and a variety of myeloid cells including mast cells,
           erythroid cells, platelets, macrophages and neutrophils.
           Rlk is expressed in T-cells and mast cell lines. Tec and
           Rlk are both key components of T-cell receptor (TCR)
           signaling. They are important in TCR-stimulated
           proliferation, IL-2 production and phopholipase C-gamma1
           activation.
          Length = 256

 Score = 29.0 bits (65), Expect = 0.19
 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 15  IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGS-LDLILKKAGKIPEHILGTI 72
           I E KV+ + +   +V  YG     + + I  E+M+ G  L+ + ++ GK+ + +L ++
Sbjct: 47  IEEAKVMMKLSHPKLVQLYGVCTQQKPLYIVTEFMENGCLLNYLRQRQGKLSKDMLLSM 105


>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Tyrosine kinase expressed in hepatocellular
          carcinoma (Tec) subfamily; catalytic (c) domain. The
          Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk
          (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Tec
          kinases are cytoplasmic (or nonreceptor) tyr kinases
          (nRTKs) with similarity to Src kinases in that they
          contain Src homology protein interaction domains (SH3,
          SH2) N-terminal to the catalytic tyr kinase domain.
          Unlike Src kinases, most Tec subfamily members (except
          Rlk) also contain an N-terminal pleckstrin homology
          (PH) domain, which binds the products of PI3K and
          allows membrane recruitment and activation. In
          addition, some members contain the Tec homology (TH)
          domain, which contains proline-rich and zinc-binding
          regions. Tec kinases form the second largest subfamily
          of nRTKs and are expressed mainly by haematopoietic
          cells, although Tec and Bmx are also found in
          endothelial cells. B-cells express Btk and Tec, while
          T-cells express Itk, Txk, and Tec. Collectively, Tec
          kinases are expressed in a variety of myeloid cells
          such as mast cells, platelets, macrophages, and
          dendritic cells. Each Tec kinase shows a distinct
          cell-type pattern of expression. The function of Tec
          kinases in lymphoid cells have been studied
          extensively. They play important roles in the
          development, differentiation, maturation, regulation,
          survival, and function of B-cells and T-cells.
          Mutations in Btk cause the severe B-cell
          immunodeficiency, X-linked agammaglobulinaemia (XLA).
          Length = 256

 Score = 29.3 bits (66), Expect = 0.20
 Identities = 14/40 (35%), Positives = 20/40 (50%)

Query: 15 IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
          I E KV+ + +  ++V  YG     + I I  EYM  G L
Sbjct: 47 IEEAKVMMKLSHPNLVQLYGVCTKQRPIFIVTEYMANGCL 86


>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 4.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 4, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK4 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK4 regulates cell morphology and
           cytoskeletal organization. It is essential for embryonic
           viability and proper neural development. Mice lacking
           PAK4 die due to defects in the fetal heart. In addition,
           their spinal cord motor neurons showed failure to
           differentiate and migrate. PAK4 also plays a role in
           cell survival and tumorigenesis. It is overexpressed in
           many primary tumors including colon, esophageal, and
           mammary tumors. PAK4 has also been implicated in viral
           and bacterial infection pathways.
          Length = 292

 Score = 28.8 bits (64), Expect = 0.23
 Identities = 18/83 (21%), Positives = 43/83 (51%), Gaps = 6/83 (7%)

Query: 7   KPTIKKQIIREL-----KVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKA 61
           K  ++KQ  REL      ++ +    ++V  Y +++   ++ + ME+++GG+L  I+   
Sbjct: 52  KMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHT 111

Query: 62  GKIPEHILGTITSATHSSLIVIY 84
            ++ E  +  +  A   +L V++
Sbjct: 112 -RMNEEQIAAVCLAVLKALSVLH 133


>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein
          Serine/Threonine Kinase, Atypical Protein Kinase C
          zeta.  Serine/Threonine Kinases (STKs), Atypical
          Protein Kinase C (aPKC) subfamily, zeta isoform,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The aPKC subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. PKCs are classified into
          three groups (classical, atypical, and novel) depending
          on their mode of activation and the structural
          characteristics of their regulatory domain. aPKCs only
          require phosphatidylserine (PS) for activation. There
          are two aPKC isoforms, zeta and iota. PKC-zeta plays a
          critical role in activating the glucose transport
          response. It is activated by glucose, insulin, and
          exercise through diverse pathways. PKC-zeta also plays
          a central role in maintaining cell polarity in yeast
          and mammalian cells. In addition, it affects actin
          remodeling in muscle cells.
          Length = 327

 Score = 28.8 bits (64), Expect = 0.24
 Identities = 11/38 (28%), Positives = 23/38 (60%)

Query: 29 IVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
          +VG +  F +   + + +EY++GG L   +++  K+PE
Sbjct: 58 LVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPE 95


>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein
           Tyrosine Kinases, Janus kinases.  Protein Tyrosine
           Kinase (PTK) family; Janus kinase (Jak) subfamily;
           catalytic (c) domain (repeat 2). The Jak subfamily is
           composed of Jak1, Jak2, Jak3, TYK2, and similar
           proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           Jak subfamily proteins are cytoplasmic (or nonreceptor)
           tyr kinases containing an N-terminal FERM domain,
           followed by a Src homology 2 (SH2) domain, a
           pseudokinase domain, and a C-terminal tyr kinase
           catalytic domain. Most Jaks are expressed in a wide
           variety of tissues, except for Jak3, which is expressed
           only in hematopoietic cells. Jaks are crucial for
           cytokine receptor signaling. They are activated by
           autophosphorylation upon cytokine-induced receptor
           aggregation, and subsequently trigger downstream
           signaling events such as the phosphorylation of signal
           transducers and activators of transcription (STATs).
           Jaks are also involved in regulating the surface
           expression of some cytokine receptors. The Jak-STAT
           pathway is involved in many biological processes
           including hematopoiesis, immunoregulation, host defense,
           fertility, lactation, growth, and embryogenesis.
          Length = 284

 Score = 28.5 bits (64), Expect = 0.33
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 16  RELKVLHECNFAHIVGFYGAFISDQDISIC--MEYMDGGSLDLILKK 60
           RE+++L   +  +IV + G        S+   MEY+  GSL   L++
Sbjct: 55  REIEILRTLDHENIVKYKGVCEKPGGRSLRLIMEYLPSGSLRDYLQR 101


>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 3.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 3 (TAO3) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO3 is also known as JIK (JNK inhibitory kinase) or KFC
           (kinase from chicken). It specifically activates c-Jun
           N-terminal kinase (JNK), presumably by phosphorylating
           and activating MKK4/MKK7. In Saccharomyces cerevisiae,
           TAO3 is a component of the RAM (regulation of Ace2p
           activity and cellular morphogenesis) signaling pathway.
           TAO3 is upregulated in retinal ganglion cells after
           axotomy, and may play a role in apoptosis.
          Length = 313

 Score = 28.5 bits (63), Expect = 0.35
 Identities = 12/46 (26%), Positives = 25/46 (54%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLI 57
           + II+E+K L +    + + + G ++ +    + MEY  G + DL+
Sbjct: 66  QDIIKEVKFLQQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLL 111


>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the
          Protein Tyrosine Kinase, Janus kinase 1.  Protein
          Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1);
          pseudokinase domain (repeat 1). The PTKc (catalytic
          domain) family to which this subfamily belongs, is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Jak1 is
          a member of the Janus kinase (Jak) subfamily of
          proteins, which are cytoplasmic (or nonreceptor) tyr
          kinases containing an N-terminal FERM domain, followed
          by a Src homology 2 (SH2) domain, a pseudokinase
          domain, and a C-terminal tyr kinase domain. The
          pseudokinase domain shows similarity to tyr kinases but
          lacks crucial residues for catalytic activity and ATP
          binding. It modulates the kinase activity of the
          C-terminal catalytic domain. Jaks are crucial for
          cytokine receptor signaling. They are activated by
          autophosphorylation upon cytokine-induced receptor
          aggregation, and subsequently trigger downstream
          signaling events such as the phosphorylation of signal
          transducers and activators of transcription (STATs).
          Jak1 is widely expressed in many tissues. Many
          cytokines are dependent on Jak1 for signaling,
          including those that use the shared receptor subunits
          common gamma chain (IL-2, IL-4, IL-7, IL-9, IL-15,
          IL-21) and gp130 (IL-6, IL-11, oncostatin M, G-CSF, and
          IFNs, among others). The many varied interactions of
          Jak1 and its ubiquitous expression suggest many
          biological roles. Jak1 is important in neurological
          development, as well as in lymphoid development and
          function. It also plays a role in the pathophysiology
          of cardiac hypertrophy and heart failure. A mutation in
          the ATP-binding site of Jak1 was identified in a human
          uterine leiomyosarcoma cell line, resulting in
          defective cytokine induction and antigen presentation,
          thus allowing the tumor to evade the immune system.
          Length = 262

 Score = 28.4 bits (63), Expect = 0.35
 Identities = 11/33 (33%), Positives = 19/33 (57%)

Query: 28 HIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          HIV  YG  + D +  +  E+++ G LDL + +
Sbjct: 65 HIVLLYGVCVRDVENIMVEEFVEFGPLDLFMHR 97


>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 6.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 6, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK6 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK6 may play a role in stress responses
           through its activation by the mitogen-activated protein
           kinase (MAPK) p38 and MAPK kinase 6 (MKK6) pathway. PAK6
           is highly expressed in the brain. It is not required for
           viability, but together with PAK5, it is required for
           normal levels of locomotion and activity, and for
           learning and memory. Increased expression of PAK6 is
           found in primary and metastatic prostate cancer. PAK6
           may play a role in the regulation of motility.
          Length = 297

 Score = 28.5 bits (63), Expect = 0.38
 Identities = 16/76 (21%), Positives = 41/76 (53%), Gaps = 6/76 (7%)

Query: 10  IKKQIIREL-----KVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKI 64
           ++KQ  REL      ++ +    ++V  Y +++  +++ + ME++ GG+L  I+ +  ++
Sbjct: 56  LRKQQRRELLFNEVVIMRDYQHQNVVEMYKSYLVGEELWVLMEFLQGGALTDIVSQT-RL 114

Query: 65  PEHILGTITSATHSSL 80
            E  + T+  +   +L
Sbjct: 115 NEEQIATVCESVLQAL 130


>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of
          Phototropin-like Protein Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Phototropin-like
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          phototropin-like subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Included in this
          subfamily are plant phototropins and predominantly
          uncharacterized fungal STKs whose catalytic domains
          resemble the phototropin kinase domain. One protein
          from Neurospora crassa is called nrc-2. Phototropins
          are blue-light receptors that control responses such as
          phototropism, stromatal opening, and chloroplast
          movement in order to optimize the photosynthetic
          efficiency of plants. They are light-activated STKs
          that contain an N-terminal photosensory domain and a
          C-terminal catalytic domain. The N-terminal domain
          contains two LOV (Light, Oxygen or Voltage) domains
          that binds FMN. Photoexcitation of the LOV domains
          results in autophosphorylation at multiple sites and
          activation of the catalytic domain. Neurospora crassa
          nrc-2 plays a role in growth and development by
          controlling entry into the conidiation program.
          Length = 316

 Score = 28.0 bits (63), Expect = 0.43
 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 9/64 (14%)

Query: 6  VKPTIKKQIIRELKVLHEC-------NFAH--IVGFYGAFISDQDISICMEYMDGGSLDL 56
          +K   KK++I+  KV              H  +   Y +F ++  + + M+Y  GG L  
Sbjct: 31 LKVLDKKEMIKRNKVKRVLTEQEILATLDHPFLPTLYASFQTETYLCLVMDYCPGGELFR 90

Query: 57 ILKK 60
          +L++
Sbjct: 91 LLQR 94


>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 2.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 2 (TAO2) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           Human TAO2 is also known as prostate-derived Ste20-like
           kinase (PSK) and was identified in a screen for
           overexpressed RNAs in prostate cancer. TAO2 activates
           both p38 and c-Jun N-terminal kinase (JNK), by
           phosphorylating and activating the respective MAP/ERK
           kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6
           and MKK4/MKK7. TAO2 contains a long C-terminal extension
           with autoinhibitory segments. It is activated by the
           release of this inhibition and the phosphorylation of
           its activation loop serine. TAO2 functions as a
           regulator of actin cytoskeletal and microtubule
           organization. In addition, it regulates the transforming
           growth factor-activated kinase 1 (TAK1), which is a
           MAPKKK that plays an essential role in the signaling
           pathways of tumor necrosis factor (TNF), interleukin 1
           (IL-1), and Toll-like receptor (TLR).
          Length = 308

 Score = 28.1 bits (62), Expect = 0.45
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHILGT 71
           + II+E++ L +    + + + G ++ +    + MEY  G + DL+  +  K P   +  
Sbjct: 60  QDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLL--EVHKKPLQEV-E 116

Query: 72  ITSATHSSLIVIYY 85
           I + TH +L  + Y
Sbjct: 117 IAAVTHGALQGLAY 130


>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and
           Dbf2p-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), ROCK- and NDR-like
           subfamily, fungal Sid2p- and Dbf2p-like proteins,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sid2p- and
           Dbf2p-like group is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This group contains fungal kinases including
           Schizosaccharomyces pombe Sid2p and Saccharomyces
           cerevisiae Dbf2p. Group members show similarity to NDR
           kinases in that they contain an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Sid2p plays a
           crucial role in the septum initiation network (SIN) and
           in the initiation of cytokinesis. Dbf2p is important in
           regulating the mitotic exit network (MEN) and in
           cytokinesis.
          Length = 333

 Score = 28.1 bits (63), Expect = 0.50
 Identities = 14/56 (25%), Positives = 25/56 (44%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEH 67
           + ++ E  +L       +V    AF  D+ + + MEY+ GG    +L   G + E 
Sbjct: 46  RHVLTERDILTTTKSEWLVKLLYAFQDDEYLYLAMEYVPGGDFRTLLNNLGVLSED 101


>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional.
          Length = 294

 Score = 27.9 bits (62), Expect = 0.52
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 15 IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          IRE+ +L E    +IV       S++ + +  EY     LDL LKK
Sbjct: 49 IREISLLKEMQHGNIVRLQDVVHSEKRLYLVFEY-----LDLDLKK 89


>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine
          Kinase, Fer.  Protein Tyrosine Kinase (PTK) family; Fer
          kinase; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Fer
          kinase is a member of the Fes subfamily of proteins
          which are cytoplasmic (or nonreceptor) tyr kinases
          containing an N-terminal region with FCH (Fes/Fer/CIP4
          homology) and coiled-coil domains, followed by a SH2
          domain, and a C-terminal catalytic domain. Fer kinase
          is expressed in a wide variety of tissues, and is found
          to reside in both the cytoplasm and the nucleus. It
          plays important roles in neuronal polarization and
          neurite development, cytoskeletal reorganization, cell
          migration, growth factor signaling, and the regulation
          of cell-cell interactions mediated by adherens
          junctions and focal adhesions. Fer kinase also
          regulates cell cycle progression in malignant cells.
          Length = 250

 Score = 28.0 bits (62), Expect = 0.58
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 10 IKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          +K + + E ++L + +  +IV   G     Q I I ME + GG     L+K
Sbjct: 35 LKIKFLSEARILKQYDHPNIVKLIGVCTQRQPIYIVMELVPGGDFLSFLRK 85


>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau;
           Validated.
          Length = 824

 Score = 28.0 bits (63), Expect = 0.60
 Identities = 7/13 (53%), Positives = 10/13 (76%)

Query: 65  PEHILGTITSATH 77
           P+ ++GTI S TH
Sbjct: 160 PDKVIGTIRSRTH 172


>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin
          Receptor-like Protein Tyrosine Kinases.  Protein
          Tyrosine Kinase (PTK) family; Insulin Receptor (InsR)
          subfamily; catalytic (c) domain. The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). The InsR subfamily is
          composed of InsR, Insulin-like Growth Factor-1 Receptor
          (IGF-1R), and similar proteins. PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. InsR and
          IGF-1R are receptor tyr kinases (RTKs) composed of two
          alphabeta heterodimers. Binding of the ligand (insulin,
          IGF-1, or IGF-2) to the extracellular alpha subunit
          activates the intracellular tyr kinase domain of the
          transmembrane beta subunit. Receptor activation leads
          to autophosphorylation, stimulating downstream kinase
          activities, which initiate signaling cascades and
          biological function. InsR and IGF-1R, which share 84%
          sequence identity in their kinase domains, display
          physiologically distinct yet overlapping functions in
          cell growth, differentiation, and metabolism. InsR
          activation leads primarily to metabolic effects while
          IGF-1R activation stimulates mitogenic pathways. In
          cells expressing both receptors, InsR/IGF-1R hybrids
          are found together with classical receptors. Both
          receptors can interact with common adaptor molecules
          such as IRS-1 and IRS-2.
          Length = 277

 Score = 27.7 bits (62), Expect = 0.67
 Identities = 13/42 (30%), Positives = 19/42 (45%)

Query: 13 QIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
          + + E  V+ E N  H+V   G   + Q   + ME M  G L
Sbjct: 55 EFLNEASVMKEFNCHHVVRLLGVVSTGQPTLVVMELMAKGDL 96


>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 5.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 5, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK5 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK5 is mainly expressed in the brain. It
           is not required for viability, but together with PAK6,
           it is required for normal levels of locomotion and
           activity, and for learning and memory. PAK5 cooperates
           with Inca (induced in neural crest by AP2) in the
           regulation of cell adhesion and cytoskeletal
           organization in the embryo and in neural crest cells
           during craniofacial development. PAK5 may also play a
           role in controlling the signaling of Raf-1, an effector
           of Ras, at the mitochondria.
          Length = 292

 Score = 27.7 bits (61), Expect = 0.68
 Identities = 14/57 (24%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 7   KPTIKKQIIREL-----KVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLIL 58
           K  ++KQ  REL      ++ + +  ++V  Y +++   ++ + ME+++GG+L  I+
Sbjct: 54  KMDLRKQQRRELLFNEVVIMRDYHHENVVDMYNSYLVGDELWVVMEFLEGGALTDIV 110


>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor 1.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, LATS1 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The LATS subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. LATS functions as a tumor
           suppressor and is implicated in cell cycle regulation.
           Inactivation of LATS1 in mice results in the development
           of various tumors, including sarcomas and ovarian
           cancer. Promoter methylation, loss of heterozygosity,
           and missense mutations targeting the LATS1 gene have
           also been found in human sarcomas and ovarian cancers.
           In addition, decreased expression of LATS1 is associated
           with an aggressive phenotype and poor prognosis. LATS1
           induces G2 arrest and promotes cytokinesis. It may be a
           component of the mitotic exit network in higher
           eukaryotes.
          Length = 382

 Score = 27.7 bits (61), Expect = 0.70
 Identities = 14/52 (26%), Positives = 26/52 (50%)

Query: 17  ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHI 68
           E  +L E +   +V  Y +F    ++   M+Y+ GG +  +L + G  PE +
Sbjct: 51  ERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPEDL 102


>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Apoptosis signal-regulating kinase.
           Serine/threonine kinases (STKs), Apoptosis
           signal-regulating kinase (ASK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ASK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Subfamily members
           are mitogen-activated protein kinase (MAPK) kinase
           kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1,
           ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. ASK1 (also called
           MAPKKK5) functions in the c-Jun N-terminal kinase (JNK)
           and p38 MAPK signaling pathways by directly activating
           their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It
           plays important roles in cytokine and stress responses,
           as well as in reactive oxygen species (ROS)-mediated
           cellular responses. ASK1 is implicated in various
           diseases mediated by oxidative stress including
           inschemic heart disease, hypertension, vessel injury,
           brain ischemia, Fanconi anemia, asthma, and pulmonary
           edema, among others. ASK2 (also called MAPKKK6)
           functions only in a heteromeric complex with ASK1, and
           can activate ASK1 by direct phosphorylation. The
           function of MAPKKK15 is still unknown.
          Length = 268

 Score = 27.5 bits (61), Expect = 0.71
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 16  RELKVLHE-------CNFAHIVGFYGAFISDQDISICMEYMDGGSL-DLILKKAGKIPEH 67
           R ++ LHE           +IV + G+   +    I ME + GGSL  L+  K G + ++
Sbjct: 47  RYVQPLHEEIALHSYLKHRNIVQYLGSDSENGFFKIFMEQVPGGSLSALLRSKWGPLKDN 106


>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 3.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek3 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek3 is primarily localized
          in the cytoplasm and shows no cell cycle-dependent
          changes in its activity. It is present in the axons of
          neurons and affects morphogenesis and polarity through
          its regulation of microtubule acetylation. Nek3
          modulates the signaling of the prolactin receptor
          through its activation of Vav2 and contributes to
          prolactin-mediated motility of breast cancer cells.
          Length = 255

 Score = 27.6 bits (61), Expect = 0.72
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 16 RELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
          +E  +L +    +IV F  +F +D  + I MEY DGG L
Sbjct: 47 KEAVLLAKMKHPNIVAFKESFEADGHLYIVMEYCDGGDL 85


>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the
          Protein Tyrosine Kinases, Janus kinases.  Protein
          Tyrosine Kinase (PTK) family; Janus kinase (Jak)
          subfamily; pseudokinase domain (repeat1). The Jak
          subfamily is composed of Jak1, Jak2, Jak3, TYK2, and
          similar proteins. The PTKc (catalytic domain) family to
          which this subfamily belongs, is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. Jak subfamily proteins are cytoplasmic (or
          nonreceptor) tyr kinases containing an N-terminal FERM
          domain, followed by a Src homology 2 (SH2) domain, a
          pseudokinase domain, and a C-terminal catalytic tyr
          kinase domain. The pseudokinase domain shows similarity
          to tyr kinases but lacks crucial residues for catalytic
          activity and ATP binding. It modulates the kinase
          activity of the C-terminal catalytic domain. Most Jaks
          are expressed in a wide variety of tissues, except for
          Jak3, which is expressed only in hematopoietic cells.
          Jaks are crucial for cytokine receptor signaling. They
          are activated by autophosphorylation upon
          cytokine-induced receptor aggregation, and subsequently
          trigger downstream signaling events such as the
          phosphorylation of signal transducers and activators of
          transcription (STATs). Jaks are also involved in
          regulating the surface expression of some cytokine
          receptors. The Jak-STAT pathway is involved in many
          biological processes including hematopoiesis,
          immunoregulation, host defense, fertility, lactation,
          growth, and embryogenesis.
          Length = 259

 Score = 27.4 bits (61), Expect = 0.77
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 28 HIVGFYGAFISDQDISICMEYMDGGSLDLILKKAG 62
          H+V  YG  + D++I +  EY+  G LD+ L +  
Sbjct: 62 HLVKLYGVCVRDENI-MVEEYVKFGPLDVFLHREK 95


>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 1.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek1 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek1 is associated with
          centrosomes throughout the cell cycle. It is involved
          in the formation of primary cilium and in the
          maintenance of centrosomes. It cycles through the
          nucleus and may be capable of relaying signals between
          the cilium and the nucleus. Nek1 is implicated in the
          development of polycystic kidney disease, which is
          characterized by benign polycystic tumors formed by
          abnormal overgrowth of renal epithelial cells. It
          appears also to be involved in DNA damage response, and
          may be important for both correct DNA damage checkpoint
          activation and DNA repair.
          Length = 256

 Score = 27.5 bits (61), Expect = 0.77
 Identities = 12/39 (30%), Positives = 22/39 (56%)

Query: 16 RELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
          +E+ VL      +IV +  +F  + ++ I M+Y +GG L
Sbjct: 48 KEVAVLSNMKHPNIVQYQESFEENGNLYIVMDYCEGGDL 86


>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 9-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK9-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK9 and CDK12
          from higher eukaryotes, yeast BUR1, C-type plant CDKs
          (CdkC), and similar proteins. CDK9, BUR1, and CdkC are
          functionally equivalent. They act as a kinase for the
          C-terminal domain of RNA polymerase II and participate
          in regulating mutliple steps of gene expression
          including transcription elongation and RNA processing.
          CDK9 and CdkC associate with T-type cyclins while BUR1
          associates with the cyclin BUR2. CDK12 is a unique CDK
          that contains an arginine/serine-rich (RS) domain,
          which is predominantly found in splicing factors. CDK12
          interacts with cyclins L1 and L2, and participates in
          regulating transcription and alternative splicing.
          Length = 287

 Score = 27.5 bits (62), Expect = 0.77
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 15 IRELKVLHECNFAHIVGFYGAFISDQDISICM--EYMD 50
          IRE+K+L +    +IV       S    SI M  EYMD
Sbjct: 46 IREIKLLQKLRHPNIVRLKEIVTSKGKGSIYMVFEYMD 83


>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of
          the Protein Tyrosine Kinases, Janus kinases 2 and 3.
          Protein Tyrosine Kinase (PTK) family; Janus kinase 2
          (Jak2) and Jak3; pseudokinase domain (repeat 1). The
          PTKc (catalytic domain) family to which this subfamily
          belongs, is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Jak2 and
          Jak3 are members of the Janus kinase (Jak) subfamily of
          proteins, which are cytoplasmic (or nonreceptor) tyr
          kinases containing an N-terminal FERM domain, followed
          by a Src homology 2 (SH2) domain, a pseudokinase
          domain, and a C-terminal tyr kinase domain. The
          pseudokinase domain shows similarity to tyr kinases but
          lacks crucial residues for catalytic activity and ATP
          binding. It modulates the kinase activity of the
          C-terminal catalytic domain. Jaks are crucial for
          cytokine receptor signaling. They are activated by
          autophosphorylation upon cytokine-induced receptor
          aggregation, and subsequently trigger downstream
          signaling events such as the phosphorylation of signal
          transducers and activators of transcription (STATs).
          Jak2 is widely expressed in many tissues while Jak3 is
          expressed only in hematopoietic cells. Jak2 is
          essential for the signaling of hormone-like cytokines
          such as growth hormone, erythropoietin, thrombopoietin,
          and prolactin, as well as some IFNs and cytokines that
          signal through the IL-3 and gp130 receptors. Jak3 binds
          the shared receptor subunit common gamma chain and
          thus, is essential in the signaling of cytokines that
          use it such as IL-2, IL-4, IL-7, IL-9, IL-15, and
          IL-21. Disruption of Jak2 in mice results in an
          embryonic lethal phenotype with multiple defects
          including erythropoietic and cardiac abnormalities. It
          is the only Jak gene that results in a lethal phenotype
          when disrupted in mice. A mutation in the pseudokinase
          domain of Jak2, V617F, is present in many
          myeloproliferative diseases, including almost all
          patients with polycythemia vera, and 50% of patients
          with essential thrombocytosis and myelofibrosis. Jak3
          is important in lymphoid development and myeloid cell
          differentiation. Inactivating mutations in Jak3 have
          been reported in humans with severe combined
          immunodeficiency (SCID).
          Length = 258

 Score = 27.5 bits (61), Expect = 0.78
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 20 VLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          ++ + +  H+V  YG  +   +  +  EY+  GSLD  LKK
Sbjct: 52 MMSQLSHKHLVLNYGVCVCGDESIMVQEYVKFGSLDTYLKK 92


>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase 1.  Serine/Threonine Kinases
           (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. ROCK contains an
           N-terminal extension, a catalytic kinase domain, and a
           C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain, and is activated via interaction with Rho
           GTPases. ROCK1 is preferentially expressed in the liver,
           lung, spleen, testes, and kidney. It mediates signaling
           from Rho to the actin cytoskeleton. It is implicated in
           the development of cardiac fibrosis, cardiomyocyte
           apoptosis, and hyperglycemia. Mice deficient with ROCK1
           display eyelids open at birth (EOB) and omphalocele
           phenotypes due to the disorganization of actin filaments
           in the eyelids and the umbilical ring.
          Length = 371

 Score = 27.3 bits (60), Expect = 0.89
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 17  ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
           E  ++   N   +V  + AF  D+ + + MEYM GG L
Sbjct: 93  ERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDL 130


>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine
           Kinases, Fyn and Yrk.  Protein Tyrosine Kinase (PTK)
           family; Fyn and Yrk kinases; catalytic (c) domain. The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Fyn and
           Yrk are members of the Src subfamily of proteins, which
           are cytoplasmic (or non-receptor) tyr kinases. Src
           kinases contain an N-terminal SH4 domain with a
           myristoylation site, followed by SH3 and SH2 domains, a
           tyr kinase domain, and a regulatory C-terminal region
           containing a conserved tyr. They are activated by
           autophosphorylation at the tyr kinase domain, but are
           negatively regulated by phosphorylation at the
           C-terminal tyr by Csk (C-terminal Src Kinase). Src
           proteins are involved in signaling pathways that
           regulate cytokine and growth factor responses,
           cytoskeleton dynamics, cell proliferation, survival, and
           differentiation. Fyn, together with Lck, plays a
           critical role in T-cell signal transduction by
           phosphorylating ITAM (immunoreceptor tyr activation
           motif) sequences on T-cell receptors, ultimately leading
           to the proliferation and differentiation of T-cells. In
           addition, Fyn is involved in the myelination of neurons,
           and is implicated in Alzheimer's and Parkinson's
           diseases. Yrk has been detected only in chickens. It is
           primarily found in neuronal and epithelial cells and in
           macrophages. It may play a role in inflammation and in
           response to injury.
          Length = 260

 Score = 27.3 bits (60), Expect = 0.89
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 11/58 (18%)

Query: 13  QIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILK----KAGKIPE 66
           QI+++L+  H+     +V  Y A +S++ I I  EYM  GSL   LK    +A K+P 
Sbjct: 53  QIMKKLR--HD----KLVQLY-AVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLPN 103


>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           LATS subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. LATS was originally identified in Drosophila
           using a screen for genes whose inactivation led to
           overproliferation of cells. In tetrapods, there are two
           LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in
           mice results in the development of various tumors,
           including sarcomas and ovarian cancer. LATS functions as
           a tumor suppressor and is implicated in cell cycle
           regulation.
          Length = 376

 Score = 27.5 bits (61), Expect = 0.89
 Identities = 14/67 (20%), Positives = 28/67 (41%), Gaps = 4/67 (5%)

Query: 4   LEVKPTIKKQIIRELK----VLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILK 59
           L     + +     +K    +L E +   +V  Y +F    ++   M+Y+ GG +  +L 
Sbjct: 34  LRKADVLMRNQAAHVKAERDILAEADNEWVVKLYYSFQDKDNLYFVMDYIPGGDMMSLLI 93

Query: 60  KAGKIPE 66
           + G   E
Sbjct: 94  RLGIFEE 100


>gnl|CDD|217029 pfam02431, Chalcone, Chalcone-flavanone isomerase.
           Chalcone-flavanone isomerase is a plant enzyme
           responsible for the isomerisation of chalcone to
           naringenin, a key step in the biosynthesis of
           flavonoids.
          Length = 200

 Score = 26.8 bits (60), Expect = 1.1
 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 4/48 (8%)

Query: 32  FYGAFISDQDI----SICMEYMDGGSLDLILKKAGKIPEHILGTITSA 75
           F  AF     +    SI       GSL +   K GKIPE  LG + + 
Sbjct: 121 FREAFKDKGSVPKGSSILFTRSPDGSLTISFSKDGKIPETELGVVENK 168


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Phosphoinositide-dependent
           kinase 1.  Serine/Threonine Kinases (STKs),
           Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PDK1
           carries an N-terminal catalytic domain and a C-terminal
           pleckstrin homology (PH) domain that binds
           phosphoinositides. It phosphorylates the activation loop
           of AGC kinases that are regulated by PI3K such as PKB,
           SGK, and PKC, among others, and is crucial for their
           activation. Thus, it contributes in regulating many
           processes including metabolism, growth, proliferation,
           and survival. PDK1 also has the ability to
           autophosphorylate and is constitutively active in
           mammalian cells. PDK1 is essential for normal embryo
           development and is important in regulating cell volume.
          Length = 280

 Score = 27.2 bits (61), Expect = 1.1
 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 12  KQIIRELKVLHECN-FAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHI 68
           K +  E +VL   N    I+  Y  F  ++++   +EY   G L   ++K G + E  
Sbjct: 46  KYVKIEKEVLTRLNGHPGIIKLYYTFQDEENLYFVLEYAPNGELLQYIRKYGSLDEKC 103


>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase,
           Spleen tyrosine kinase.  Protein Tyrosine Kinase (PTK)
           family; Spleen tyrosine kinase (Syk); catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Syk,
           together with Zap-70, form the Syk subfamily of kinases
           which are cytoplasmic (or nonreceptor) tyr kinases
           containing two Src homology 2 (SH2) domains N-terminal
           to the catalytic tyr kinase domain. Syk was first cloned
           from the spleen, and its function in hematopoietic cells
           is well-established. Syk is involved in the signaling
           downstream of activated receptors (including B-cell and
           Fc receptors) that contain ITAMs (immunoreceptor tyr
           activation motifs), leading to processes such as cell
           proliferation, differentiation, survival, adhesion,
           migration, and phagocytosis. More recently, Syk
           expression has been detected in other cell types
           (including epithelial cells, vascular endothelial cells,
           neurons, hepatocytes, and melanocytes), suggesting a
           variety of biological functions in non-immune cells. Syk
           plays a critical role in maintaining vascular integrity
           and in wound healing during embryogenesis. It also
           regulates Vav3, which is important in osteoclast
           function including bone development. In breast
           epithelial cells, where Syk acts as a negative regulator
           for epidermal growth factor receptor (EGFR) signaling,
           loss of Syk expression is associated with abnormal
           proliferation during cancer development suggesting a
           potential role as a tumor suppressor. In mice, Syk has
           been shown to inhibit malignant transformation of
           mammary epithelial cells induced with murine mammary
           tumor virus (MMTV).
          Length = 257

 Score = 26.8 bits (59), Expect = 1.2
 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 4/70 (5%)

Query: 8   PTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEH 67
           P +K +++RE  V+ + +  +IV   G     +   + ME  + G L+  L+K   + E 
Sbjct: 37  PALKDELLREANVMQQLDNPYIVRMIG-ICEAESWMLVMELAELGPLNKFLQKNKHVTEK 95

Query: 68  ILGTITSATH 77
               IT   H
Sbjct: 96  ---NITELVH 102


>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Rho-associated
           coiled-coil containing protein kinase (ROCK) and Nuclear
           Dbf2-Related (NDR)-like kinase subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK- and NDR-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include ROCK and
           ROCK-like proteins such as DMPK, MRCK, and CRIK, as well
           as NDR and NDR-like proteins such as LATS, CBK1 and
           Sid2p. ROCK and CRIK are effectors of the small GTPase
           Rho, while MRCK is an effector of the small GTPase
           Cdc42. NDR and NDR-like kinases contain an N-terminal
           regulatory (NTR) domain and an insert within the
           catalytic domain that contains an auto-inhibitory
           sequence. Proteins in this subfamily are involved in
           regulating many cellular functions including
           contraction, motility, division, proliferation,
           apoptosis, morphogenesis, and cytokinesis.
          Length = 350

 Score = 26.9 bits (60), Expect = 1.3
 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 9/67 (13%)

Query: 11  KKQIIRELKVLH---------ECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKA 61
           K  +I+  ++ H         + +   IV  Y +F  ++ + + MEYM GG L  +L + 
Sbjct: 36  KSDMIKRNQIAHVRAERDILADADSPWIVKLYYSFQDEEHLYLVMEYMPGGDLMNLLIRK 95

Query: 62  GKIPEHI 68
              PE  
Sbjct: 96  DVFPEET 102


>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase,
           Interleukin-2-inducible T-cell Kinase.  Protein Tyrosine
           Kinase (PTK) family; Interleukin-2 (IL-2)-inducible
           T-cell kinase (Itk); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Itk (also
           known as Tsk or Emt) is a member of the Tec subfamily of
           proteins, which are cytoplasmic (or nonreceptor) tyr
           kinases with similarity to Src kinases in that they
           contain Src homology protein interaction domains (SH3,
           SH2) N-terminal to the catalytic tyr kinase domain.
           Unlike Src kinases, most Tec subfamily members (except
           Rlk) also contain an N-terminal pleckstrin homology (PH)
           domain, which binds the products of PI3K and allows
           membrane recruitment and activation. In addition, Itk
           contains the Tec homology (TH) domain containing one
           proline-rich region and a zinc-binding region. Tec
           kinases are expressed mainly by haematopoietic cells.
           Itk is expressed in T-cells and mast cells, and is
           important in their development and differentiation. Of
           the three Tec kinases expressed in T-cells, Itk plays
           the predominant role in T-cell receptor (TCR) signaling.
           It is activated by phosphorylation upon TCR crosslinking
           and is involved in the pathway resulting in
           phospholipase C-gamma1 activation and actin
           polymerization. It also plays a role in the downstream
           signaling of the T-cell costimulatory receptor CD28, the
           T-cell surface receptor CD2, and the chemokine receptor
           CXCR4. In addition, Itk is crucial for the development
           of T-helper(Th)2 effector responses.
          Length = 256

 Score = 26.8 bits (59), Expect = 1.3
 Identities = 15/60 (25%), Positives = 28/60 (46%), Gaps = 1/60 (1%)

Query: 11  KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL-DLILKKAGKIPEHIL 69
           ++  I E +V+ + +   +V  YG       I +  E+M+ G L D +  + GK  +  L
Sbjct: 43  EEDFIEEAQVMMKLSHPKLVQLYGVCTERSPICLVFEFMEHGCLSDYLRAQRGKFSQETL 102


>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 1.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 1 (TAO1) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO1 is sometimes referred to as prostate-derived
           sterile 20-like kinase 2 (PSK2). TAO1 activates the p38
           MAPK through direct interaction with and activation of
           MEK3. TAO1 is highly expressed in the brain and may play
           a role in neuronal apoptosis. TAO1 interacts with the
           checkpoint proteins BubR1 and Mad2, and plays an
           important role in regulating mitotic progression, which
           is required for both chromosome congression and
           checkpoint-induced anaphase delay. TAO1 may play a role
           in protecting genomic stability.
          Length = 317

 Score = 27.0 bits (59), Expect = 1.3
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 3/74 (4%)

Query: 12  KQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEHILGT 71
           + II+E+K L      + + + G ++ +    + MEY  G + DL+  +  K P   +  
Sbjct: 70  QDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLL--EVHKKPLQEV-E 126

Query: 72  ITSATHSSLIVIYY 85
           I + TH +L  + Y
Sbjct: 127 IAAITHGALQGLAY 140


>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase 2.  Serine/Threonine Kinases
           (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. ROCK contains an
           N-terminal extension, a catalytic kinase domain, and a
           C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain, and is activated via interaction with Rho
           GTPases. ROCK2 was the first identified target of
           activated RhoA, and was found to play a role in stress
           fiber and focal adhesion formation. It is prominently
           expressed in the brain, heart, and skeletal muscles. It
           is implicated in vascular and neurological disorders,
           such as hypertension and vasospasm of the coronary and
           cerebral arteries. ROCK2 is also activated by caspase-2
           cleavage, resulting in thrombin-induced microparticle
           generation in response to cell activation. Mice
           deficient in ROCK2 show intrauterine growth retardation
           and embryonic lethality because of placental
           dysfunction.
          Length = 370

 Score = 26.9 bits (59), Expect = 1.3
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 17  ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
           E  ++   N   +V  + AF  D+ + + MEYM GG L
Sbjct: 93  ERDIMAFANSPWVVQLFCAFQDDKYLYMVMEYMPGGDL 130


>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine
           Kinases, Fungal Mitogen-Activated Protein Kinases Sty1
           and Hog1.  Serine/Threonine Kinases (STKs), Fungal
           Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Sty1/Hog1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of the MAPKs Sty1
           from Schizosaccharomyces pombe, Hog1 from Saccharomyces
           cerevisiae, and similar proteins. MAPKs are important
           mediators of cellular responses to extracellular
           signals. Sty1 and Hog1 are stress-activated MAPKs that
           partipate in transcriptional regulation in response to
           stress. Sty1 is activated in response to oxidative
           stress, osmotic stress, and UV radiation. Sty1 is
           regulated by the MAP2K Wis1, which is activated by the
           MAP3Ks Wis4 and Win1, which receive signals of the
           stress condition from membrane-spanning histidine
           kinases Mak1-3. Activated Sty1 stabilizes the Atf1
           transcription factor and induces transcription of
           Atf1-dependent genes of the core environmetal stress
           response (CESR). Hog1 is the key element in the high
           osmolarity glycerol (HOG) pathway and is activated upon
           hyperosmotic stress. Activated Hog1 accumulates in the
           nucleus and regulates stress-induced transcription. The
           HOG pathway is mediated by two transmembrane
           osmosensors, Sln1 and Sho1.
          Length = 328

 Score = 26.7 bits (59), Expect = 1.4
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 8   PTIKKQIIRELKVLHECNFAHIVGFYGAFISD-QDISICMEYMDGGSLDLILK 59
           P + K+  RELK+L      +I+     FIS  +DI    E + G  L  +L 
Sbjct: 50  PVLAKRTYRELKLLKHLRHENIISLSDIFISPLEDIYFVTELL-GTDLHRLLT 101


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase (MAPK) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The MAPK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation. Typical MAPK pathways involve a triple
          kinase core cascade comprising of the MAPK, which is
          phosphorylated and activated by a MAPK kinase (MAP2K or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAP3K or MKKK). Each cascade is
          activated either by a small GTP-binding protein or by
          an adaptor protein, which transmits the signal either
          directly to a MAP3K to start the triple kinase core
          cascade or indirectly through a mediator kinase, a
          MAP4K. There are three main typical MAPK subfamilies:
          Extracellular signal-Regulated Kinase (ERK), c-Jun
          N-terminal Kinase (JNK), and p38. Some MAPKs are
          atypical in that they are not regulated by MAP2Ks.
          These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 26.7 bits (60), Expect = 1.5
 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 9/46 (19%)

Query: 12 KQIIRELKVLHECNFAH--IVGFYGAFISDQ-----DISICMEYMD 50
          K+I+RE+K+L   +  H  I+G              D+ I  E M+
Sbjct: 44 KRILREIKLL--RHLRHENIIGLLDILRPPSPEDFNDVYIVTELME 87


>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Serum- and
          Glucocorticoid-induced Kinase 3.  Serine/Threonine
          Kinases (STKs), Serum- and Glucocorticoid-induced
          Kinase (SGK) subfamily, SGK3 isoform, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The SGK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. There are three isoforms of
          SGK, named SGK1, SGK2, and SGK3 (also called
          cytokine-independent survival kinase CISK). SGK3 is
          expressed in most tissues and is most abundant in the
          embryo and adult heart and spleen. It was originally
          discovered in a screen for antiapoptotic genes. It
          phosphorylates and inhibits the proapoptotic proteins,
          Bad and FKHRL1. SGK3 also regulates many transporters,
          ion channels, and receptors. It plays a critical role
          in hair follicle morphogenesis and hair cycling.
          Length = 325

 Score = 26.9 bits (59), Expect = 1.5
 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 11 KKQIIRELKVLHECNFAH--IVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
          +K I+ E  VL + N  H  +VG + +F + + +   +++++GG L   L++    PE
Sbjct: 39 QKHIMAERNVLLK-NVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPE 95


>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine
          Kinase, PCTAIRE-2 kinase.  Serine/Threonine Kinases
          (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The PCTAIRE-2 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares
          sequence similarity with Cyclin-Dependent Kinases
          (CDKs), which belong to a large family of STKs that are
          regulated by their cognate cyclins. Together, CDKs and
          cyclins are involved in the control of cell-cycle
          progression, transcription, and neuronal function.
          PCTAIRE-2 is specifically expressed in neurons in the
          central nervous system, mainly in terminally
          differentiated neurons. It associates with Trap (Tudor
          repeat associator with PCTAIRE-2) and could play a role
          in regulating mitochondrial function in neurons.
          Length = 309

 Score = 26.5 bits (58), Expect = 1.8
 Identities = 11/36 (30%), Positives = 22/36 (61%)

Query: 15 IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMD 50
          IRE+ +L +   A+IV  +    +D+ +++  EY+D
Sbjct: 52 IREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLD 87


>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. 
           Serine/Threonine Kinases (STKs), NDR kinase subfamily,
           NDR2 isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The NDR
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. Higher eukaryotes
           contain two NDR isoforms, NDR1 and NDR2. Both isoforms
           play a role in proper centrosome duplication. In
           addition, NDR2 plays a role in regulating neuronal
           growth and differentiation, as well as in facilitating
           neurite outgrowth. It is also implicated in fear
           conditioning as it contributes to the coupling of
           neuronal morphological changes with fear-memory
           consolidation. NDR2 is also referred to as STK38-like.
          Length = 360

 Score = 26.5 bits (58), Expect = 1.8
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 11  KKQI--IR-ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
           K+Q+  IR E  +L E + A +V  + +F   +++ + ME++ GG +  +L K   + E
Sbjct: 42  KEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLSE 100


>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 1-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 1 (CDK1)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK1 from
          higher eukaryotes, plants, and yeasts, as well as CDK2
          and CDK3. CDK1 is also called Cell division control
          protein 2 (Cdc2) or p34 protein kinase, and is
          regulated by cyclins A, B, and E. The CDK1/cyclin A
          complex controls G2 phase entry and progression while
          the CDK1/cyclin B complex is critical for G2 to M phase
          transition. CDK2 is regulated by cyclin E or cyclin A.
          Upon activation by cyclin E, it phosphorylates the
          retinoblastoma (pRb) protein which activates E2F
          mediated transcription and allows cells to move into S
          phase. The CDK2/cyclin A complex plays a role in
          regulating DNA replication. Studies in knockout mice
          revealed that CDK1 can compensate for the loss of the
          cdk2 gene as it can also bind cyclin E and drive G1 to
          S phase transition. CDK3 is regulated by cyclin C and
          it phosphorylates pRB specifically during the G0/G1
          transition. This phosphorylation is required for cells
          to exit G0 efficiently and enter the G1 phase.
          Length = 283

 Score = 26.1 bits (58), Expect = 2.3
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 15 IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          IRE+ +L E N  +IV       S+  + +  E+     LDL LKK
Sbjct: 46 IREISLLKELNHPNIVRLLDVVHSENKLYLVFEF-----LDLDLKK 86


>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine
           Kinase, Insulin-like Growth Factor-1 Receptor.  Protein
           Tyrosine Kinase (PTK) family; Insulin-like Growth
           Factor-1 Receptor (IGF-1R); catalytic (c) domain. The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. IGF-1R is
           a receptor tyr kinases (RTK) that is composed of two
           alphabeta heterodimers. Binding of the ligand (IGF-1 or
           IGF-2) to the extracellular alpha subunit activates the
           intracellular tyr kinase domain of the transmembrane
           beta subunit. Receptor activation leads to
           autophosphorylation, which stimulates downstream kinase
           activities and biological function. IGF-1R signaling is
           important in the differentiation, growth, and survival
           of normal cells. In cancer cells, where it is frequently
           overexpressed, IGF-1R is implicated in proliferation,
           the suppression of apoptosis, invasion, and metastasis.
           IGF-1R is being developed as a therapeutic target in
           cancer treatment.
          Length = 277

 Score = 26.1 bits (57), Expect = 2.6
 Identities = 14/47 (29%), Positives = 20/47 (42%)

Query: 13  QIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILK 59
           + + E  V+ E N  H+V   G     Q   + ME M  G L   L+
Sbjct: 55  EFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLR 101


>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein
          Serine/Threonine Kinase, Protein Kinase N.
          Serine/Threonine Kinases (STKs), Protein Kinase N (PKN)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          PKN subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. PKN has a C-terminal
          catalytic domain that is highly homologous to PKCs. Its
          unique N-terminal regulatory region contains
          antiparallel coiled-coil (ACC) domains. In mammals,
          there are three PKN isoforms from different genes
          (designated PKN-alpha, beta, and gamma), which show
          different enzymatic properties, tissue distribution,
          and varied functions. PKN can be activated by the small
          GTPase Rho, and by fatty acids such as arachidonic and
          linoleic acids. It is involved in many biological
          processes including cytokeletal regulation, cell
          adhesion, vesicle transport, glucose transport,
          regulation of meiotic maturation and embryonic cell
          cycles, signaling to the nucleus, and tumorigenesis.
          Length = 324

 Score = 25.8 bits (57), Expect = 2.7
 Identities = 8/26 (30%), Positives = 13/26 (50%)

Query: 29 IVGFYGAFISDQDISICMEYMDGGSL 54
          +V  +  F ++  +   MEY  GG L
Sbjct: 64 LVNLFACFQTEDHVCFVMEYAAGGDL 89


>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 10.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 10
          (Nek10) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek10 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. No function has yet been
          ascribed to Nek10. The gene encoding Nek10 is a
          putative causative gene for breast cancer; it is
          located within a breast cancer susceptibility loci on
          chromosome 3p24.
          Length = 269

 Score = 25.9 bits (57), Expect = 2.9
 Identities = 11/42 (26%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 14 IIRELKVLHE-CNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
          I+ E+ ++ E     +IV +Y  F+ +  + I M+ ++G  L
Sbjct: 55 IVSEVTIIKEQLRHPNIVRYYKTFLENDRLYIVMDLIEGAPL 96


>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein
          Serine/Threonine Kinase, Atypical Protein Kinase C.
          Serine/Threonine Kinases (STKs), Atypical Protein
          Kinase C (aPKC) subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The aPKC subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PKCs are
          classified into three groups (classical, atypical, and
          novel) depending on their mode of activation and the
          structural characteristics of their regulatory domain.
          aPKCs only require phosphatidylserine (PS) for
          activation. They contain a C2-like region, instead of a
          calcium-binding (C2) region found in classical PKCs, in
          their regulatory domain. There are two aPKC isoforms,
          zeta and iota. aPKCs are involved in many cellular
          functions including proliferation, migration,
          apoptosis, polarity maintenance and cytoskeletal
          regulation. They also play a critical role in the
          regulation of glucose metabolism and in the
          pathogenesis of type 2 diabetes.
          Length = 329

 Score = 25.6 bits (56), Expect = 3.5
 Identities = 11/42 (26%), Positives = 23/42 (54%)

Query: 25 NFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPE 66
          N   +VG +  F ++  +   +E++ GG L   +++  K+PE
Sbjct: 54 NHPFLVGLHSCFQTESRLFFVIEFVSGGDLMFHMQRQRKLPE 95


>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine
          Kinase, Fungal Cyclin-Dependent protein Kinase Pho85.
          Serine/Threonine Kinases (STKs), Pho85 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The Pho85 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Pho85 is a multifunctional
          Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs
          belong to a large family of STKs that are regulated by
          their cognate cyclins. Together, they are involved in
          the control of cell-cycle progression, transcription,
          and neuronal function. Pho85 is regulated by 10
          different cyclins (Pcls) and plays a role in G1
          progression, cell polarity, phosphate and glycogen
          metabolism, gene expression, and in signaling changes
          in the environment. It is not essential for yeast
          viability and is the functional homolog of mammalian
          CDK5, which plays a role in central nervous system
          development.
          Length = 284

 Score = 25.5 bits (56), Expect = 3.5
 Identities = 13/50 (26%), Positives = 24/50 (48%)

Query: 2  IHLEVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDG 51
          IHL+ +       IRE+ ++ E    +IV  +    ++  + +  EYMD 
Sbjct: 33 IHLDAEEGTPSTAIREISLMKELKHENIVRLHDVIHTENKLMLVFEYMDK 82


>gnl|CDD|183082 PRK11302, PRK11302, DNA-binding transcriptional regulator HexR;
          Provisional.
          Length = 284

 Score = 25.3 bits (56), Expect = 4.1
 Identities = 10/29 (34%), Positives = 16/29 (55%)

Query: 52 GSLDLILKKAGKIPEHILGTITSATHSSL 80
            L+ + K   K+ E IL +  +A HSS+
Sbjct: 9  SRLEHLSKSERKVAEVILASPQTAIHSSI 37


>gnl|CDD|236705 PRK10517, PRK10517, magnesium-transporting ATPase MgtA;
           Provisional.
          Length = 902

 Score = 25.4 bits (56), Expect = 4.3
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 20/63 (31%)

Query: 8   PTIKKQIIRELKVLHECNFAHIVGFYGAFISD------QDISICMEYMDGG------SLD 55
           P  K++I+  LK        H+VGF G  I+D       DI I    +DG       + D
Sbjct: 623 PMHKERIVTLLK-----REGHVVGFMGDGINDAPALRAADIGIS---VDGAVDIAREAAD 674

Query: 56  LIL 58
           +IL
Sbjct: 675 IIL 677


>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase.  Serine/Threonine Kinases
           (STKs), Rho-associated coiled-coil containing protein
           kinase (ROCK) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The ROCK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. ROCK is also referred to as Rho-associated
           kinase or simply as Rho kinase. It contains an
           N-terminal extension, a catalytic kinase domain, and a
           long C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain. It is activated via interaction with Rho GTPases
           and is involved in many cellular functions including
           contraction, adhesion, migration, motility,
           proliferation, and apoptosis. The ROCK subfamily
           consists of two isoforms, ROCK1 and ROCK2, which may be
           functionally redundant in some systems, but exhibit
           different tissue distributions. Both isoforms are
           ubiquitously expressed in most tissues, but ROCK2 is
           more prominent in brain and skeletal muscle while ROCK1
           is more pronounced in the liver, testes, and kidney.
           Studies in knockout mice result in different phenotypes,
           suggesting that the two isoforms do not compensate for
           each other during embryonic development.
          Length = 370

 Score = 25.5 bits (56), Expect = 4.4
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 29  IVGFYGAFISDQDISICMEYMDGGSL 54
           IV  + AF  D+ + + MEYM GG L
Sbjct: 105 IVQLHYAFQDDKYLYMVMEYMPGGDL 130


>gnl|CDD|235478 PRK05457, PRK05457, heat shock protein HtpX; Provisional.
          Length = 284

 Score = 25.1 bits (56), Expect = 4.9
 Identities = 8/13 (61%), Positives = 10/13 (76%)

Query: 26 FAHIVGFYGAFIS 38
          FA + GF G+FIS
Sbjct: 39 FAAVFGFGGSFIS 51


>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase Like 5.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 5 (CDKL5) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. Mutations in the gene encoding CDKL5,
           previously called STK9, are associated with early onset
           epilepsy and severe mental retardation [X-linked
           infantile spasm syndrome (ISSX) or West syndrome]. In
           addition, CDKL5 mutations also sometimes cause a
           phenotype similar to Rett syndrome (RTT), a progressive
           neurodevelopmental disorder. These pathogenic mutations
           are located in the N-terminal portion of the protein
           within the kinase domain.
          Length = 287

 Score = 25.3 bits (55), Expect = 5.3
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 10  IKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILK-KAGKIPEHI 68
           +K+  +RELK+L      +IV    AF     + +  EY++   L+L+ +   G  PE +
Sbjct: 43  VKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKV 102


>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine
          Kinase, Ephrin Receptor A2.  Protein Tyrosine Kinase
          (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2
          receptor; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). In general, class EphA receptors bind
          GPI-anchored ephrin-A ligands. There are ten vertebrate
          EphA receptors (EphA1-10), which display promiscuous
          interactions with six ephrin-A ligands. EphRs contain
          an ephrin binding domain and two fibronectin repeats
          extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling).
          Ephrin/EphR interaction mainly results in cell-cell
          repulsion or adhesion, making it important in neural
          development and plasticity, cell morphogenesis,
          cell-fate determination, embryonic development, tissue
          patterning, and angiogenesis. The EphA2 receptor is
          overexpressed in tumor cells and tumor blood vessels in
          a variety of cancers including breast, prostate, lung,
          and colon. As a result, it is an attractive target for
          drug design since its inhibition could affect several
          aspects of tumor progression.
          Length = 268

 Score = 24.9 bits (54), Expect = 5.7
 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 2/36 (5%)

Query: 26 FAH--IVGFYGAFISDQDISICMEYMDGGSLDLILK 59
          F+H  I+   G     +   I  EYM+ G+LD  L+
Sbjct: 63 FSHHNIIRLEGVVTKFKPAMIITEYMENGALDKYLR 98


>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related
          kinase-like Protein Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related
          (NDR) kinase subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The NDR subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. NDR kinase
          contains an N-terminal regulatory (NTR) domain and an
          insert within the catalytic domain that contains an
          auto-inhibitory sequence. Like many other AGC kinases,
          NDR kinase requires phosphorylation at two sites, the
          activation loop (A-loop) and the hydrophobic motif
          (HM), for activity. NDR kinases regulate mitosis, cell
          growth, embryonic development, and neurological
          processes. They are also required for proper centrosome
          duplication. Higher eukaryotes contain two NDR
          isoforms, NDR1 and NDR2. This subfamily also contains
          fungal NDR-like kinases.
          Length = 364

 Score = 25.0 bits (55), Expect = 6.0
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 17 ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL-DLILKK 60
          E  +L E +   +V  Y +F  +  + + MEY+ GG +  L++KK
Sbjct: 51 ERDILAEADNPWVVKLYYSFQDENYLYLIMEYLPGGDMMTLLMKK 95


>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase Like 1 and 4.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 1 (CDKL1) and CDKL4 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL1 and CDKL4
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKL1, also called
           p42 KKIALRE, is a glial protein that is upregulated in
           gliosis. It is present in neuroblastoma and A431 human
           carcinoma cells, and may be implicated in neoplastic
           transformation. The function of CDKL4 is unknown.
          Length = 286

 Score = 25.0 bits (55), Expect = 6.0
 Identities = 19/69 (27%), Positives = 34/69 (49%)

Query: 5   EVKPTIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKI 64
           E  P IKK  +RE+++L +    ++V     F   + + +  EY D   L+ + K    +
Sbjct: 38  EDDPVIKKIALREIRMLKQLKHPNLVNLIEVFRRKRKLHLVFEYCDHTVLNELEKNPRGV 97

Query: 65  PEHILGTIT 73
           PEH++  I 
Sbjct: 98  PEHLIKKII 106


>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src
          kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
          Kinase (PTK) family; C-terminal Src kinase (Csk)
          subfamily; catalytic (c) domain. The Csk subfamily is
          composed of Csk, Chk, and similar proteins. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Csk
          subfamily kinases are cytoplasmic (or nonreceptor) tyr
          kinases containing the Src homology domains, SH3 and
          SH2, N-terminal to the catalytic tyr kinase domain.
          They negatively regulate the activity of Src kinases
          that are anchored to the plasma membrane. To inhibit
          Src kinases, Csk and Chk are translocated to the
          membrane via binding to specific transmembrane
          proteins, G-proteins, or adaptor proteins near the
          membrane. Csk catalyzes the tyr phosphorylation of the
          regulatory C-terminal tail of Src kinases, resulting in
          their inactivation. Chk inhibit Src kinases using a
          noncatalytic mechanism by simply binding to them. As
          negative regulators of Src kinases, Csk and Chk play
          important roles in cell proliferation, survival, and
          differentiation, and consequently, in cancer
          development and progression.
          Length = 256

 Score = 25.1 bits (55), Expect = 6.1
 Identities = 12/46 (26%), Positives = 19/46 (41%)

Query: 9  TIKKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
          T  +  + E  V+      ++V   G  +    + I  EYM  GSL
Sbjct: 42 TAAQAFLAEASVMTTLRHPNLVQLLGVVLQGNPLYIVTEYMAKGSL 87


>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular
           signal-Regulated Kinase 1 and 2-like Serine/Threonine
           Kinases.  Serine/Threonine Kinases (STKs), Extracellular
           signal-regulated kinases 1 and 2 (ERK1/2) and Fus3
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. This
           ERK1/2-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           the mitogen-activated protein kinases (MAPKs) ERK1,
           ERK2, baker's yeast Fus3, and similar proteins. MAPK
           pathways are important mediators of cellular responses
           to extracellular signals. ERK1/2 activation is
           preferentially by mitogenic factors, differentiation
           stimuli, and cytokines, through a kinase cascade
           involving the MAPK kinases MEK1/2 and a MAPK kinase
           kinase from the Raf family. ERK1/2 have numerous
           substrates, many of which are nuclear and participate in
           transcriptional regulation of many cellular processes.
           They regulate cell growth, cell proliferation, and cell
           cycle progression from G1 to S phase. Although the
           distinct roles of ERK1 and ERK2 have not been fully
           determined, it is known that ERK2 can maintain most
           functions in the absence of ERK1, and that the deletion
           of ERK2 is embryonically lethal. The MAPK, Fus3,
           regulates yeast mating processes including
           mating-specific gene expression, G1 arrest, mating
           projection, and cell fusion.
          Length = 336

 Score = 24.9 bits (55), Expect = 6.2
 Identities = 8/16 (50%), Positives = 10/16 (62%)

Query: 13  QIIRELKVLHECNFAH 28
           QI+R LK +H  N  H
Sbjct: 114 QILRGLKYIHSANVLH 129


>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear
          Dbf2-Related kinase-like Protein Serine/Threonine
          Kinases.  Serine/Threonine Kinases (STKs), NDR kinase
          subfamily, fungal NDR-like proteins, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The NDR subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This group is composed of
          fungal NDR-like proteins including Saccharomyces
          cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe
          Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and
          Neurospora crassa Cot1. Like NDR kinase, group members
          contain an N-terminal regulatory (NTR) domain and an
          insert within the catalytic domain that contains an
          auto-inhibitory sequence. CBK1 is an essential
          component in the RAM (regulation of Ace2p activity and
          cellular morphogenesis) network. CBK1 and Orb6 play
          similar roles in coordinating cell morphology with cell
          cycle progression. Ukc1 is involved in morphogenesis,
          pathogenicity, and pigment formation. Cot1 plays a role
          in polar tip extension.
          Length = 377

 Score = 24.8 bits (54), Expect = 6.6
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 17 ELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKK 60
          E  VL E +   +V  Y +F   Q + + ME++ GG L  +L K
Sbjct: 51 ERDVLAESDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIK 94


>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein
          Serine/Threonine Kinase, G protein-coupled Receptor
          Kinase 7.  Serine/Threonine Kinases (STKs), G
          protein-coupled Receptor Kinase (GRK) subfamily, GRK7
          isoform, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          GRK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. GRKs phosphorylate and
          regulate G protein-coupled receptors (GPCRs), the
          largest superfamily of cell surface receptors, which
          regulate some part of nearly all physiological
          functions. Phosphorylated GPCRs bind to arrestins,
          which prevents further G protein signaling despite the
          presence of activating ligand. There are seven types of
          GRKs, named GRK1 to GRK7. GRK7, also called iodopsin
          kinase, belongs to the visual group of GRKs. It is
          primarily found in the retina and plays a role in the
          regulation of opsin light receptors. GRK7 is located in
          retinal cone outer segments and plays an important role
          in regulating photoresponse of the cones.
          Length = 277

 Score = 24.5 bits (53), Expect = 7.7
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 11 KKQIIRELKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSL 54
          +K  + E ++L + N   IV    AF S   + + M  M+GG L
Sbjct: 37 EKMALLEKEILEKVNSPFIVNLAYAFESKTHLCLVMSLMNGGDL 80


>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen and stress-activated
           kinase.  Serine/Threonine Kinases (STKs), Mitogen and
           stress-activated kinase (MSK) subfamily, N-terminal
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MSK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MSKs contain an
           N-terminal kinase domain (NTD) from the AGC family and a
           C-terminal kinase domain (CTD) from the CAMK family,
           similar to 90 kDa ribosomal protein S6 kinases (RSKs).
           MSKs are activated by two major signaling cascades, the
           Ras-MAPK and p38 stress kinase pathways, in response to
           various stimuli such as growth factors, hormones,
           neurotransmitters, cellular stress, and pro-inflammatory
           cytokines. This triggers phosphorylation in the
           activation loop (A-loop) of the CTD of MSK. The active
           CTD phosphorylates the hydrophobic motif (HM) in the
           C-terminal extension of NTD, which facilitates the
           phosphorylation of the A-loop and activates the NTD,
           which in turn phosphorylates downstream targets. MSKs
           are predominantly nuclear proteins. They are widely
           expressed in many tissues including heart, brain, lung,
           liver, kidney, and pancreas. There are two isoforms of
           MSK, called MSK1 and MSK2.
          Length = 288

 Score = 24.8 bits (54), Expect = 8.3
 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 18  LKVLHECNFAHIVGFYGAFISDQDISICMEYMDGGSLDLILKKAGKIPEH 67
           L+ +  C F  +V  + AF +D  + + ++Y++GG L   L +     E 
Sbjct: 58  LEAVRRCPF--LVTLHYAFQTDTKLHLILDYVNGGELFTHLYQREHFTES 105


>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine
          Kinase, PCTAIRE-1 kinase.  Serine/Threonine Kinases
          (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The PCTAIRE-1 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares
          sequence similarity with Cyclin-Dependent Kinases
          (CDKs), which belong to a large family of STKs that are
          regulated by their cognate cyclins. Together, CDKs and
          cyclins are involved in the control of cell-cycle
          progression, transcription, and neuronal function.
          PCTAIRE-1 is expressed ubiquitously and is localized in
          the cytoplasm. Its kinase activity is cell cycle
          dependent and peaks at the S and G2 phases. PCTAIRE-1
          is highly expressed in the brain and may play a role in
          regulating neurite outgrowth. It can also associate
          with Trap (Tudor repeat associator with PCTAIRE-2), a
          physiological partner of PCTAIRE-2; with p11, a small
          dimeric protein with similarity to S100; and with
          14-3-3 proteins, mediators of phosphorylation-dependent
          interactions in many different proteins.
          Length = 301

 Score = 24.6 bits (53), Expect = 8.9
 Identities = 10/36 (27%), Positives = 22/36 (61%)

Query: 15 IRELKVLHECNFAHIVGFYGAFISDQDISICMEYMD 50
          IRE+ +L +   A+IV  +    +++ +++  EY+D
Sbjct: 52 IREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLD 87


>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein
           Tyrosine Kinases.  Protein Tyrosine Kinase (PTK) family;
           Src kinase subfamily; catalytic (c) domain. Src
           subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr,
           Fyn, Yrk, and Yes. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           Src (or c-Src) proteins are cytoplasmic (or
           non-receptor) tyr kinases which are anchored to the
           plasma membrane. They contain an N-terminal SH4 domain
           with a myristoylation site, followed by SH3 and SH2
           domains, a tyr kinase domain, and a regulatory
           C-terminal region containing a conserved tyr. They are
           activated by autophosphorylation at the tyr kinase
           domain, but are negatively regulated by phosphorylation
           at the C-terminal tyr by Csk (C-terminal Src Kinase).
           Src proteins are involved in signaling pathways that
           regulate cytokine and growth factor responses,
           cytoskeleton dynamics, cell proliferation, survival, and
           differentiation. They were identified as the first
           proto-oncogene products, and they regulate cell
           adhesion, invasion, and motility in cancer cells and
           tumor vasculature, contributing to cancer progression
           and metastasis. Src kinases are overexpressed in a
           variety of human cancers, making them attractive targets
           for therapy. They are also implicated in acute
           inflammatory responses and osteoclast function. Src,
           Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
           Hck, Fgr, and Lyn show a limited expression pattern.
          Length = 261

 Score = 24.6 bits (54), Expect = 9.0
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 15  IRELKVLHECNFAHIVGFYGAFISDQD-ISICMEYMDGGSLDLILK----KAGKIPEHI 68
           ++E +++ +     +V  Y A  S+++ I I  EYM  GSL   LK    K  ++P+ +
Sbjct: 49  LQEAQIMKKLRHDKLVQLY-AVCSEEEPIYIVTEYMSKGSLLDFLKSGEGKKLRLPQLV 106


>gnl|CDD|237732 PRK14498, PRK14498, putative molybdopterin biosynthesis protein
           MoeA/LysR substrate binding-domain-containing protein;
           Provisional.
          Length = 633

 Score = 24.4 bits (54), Expect = 9.4
 Identities = 10/27 (37%), Positives = 12/27 (44%), Gaps = 1/27 (3%)

Query: 54  LDLILKKAGKIPEHILG-TITSATHSS 79
           LD  LK+    PE I G      TH +
Sbjct: 539 LDYHLKELAIDPERINGYDREEKTHMA 565


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.325    0.143    0.419 

Gapped
Lambda     K      H
   0.267   0.0807    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,484,969
Number of extensions: 367375
Number of successful extensions: 635
Number of sequences better than 10.0: 1
Number of HSP's gapped: 624
Number of HSP's successfully gapped: 180
Length of query: 87
Length of database: 10,937,602
Length adjustment: 55
Effective length of query: 32
Effective length of database: 8,498,132
Effective search space: 271940224
Effective search space used: 271940224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (24.0 bits)