Diaphorina citri psyllid: psy14752


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MKISKKKIGMDEEGLFRVTGGASKVKRLKTCLDAHCIKFEDALEYDAHVLAGVLKLYLRELPEPLLTYEGEPFHLLTCTELTNTK
ccHHHHHccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccc
MKISKKKIGMDEEGLFRVTGGASKVKRLKTCLDAHCIKFEDALEYDAHVLAGVLKLYLRELPEPLLTYEGEPFHLLTCTE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKISKKKIGMDEEGLFRVTGGASKVKRLKTCLDAHCIKFEDALEYDAHVLAGVLKLYLRELPEPLLTYEGEPFHLLTCTELTNTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rho GTPase-activating protein 44 GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Acts as a GTPase activitor in vitro for CDC42 and RAC1.confidentQ5SSM3
Rho GTPase-activating protein 92B GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.confidentQ9VDS5
Rho GTPase-activating protein 44 GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Acts as a GTPase activitor in vitro for CDC42 and RAC1.confidentQ17R89

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030675 [MF]Rac GTPase activator activityprobableGO:0005099, GO:0005083, GO:0005096, GO:0030695, GO:0003674, GO:0008047, GO:0005100, GO:0060589, GO:0030234
GO:0032855 [BP]positive regulation of Rac GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0046578, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032319, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0032320, GO:0032321, GO:0031329, GO:0006140
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043089 [BP]positive regulation of Cdc42 GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0046578, GO:0043088, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032319, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0032489, GO:0009118, GO:0051336, GO:1900542, GO:0032320, GO:0032321, GO:0031329, GO:0006140
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006796 [BP]phosphate-containing compound metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237, GO:0006793
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0017156 [BP]calcium ion-dependent exocytosisprobableGO:0046903, GO:0006810, GO:0016192, GO:0006887, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0071704 [BP]organic substance metabolic processprobableGO:0008150, GO:0008152
GO:0030427 [CC]site of polarized growthprobableGO:0005575, GO:0044464, GO:0005623
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007015 [BP]actin filament organizationprobableGO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F7C, chain A
Confidence level:very confident
Coverage over the Query: 4-79
View the alignment between query and template
View the model in PyMOL