Diaphorina citri psyllid: psy14756

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MVIYCHNLVGRCQKTLDPFADAFKGSEDDVQDGLVHIRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKTGLAKPEQLKVHGF
cEEEEEcccccccccccccccccccccccccccEEEEEEEEECccEEEEEECcccccccHHHHHHHHHcccccccEEEEccccccEEEECccHHHHHHHHHHHccccccccEEEccc
*VIYCHNLVGRCQKTLDPFADAFKGSEDDVQDGLVHIRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKTGLAKPEQLKVHGF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIYCHNLVGRCQKTLDPFADAFKGSEDDVQDGLVHIRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKTGLAKPEQLKVHGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein translation factor SUI1 homolog Probably involved in translation.very confidentP42678
Protein translation factor SUI1 homolog Probably involved in translation.very confidentQ9VZS3
Eukaryotic translation initiation factor 1 Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.very confidentP41567

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IF1, chain A
Confidence level:very confident
Coverage over the Query: 8-117
View the alignment between query and template
View the model in PyMOL