Query         psy14771
Match_columns 64
No_of_seqs    102 out of 104
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 20:12:27 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14771.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14771hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3886|consensus               99.8 2.3E-22 4.9E-27  150.1  -1.8   58    1-58    195-252 (295)
  2 PF04670 Gtr1_RagA:  Gtr1/RagA   99.3 1.2E-12 2.5E-17   93.3   2.7   38    1-38    193-232 (232)
  3 PTZ00167 RNA polymerase subuni  39.6     9.5 0.00021   26.5  -0.1   27    2-37      2-28  (144)
  4 cd01452 VWA_26S_proteasome_sub  37.2      49  0.0011   23.1   3.2   30   12-41      5-36  (187)
  5 PF00724 Oxidored_FMN:  NADH:fl  37.0      31 0.00067   25.4   2.3   28   31-58    141-169 (341)
  6 cd07630 BAR_SNX_like The Bin/A  34.9      26 0.00057   24.6   1.6   13   28-40    145-157 (198)
  7 cd07663 BAR_SNX5 The Bin/Amphi  34.3      27 0.00058   25.4   1.6   13   28-40    163-175 (218)
  8 cd01453 vWA_transcription_fact  30.2      79  0.0017   21.1   3.2   33   11-43      4-38  (183)
  9 PF10972 DUF2803:  Protein of u  29.1      33 0.00072   24.1   1.3   10    4-13     24-33  (213)
 10 KOG0458|consensus               28.3      63  0.0014   27.2   2.9   32   25-56    329-361 (603)
 11 cd07662 BAR_SNX6 The Bin/Amphi  28.2      39 0.00084   24.8   1.6   13   28-40    163-175 (218)
 12 KOG1908|consensus               27.8      43 0.00093   23.9   1.7   24   27-50     70-93  (165)
 13 KOG1464|consensus               27.8      44 0.00095   26.9   1.9   22   27-48    157-178 (440)
 14 COG5256 TEF1 Translation elong  27.4      69  0.0015   25.9   2.9   30   26-55    160-189 (428)
 15 PLN02411 12-oxophytodienoate r  27.0      59  0.0013   24.8   2.4   27   32-58    158-185 (391)
 16 cd02929 TMADH_HD_FMN Trimethyl  26.4      64  0.0014   24.2   2.5   28   31-58    142-170 (370)
 17 PF08734 GYD:  GYD domain;  Int  26.1      80  0.0017   19.4   2.5   39   14-59      1-43  (91)
 18 cd04735 OYE_like_4_FMN Old yel  25.6      66  0.0014   23.8   2.4   29   31-59    136-165 (353)
 19 cd03070 PDI_b_ERp44 PDIb famil  25.2      85  0.0018   19.8   2.5   30   11-40     15-44  (91)
 20 PRK10605 N-ethylmaleimide redu  25.0      68  0.0015   24.1   2.4   28   31-58    151-179 (362)
 21 PRK13523 NADPH dehydrogenase N  24.8      70  0.0015   23.9   2.4   30   29-58    132-162 (337)
 22 PF12535 Nudix_N:  Hydrolase of  24.6      36 0.00078   19.9   0.7   18   27-44     27-44  (58)
 23 cd07621 BAR_SNX5_6 The Bin/Amp  23.3      55  0.0012   23.7   1.6   13   28-40    164-176 (219)
 24 PF13170 DUF4003:  Protein of u  23.2      67  0.0014   23.8   2.0   17   24-40     31-47  (297)
 25 cd04747 OYE_like_5_FMN Old yel  21.9      85  0.0018   23.9   2.4   29   31-59    136-165 (361)
 26 cd02930 DCR_FMN 2,4-dienoyl-Co  21.7      87  0.0019   23.1   2.4   28   31-58    129-157 (353)
 27 COG4112 Predicted phosphoester  21.3      57  0.0012   24.0   1.3   12    2-13     70-81  (203)
 28 PRK03057 hypothetical protein;  20.9      74  0.0016   22.5   1.8   19   25-43    159-177 (180)
 29 PF02762 Cbl_N3:  CBL proto-onc  20.5      20 0.00043   23.3  -1.0    9   41-49     30-38  (86)
 30 cd02931 ER_like_FMN Enoate red  20.5      93   0.002   23.5   2.4   29   31-59    142-171 (382)

No 1  
>KOG3886|consensus
Probab=99.83  E-value=2.3e-22  Score=150.14  Aligned_cols=58  Identities=62%  Similarity=0.749  Sum_probs=55.3

Q ss_pred             CCceEEEEEeceeeEEEEecccCCCCCCchHHHHHHHHHHHHHhhccCcCcceeEEEE
Q psy14771          1 MDGDEVLLFERATFLVISHCQRKEHRDIHRFEKISNIIKQFKLSSKWLPRFIQWKYAT   58 (64)
Q Consensus         1 ~~A~EVvLFErtTFLVIs~~~~~~~~d~~RFEkISnIiK~FKlScsk~~~~f~~~~~~   58 (64)
                      ++|+|||||||+|||||||.+..+++|.|||||||||+||||+||+|++++|++++..
T Consensus       195 ~ea~eviLfEr~tflvI~~~q~~~~~~~hrfekisnI~kqfk~sctk~~~~f~s~~~~  252 (295)
T KOG3886|consen  195 LEALEVILFERATFLVISHYQIKEMRDAHRFEKISNIIKQFKLSCTKLNADFDSMEVR  252 (295)
T ss_pred             HhHHHHHHHHhhhheeeehhhhhccccccccccHHHHHHHhhcceeecccccchhhee
Confidence            4799999999999999999999999999999999999999999999999999998753


No 2  
>PF04670 Gtr1_RagA:  Gtr1/RagA G protein conserved region;  InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1. RCC1 catalyzes guanine nucleotide exchange on Ran, a well characterised nuclear Ras-like small G protein that plays an essential role in the import and export of proteins and RNAs across the nuclear membrane through the nuclear pore complex. RCC1 is located inside the nucleus, bound to chromatin. The concentration of GTP within the cell is ~30 times higher than the concentration of GDP, thus resulting in the preferential production of the GTP form of Ran by RCC1 within the nucleus. Gtr1p is located within both the cytoplasm and the nucleus and has been reported to play a role in cell growth. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1 and Rag A and Gtr1p belong to the sixth subfamily of the Ras-like small GTPase superfamily []. ; GO: 0005525 GTP binding, 0005634 nucleus, 0005737 cytoplasm; PDB: 3R7W_B 2Q3F_B 3LLU_A.
Probab=99.30  E-value=1.2e-12  Score=93.26  Aligned_cols=38  Identities=53%  Similarity=0.828  Sum_probs=28.7

Q ss_pred             CCceEEEEEeceeeEEEEecccCCC--CCCchHHHHHHHH
Q psy14771          1 MDGDEVLLFERATFLVISHCQRKEH--RDIHRFEKISNII   38 (64)
Q Consensus         1 ~~A~EVvLFErtTFLVIs~~~~~~~--~d~~RFEkISnIi   38 (64)
                      |+|+||+||||+|||+||++++.+.  .|++|||++||||
T Consensus       193 c~a~ev~LFd~~T~L~Ia~ds~~~~~~~~~~~fE~~S~ii  232 (232)
T PF04670_consen  193 CNADEVFLFDRSTFLYIATDSRSPVDERDMQRFEKCSDII  232 (232)
T ss_dssp             CTEEEEEEEETTT--ECEE-S-S------HHHHHHHHHHH
T ss_pred             cCCcEEEEEeeeeEEEEEeccCCCccccccccHHHHhhcC
Confidence            7999999999999999999996554  5799999999997


No 3  
>PTZ00167 RNA polymerase subunit 8c; Provisional
Probab=39.60  E-value=9.5  Score=26.46  Aligned_cols=27  Identities=41%  Similarity=0.576  Sum_probs=18.1

Q ss_pred             CceEEEEEeceeeEEEEecccCCCCCCchHHHHHHH
Q psy14771          2 DGDEVLLFERATFLVISHCQRKEHRDIHRFEKISNI   37 (64)
Q Consensus         2 ~A~EVvLFErtTFLVIs~~~~~~~~d~~RFEkISnI   37 (64)
                      .++.+ |||-. |-|.+       .||++|+|+|-|
T Consensus         2 ~~~~~-LfeD~-F~V~~-------iD~~gfdrVSRI   28 (144)
T PTZ00167          2 SLPSC-LFEDR-FVVRS-------VDNSKFERVSRI   28 (144)
T ss_pred             CCCce-EEEee-EEEEe-------cCCCCCceEEEE
Confidence            34444 88854 66654       467789999865


No 4  
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins. It is an ATP-dependent protease responsible for the bulk of non-lysosomal proteolysis in eukaryotes, often using covalent modification of proteins by ubiquitylation. It consists of a 20S proteolytic core particle (CP) and a 19S regulatory particle (RP). The CP is an ATP independent peptidase consisting of hydrolyzing activities. One or both ends of CP carry the RP that confers both ubiquitin and ATP dependence to the 26S proteosome. The RP's  proposed functions include recognition of substrates and translocation of these to CP for proteolysis. The RP can dissociate into a stable lid and base subcomplexes. The base is composed of three non-ATPase subunits (Rpn 1, 2 and 10). A single residue in the vWA domain of Rpn10 has been implicated to be responsible for stabilizing the lid-base association.
Probab=37.21  E-value=49  Score=23.08  Aligned_cols=30  Identities=17%  Similarity=0.307  Sum_probs=22.7

Q ss_pred             eeeEEEEecccCCCC--CCchHHHHHHHHHHH
Q psy14771         12 ATFLVISHCQRKEHR--DIHRFEKISNIIKQF   41 (64)
Q Consensus        12 tTFLVIs~~~~~~~~--d~~RFEkISnIiK~F   41 (64)
                      +|.++|-.+.+-...  .|.|++.....+..|
T Consensus         5 a~vi~lD~S~sM~a~D~~PnRL~aak~~i~~~   36 (187)
T cd01452           5 ATMICIDNSEYMRNGDYPPTRFQAQADAVNLI   36 (187)
T ss_pred             EEEEEEECCHHHHcCCCCCCHHHHHHHHHHHH
Confidence            577787776664444  489999999998876


No 5  
>PF00724 Oxidored_FMN:  NADH:flavin oxidoreductase / NADH oxidase family;  InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside []. It is a widely distributed fold which has been found in many enzyme families that catalyse completely unrelated reactions []. The active site is always found at the C-terminal end of this domain. Proteins in this entry are a variety of NADH:flavin oxidoreductase/NADH oxidase enzymes, found mostly in bacteria or fungi, that contain a TIM-barrel fold. They commonly use FMN/FAD as cofactor and include:  dimethylamine dehydrogenase trimethylamine dehydrogenase 12-oxophytodienoate reductase NADPH dehydrogenase NADH oxidase  ; GO: 0010181 FMN binding, 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3GKA_B 3P67_A 3F03_K 2ABA_A 1VYR_A 1GVO_A 3KFT_B 3P8I_A 1GVQ_A 3P74_A ....
Probab=36.97  E-value=31  Score=25.39  Aligned_cols=28  Identities=18%  Similarity=0.113  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHhhccC-cCcceeEEEE
Q psy14771         31 FEKISNIIKQFKLSSKWL-PRFIQWKYAT   58 (64)
Q Consensus        31 FEkISnIiK~FKlScsk~-~~~f~~~~~~   58 (64)
                      -|.|..|+++|..++.+. .+.|.++++-
T Consensus       141 ~~eI~~ii~~f~~AA~~A~~AGfDGVEIH  169 (341)
T PF00724_consen  141 EEEIEEIIEDFAQAARRAKEAGFDGVEIH  169 (341)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTT-SEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHhccCeEeec
Confidence            688999999999999885 8999999975


No 6  
>cd07630 BAR_SNX_like The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized Sorting Nexins. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of uncharacterized proteins with similarity to sorting nexins (SNXs), which are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Probab=34.90  E-value=26  Score=24.58  Aligned_cols=13  Identities=38%  Similarity=0.590  Sum_probs=11.3

Q ss_pred             CchHHHHHHHHHH
Q psy14771         28 IHRFEKISNIIKQ   40 (64)
Q Consensus        28 ~~RFEkISnIiK~   40 (64)
                      ..+||+||+.||+
T Consensus       145 ~~~fe~iS~~~k~  157 (198)
T cd07630         145 ETEFEEISSLAKK  157 (198)
T ss_pred             HHHHHHHHHHHHH
Confidence            4699999999985


No 7  
>cd07663 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 5. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX5, abundantly expressed in macrophages, regulates macropinocytosis, a process that enables cells to internalize large amounts of external solutes. It may also be a component of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi, acting as a mammalian equivalent of yeast Vsp17p. It 
Probab=34.34  E-value=27  Score=25.42  Aligned_cols=13  Identities=46%  Similarity=0.662  Sum_probs=11.3

Q ss_pred             CchHHHHHHHHHH
Q psy14771         28 IHRFEKISNIIKQ   40 (64)
Q Consensus        28 ~~RFEkISnIiK~   40 (64)
                      .++||+||..+|.
T Consensus       163 ~~~Fe~IS~~~k~  175 (218)
T cd07663         163 CQKFEKLSESAKQ  175 (218)
T ss_pred             HHHHHHHHHHHHH
Confidence            5799999999874


No 8  
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme. Orthologues of these genes are found in all completed eukaryotic genomes and all these proteins contain a VWA domain. The p44 subunit of TFIIH functions as a DNA helicase in RNA polymerase II transcription initiation and DNA repair, and its transcriptional activity is dependent on its C-terminal Zn-binding domains. The function of the vWA domain is unclear, but may be involved in complex assembly. The MIDAS motif is not conserved in this sub-group.
Probab=30.23  E-value=79  Score=21.11  Aligned_cols=33  Identities=18%  Similarity=0.308  Sum_probs=24.4

Q ss_pred             ceeeEEEEecccCCCC--CCchHHHHHHHHHHHHH
Q psy14771         11 RATFLVISHCQRKEHR--DIHRFEKISNIIKQFKL   43 (64)
Q Consensus        11 rtTFLVIs~~~~~~~~--d~~RFEkISnIiK~FKl   43 (64)
                      |...++|-.+.+-...  .|.|+|+....+..|=.
T Consensus         4 r~ivi~lD~S~SM~a~D~~ptRl~~ak~~~~~fi~   38 (183)
T cd01453           4 RHLIIVIDCSRSMEEQDLKPSRLAVVLKLLELFIE   38 (183)
T ss_pred             eEEEEEEECcHHHhcCCCCchHHHHHHHHHHHHHH
Confidence            5667788777765433  48999999998877754


No 9  
>PF10972 DUF2803:  Protein of unknown function (DUF2803);  InterPro: IPR021241  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=29.15  E-value=33  Score=24.09  Aligned_cols=10  Identities=50%  Similarity=0.823  Sum_probs=8.7

Q ss_pred             eEEEEEecee
Q psy14771          4 DEVLLFERAT   13 (64)
Q Consensus         4 ~EVvLFErtT   13 (64)
                      -|||+|||..
T Consensus        24 VEviiF~r~~   33 (213)
T PF10972_consen   24 VEVIIFERNV   33 (213)
T ss_pred             EEEEEEEecC
Confidence            3899999987


No 10 
>KOG0458|consensus
Probab=28.30  E-value=63  Score=27.21  Aligned_cols=32  Identities=22%  Similarity=0.282  Sum_probs=25.9

Q ss_pred             CCCCchHHHHHHHHHHHH-HhhccCcCcceeEE
Q psy14771         25 HRDIHRFEKISNIIKQFK-LSSKWLPRFIQWKY   56 (64)
Q Consensus        25 ~~d~~RFEkISnIiK~FK-lScsk~~~~f~~~~   56 (64)
                      .+|.+|||.|-|.+..|= .+|.-..++++.+-
T Consensus       329 ~Wsq~RF~eIk~~l~~fL~~~~gf~es~v~FIP  361 (603)
T KOG0458|consen  329 SWSQDRFEEIKNKLSSFLKESCGFKESSVKFIP  361 (603)
T ss_pred             CccHHHHHHHHHHHHHHHHHhcCcccCCcceEe
Confidence            468999999999999997 89977777665543


No 11 
>cd07662 BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 6. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX6 forms a stable complex with SNX1 and may be a component of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi, acting as a mammalian equivalent of yeast Vsp17p. It interacts with the receptor serine/threonine kinases from the transforming growth factor-beta family. It also plays 
Probab=28.23  E-value=39  Score=24.80  Aligned_cols=13  Identities=54%  Similarity=0.693  Sum_probs=11.0

Q ss_pred             CchHHHHHHHHHH
Q psy14771         28 IHRFEKISNIIKQ   40 (64)
Q Consensus        28 ~~RFEkISnIiK~   40 (64)
                      .++||+||..+|.
T Consensus       163 ~~~Fe~IS~~aK~  175 (218)
T cd07662         163 CQKFEKISESAKQ  175 (218)
T ss_pred             HHHHHHHHHHHHH
Confidence            4699999999874


No 12 
>KOG1908|consensus
Probab=27.80  E-value=43  Score=23.91  Aligned_cols=24  Identities=25%  Similarity=0.260  Sum_probs=21.2

Q ss_pred             CCchHHHHHHHHHHHHHhhccCcC
Q psy14771         27 DIHRFEKISNIIKQFKLSSKWLPR   50 (64)
Q Consensus        27 d~~RFEkISnIiK~FKlScsk~~~   50 (64)
                      |.+|-=-.++||-.||..|.|.+.
T Consensus        70 dsqrvids~Eii~AYkeACQk~nC   93 (165)
T KOG1908|consen   70 DSQRVIDSDEIIGAYKEACQKLNC   93 (165)
T ss_pred             cccccccHHHHHHHHHHHHHHccc
Confidence            677888899999999999999764


No 13 
>KOG1464|consensus
Probab=27.80  E-value=44  Score=26.86  Aligned_cols=22  Identities=27%  Similarity=0.373  Sum_probs=19.8

Q ss_pred             CCchHHHHHHHHHHHHHhhccC
Q psy14771         27 DIHRFEKISNIIKQFKLSSKWL   48 (64)
Q Consensus        27 d~~RFEkISnIiK~FKlScsk~   48 (64)
                      |.+-|.|+-.|+||.++||.+-
T Consensus       157 d~~e~~kl~KIlkqLh~SCq~e  178 (440)
T KOG1464|consen  157 DRGEYTKLQKILKQLHQSCQTE  178 (440)
T ss_pred             eHHHHHHHHHHHHHHHHHhccc
Confidence            6788999999999999999764


No 14 
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]
Probab=27.43  E-value=69  Score=25.89  Aligned_cols=30  Identities=20%  Similarity=0.321  Sum_probs=24.4

Q ss_pred             CCCchHHHHHHHHHHHHHhhccCcCcceeE
Q psy14771         26 RDIHRFEKISNIIKQFKLSSKWLPRFIQWK   55 (64)
Q Consensus        26 ~d~~RFEkISnIiK~FKlScsk~~~~f~~~   55 (64)
                      +|.+|||.|.+-+..++.+|-....+++-+
T Consensus       160 wde~rf~ei~~~v~~l~k~~G~~~~~v~FI  189 (428)
T COG5256         160 WDEERFEEIVSEVSKLLKMVGYNPKDVPFI  189 (428)
T ss_pred             cCHHHHHHHHHHHHHHHHHcCCCccCCeEE
Confidence            689999999999999999998775554433


No 15 
>PLN02411 12-oxophytodienoate reductase
Probab=27.00  E-value=59  Score=24.77  Aligned_cols=27  Identities=4%  Similarity=0.028  Sum_probs=24.0

Q ss_pred             HHHHHHHHHHHHhhccC-cCcceeEEEE
Q psy14771         32 EKISNIIKQFKLSSKWL-PRFIQWKYAT   58 (64)
Q Consensus        32 EkISnIiK~FKlScsk~-~~~f~~~~~~   58 (64)
                      |.|..||++|..++.+. .+.|+++++-
T Consensus       158 ~eI~~ii~~f~~AA~rA~~AGFDGVEIH  185 (391)
T PLN02411        158 SEIPEVVEHYRQAALNAIRAGFDGIEIH  185 (391)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCCCEEEEc
Confidence            77999999999999885 6999999874


No 16 
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain.  TMADH is an iron-sulfur flavoprotein that catalyzes the oxidative demethylation of trimethylamine to form dimethylamine and formaldehyde. The protein forms a symetrical dimer with each subunit containing one 4Fe-4S cluster and one FMN cofactor.  It contains a unique flavin, in the form of a 6-S-cysteinyl FMN  which is bent by ~25 degrees along the N5-N10 axis of the flavin isoalloxazine ring. This modification of the conformation of the flavin is thought to facilitate catalysis.The closely related histamine dehydrogenase catalyzes oxidative deamination of histamine.
Probab=26.42  E-value=64  Score=24.25  Aligned_cols=28  Identities=7%  Similarity=-0.002  Sum_probs=24.4

Q ss_pred             HHHHHHHHHHHHHhhccC-cCcceeEEEE
Q psy14771         31 FEKISNIIKQFKLSSKWL-PRFIQWKYAT   58 (64)
Q Consensus        31 FEkISnIiK~FKlScsk~-~~~f~~~~~~   58 (64)
                      -|.|..|+++|..++.+. .+.|.++++.
T Consensus       142 ~~eI~~ii~~f~~AA~ra~~aGfDgVEih  170 (370)
T cd02929         142 KDDIKRVRRWYVDAALRARDAGFDIVYVY  170 (370)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCCCEEEEc
Confidence            478999999999998875 7899999875


No 17 
>PF08734 GYD:  GYD domain;  InterPro: IPR014845 These proteins of unknown function are usually less than 100 amino acids in length. They may belong to the dimeric alpha/beta barrel superfamily. 
Probab=26.09  E-value=80  Score=19.38  Aligned_cols=39  Identities=18%  Similarity=0.306  Sum_probs=26.1

Q ss_pred             eEEEEecccCC----CCCCchHHHHHHHHHHHHHhhccCcCcceeEEEEE
Q psy14771         14 FLVISHCQRKE----HRDIHRFEKISNIIKQFKLSSKWLPRFIQWKYATL   59 (64)
Q Consensus        14 FLVIs~~~~~~----~~d~~RFEkISnIiK~FKlScsk~~~~f~~~~~~~   59 (64)
                      |++++.++..-    ...++|-+.+...+++       .+..+.++|+|+
T Consensus         1 yi~l~~~T~~g~~~~~~~~~R~~a~~~~~e~-------~Gg~l~~~y~t~   43 (91)
T PF08734_consen    1 YIILARYTPEGAKGIKDSPDRAEAVRALIEA-------LGGKLKSFYWTL   43 (91)
T ss_pred             CEEEEEeCHHHHHHHhhcHHHHHHHHHHHHH-------cCCEEEEEEEec
Confidence            56677776431    1236777777777665       578888898886


No 18 
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=25.60  E-value=66  Score=23.82  Aligned_cols=29  Identities=17%  Similarity=0.079  Sum_probs=24.8

Q ss_pred             HHHHHHHHHHHHHhhccC-cCcceeEEEEE
Q psy14771         31 FEKISNIIKQFKLSSKWL-PRFIQWKYATL   59 (64)
Q Consensus        31 FEkISnIiK~FKlScsk~-~~~f~~~~~~~   59 (64)
                      =|.|..|+++|-.++.+. .++|+++++..
T Consensus       136 ~~eI~~ii~~f~~aA~~a~~aGfDgVeih~  165 (353)
T cd04735         136 HEEIEDIIDAFGEATRRAIEAGFDGVEIHG  165 (353)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCCCEEEEcc
Confidence            478999999999999885 68999999753


No 19 
>cd03070 PDI_b_ERp44 PDIb family, ERp44 subfamily, first redox inactive TRX-like domain b; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. Through the formation of reversible mixed disulfides, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. ERp44 also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol. Similar to PDI, the b domain of ERp44 is likely involved in binding to substrates.
Probab=25.16  E-value=85  Score=19.84  Aligned_cols=30  Identities=23%  Similarity=0.476  Sum_probs=24.7

Q ss_pred             ceeeEEEEecccCCCCCCchHHHHHHHHHH
Q psy14771         11 RATFLVISHCQRKEHRDIHRFEKISNIIKQ   40 (64)
Q Consensus        11 rtTFLVIs~~~~~~~~d~~RFEkISnIiK~   40 (64)
                      +..=.||+.-.+.++++.+=|+|+.+++|.
T Consensus        15 ~~kr~iIgYF~~~~~~eY~~f~kvA~~lr~   44 (91)
T cd03070          15 RSKRNIIGYFESKDSDEYDNFRKVANILRD   44 (91)
T ss_pred             cCCceEEEEEcCCCChhHHHHHHHHHHHhh
Confidence            344468999988888999999999999873


No 20 
>PRK10605 N-ethylmaleimide reductase; Provisional
Probab=25.02  E-value=68  Score=24.15  Aligned_cols=28  Identities=14%  Similarity=0.140  Sum_probs=24.2

Q ss_pred             HHHHHHHHHHHHHhhccC-cCcceeEEEE
Q psy14771         31 FEKISNIIKQFKLSSKWL-PRFIQWKYAT   58 (64)
Q Consensus        31 FEkISnIiK~FKlScsk~-~~~f~~~~~~   58 (64)
                      -+.|-.|+++|-.++.+. ++.|.++++-
T Consensus       151 ~~eI~~ii~~f~~AA~rA~~AGfDGVEIh  179 (362)
T PRK10605        151 LEEIPGIVNDFRQAIANAREAGFDLVELH  179 (362)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCCCEEEEc
Confidence            467999999999999875 7999999874


No 21 
>PRK13523 NADPH dehydrogenase NamA; Provisional
Probab=24.78  E-value=70  Score=23.87  Aligned_cols=30  Identities=13%  Similarity=-0.010  Sum_probs=25.2

Q ss_pred             chHHHHHHHHHHHHHhhccC-cCcceeEEEE
Q psy14771         29 HRFEKISNIIKQFKLSSKWL-PRFIQWKYAT   58 (64)
Q Consensus        29 ~RFEkISnIiK~FKlScsk~-~~~f~~~~~~   58 (64)
                      ---|.|.+|+++|..++.+. .+.|+++++.
T Consensus       132 mt~eeI~~ii~~f~~aA~~a~~aGfDgVeih  162 (337)
T PRK13523        132 MTKEQIKETVLAFKQAAVRAKEAGFDVIEIH  162 (337)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHcCCCEEEEc
Confidence            44688999999999998775 6799999875


No 22 
>PF12535 Nudix_N:  Hydrolase of X-linked nucleoside diphosphate N terminal ; PDB: 3Q1P_B 3Q4I_B.
Probab=24.56  E-value=36  Score=19.93  Aligned_cols=18  Identities=22%  Similarity=0.449  Sum_probs=13.8

Q ss_pred             CCchHHHHHHHHHHHHHh
Q psy14771         27 DIHRFEKISNIIKQFKLS   44 (64)
Q Consensus        27 d~~RFEkISnIiK~FKlS   44 (64)
                      |..|||+|..|.-+.=..
T Consensus        27 D~ERy~~lr~ia~ella~   44 (58)
T PF12535_consen   27 DRERYEELREIAAELLAE   44 (58)
T ss_dssp             HHHHHHHHHHHHHHHHCC
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            679999999997665433


No 23 
>cd07621 BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 5 and 6. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. Members of this subfamily include SNX5, SNX6, the mammalian SNX32, and similar proteins. SNX5 and SNX6 may be components of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi, acting as a mammalian equivalent of yeast Vsp17p. The function of SNX32 is still unknown. BAR domain
Probab=23.27  E-value=55  Score=23.70  Aligned_cols=13  Identities=38%  Similarity=0.555  Sum_probs=11.1

Q ss_pred             CchHHHHHHHHHH
Q psy14771         28 IHRFEKISNIIKQ   40 (64)
Q Consensus        28 ~~RFEkISnIiK~   40 (64)
                      ..+||+||..+|.
T Consensus       164 ~~~Fe~iS~~~k~  176 (219)
T cd07621         164 CEKFESMSESAKQ  176 (219)
T ss_pred             HHHHHHHHHHHHH
Confidence            4799999999874


No 24 
>PF13170 DUF4003:  Protein of unknown function (DUF4003)
Probab=23.22  E-value=67  Score=23.78  Aligned_cols=17  Identities=41%  Similarity=0.624  Sum_probs=14.4

Q ss_pred             CCCCCchHHHHHHHHHH
Q psy14771         24 EHRDIHRFEKISNIIKQ   40 (64)
Q Consensus        24 ~~~d~~RFEkISnIiK~   40 (64)
                      ...|..||+.++++||+
T Consensus        31 ~~~d~~~~~~~~~~IK~   47 (297)
T PF13170_consen   31 KEFDAERFKEISKYIKK   47 (297)
T ss_pred             CCCCHHHHHHHHHHHHH
Confidence            44688999999999997


No 25 
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=21.92  E-value=85  Score=23.88  Aligned_cols=29  Identities=10%  Similarity=-0.129  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHHHHhhccC-cCcceeEEEEE
Q psy14771         31 FEKISNIIKQFKLSSKWL-PRFIQWKYATL   59 (64)
Q Consensus        31 FEkISnIiK~FKlScsk~-~~~f~~~~~~~   59 (64)
                      -|.|-.|+++|..++.+. ++.|.++++..
T Consensus       136 ~~eI~~ii~~f~~AA~~a~~aGfDgVeih~  165 (361)
T cd04747         136 EADIDDVIAAFARAAADARRLGFDGIELHG  165 (361)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCCCEEEEec
Confidence            467999999999988775 68999998753


No 26 
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain.  DCR in E. coli  is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provi
Probab=21.69  E-value=87  Score=23.08  Aligned_cols=28  Identities=14%  Similarity=-0.013  Sum_probs=24.6

Q ss_pred             HHHHHHHHHHHHHhhccC-cCcceeEEEE
Q psy14771         31 FEKISNIIKQFKLSSKWL-PRFIQWKYAT   58 (64)
Q Consensus        31 FEkISnIiK~FKlScsk~-~~~f~~~~~~   58 (64)
                      -|.|..|+++|..++.+. .+.|+++++-
T Consensus       129 ~~eI~~i~~~f~~aA~~a~~aGfDgVeih  157 (353)
T cd02930         129 EEEIEQTIEDFARCAALAREAGYDGVEIM  157 (353)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCCCEEEEe
Confidence            488999999999999884 7999999974


No 27 
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only]
Probab=21.30  E-value=57  Score=24.03  Aligned_cols=12  Identities=67%  Similarity=1.030  Sum_probs=9.9

Q ss_pred             CceEEEEEecee
Q psy14771          2 DGDEVLLFERAT   13 (64)
Q Consensus         2 ~A~EVvLFErtT   13 (64)
                      +-|||+++||.|
T Consensus        70 ~edevliyeRlt   81 (203)
T COG4112          70 DEDEVLIYERLT   81 (203)
T ss_pred             cCCEEEEEEecc
Confidence            467999999976


No 28 
>PRK03057 hypothetical protein; Provisional
Probab=20.93  E-value=74  Score=22.51  Aligned_cols=19  Identities=16%  Similarity=0.564  Sum_probs=16.7

Q ss_pred             CCCCchHHHHHHHHHHHHH
Q psy14771         25 HRDIHRFEKISNIIKQFKL   43 (64)
Q Consensus        25 ~~d~~RFEkISnIiK~FKl   43 (64)
                      ..|.+||-++|++++++|.
T Consensus       159 ~~D~e~F~~Lt~~L~~l~~  177 (180)
T PRK03057        159 RKDMEEFQRLTEKLKKLEG  177 (180)
T ss_pred             CCCHHHHHHHHHHHHHHHh
Confidence            4689999999999999954


No 29 
>PF02762 Cbl_N3:  CBL proto-oncogene N-terminus, SH2-like domain;  InterPro: IPR014742 Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface. The N-terminal region of Cbl contains a Cbl-type phosphotyrosine-binding (Cbl-PTB) domain, which is composed of three evolutionarily conserved domains: an N-terminal four-helix bundle (4H) domain, an EF hand-like calcium-binding domain, and a divergent SH2-like domain. The calcium-bound EF-hand wedges between the 4H and SH2 domains, and roughly determines their relative orientation. The Cbl-PTB domain has also been named Cbl N-terminal (Cbl-N) or tyrosine kinase binding (TKB) domain [, ]. The N-terminal 4H domain contains four long alpha-helices. The C and D helices in this domain pack against the adjacent EF-hand-like domain, and a highly conserved loop connecting the A and B helices contacts the SH2-like domain. The EF-hand motif is similar to classical EF-hand proteins. The SH2-like domain retains the general helix-sheet-helix architecture of the SH2 fold, but lacks the secondary beta-sheet, comprising beta-strands D', E and F, and also a prominent BG loop [].  This entry represents the SH2-like domain.; PDB: 3PFV_A 3VGO_A 3PLF_B 2Y1M_A 2CBL_A 3BUX_B 3BUN_B 3BUM_B 3OB1_B 3BUW_B ....
Probab=20.49  E-value=20  Score=23.32  Aligned_cols=9  Identities=44%  Similarity=0.626  Sum_probs=7.6

Q ss_pred             HHHhhccCc
Q psy14771         41 FKLSSKWLP   49 (64)
Q Consensus        41 FKlScsk~~   49 (64)
                      |++||.|++
T Consensus        30 FRlSCTrLG   38 (86)
T PF02762_consen   30 FRLSCTRLG   38 (86)
T ss_dssp             EEEESSSTT
T ss_pred             Eeecccccc
Confidence            789999985


No 30 
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain.  Enoate reductase catalyzes the NADH-dependent reduction of carbon-carbon double bonds of several molecules, including nonactivated 2-enoates, alpha,beta-unsaturated aldehydes, cyclic ketones, and methylketones. ERs are similar to 2,4-dienoyl-CoA reductase from E. coli and to the old yellow enzyme from Saccharomyces cerevisiae.
Probab=20.47  E-value=93  Score=23.47  Aligned_cols=29  Identities=10%  Similarity=-0.026  Sum_probs=24.6

Q ss_pred             HHHHHHHHHHHHHhhccC-cCcceeEEEEE
Q psy14771         31 FEKISNIIKQFKLSSKWL-PRFIQWKYATL   59 (64)
Q Consensus        31 FEkISnIiK~FKlScsk~-~~~f~~~~~~~   59 (64)
                      -|.|..|+++|..+..+. ++.|.++++-.
T Consensus       142 ~~eI~~ii~~f~~AA~ra~~AGfDgVEih~  171 (382)
T cd02931         142 TEEVETFVGKFGESAVIAKEAGFDGVEIHA  171 (382)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCCCEEEEec
Confidence            367999999999998775 68999998753


Done!