BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy14809
         (90 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3E1S|A Chain A, Structure Of An N-Terminal Truncation Of Deinococcus
           Radiodurans Recd2
 pdb|3GP8|A Chain A, Crystal Structure Of The Binary Complex Of Recd2 With Dna
 pdb|3GPL|A Chain A, Crystal Structure Of The Ternary Complex Of Recd2 With Dna
           And Adpnp
 pdb|3GPL|B Chain B, Crystal Structure Of The Ternary Complex Of Recd2 With Dna
           And Adpnp
          Length = 574

 Score = 26.2 bits (56), Expect = 5.0,   Method: Composition-based stats.
 Identities = 10/18 (55%), Positives = 14/18 (77%)

Query: 39  EQFSLCLEYAITIHKCQG 56
           E F+L L YA+T+H+ QG
Sbjct: 484 ELFNLQLGYALTVHRAQG 501


>pdb|3VR8|D Chain D, Mitochondrial Rhodoquinol-Fumarate Reductase From The
           Parasitic Nematode Ascaris Suum
 pdb|3VR8|H Chain H, Mitochondrial Rhodoquinol-Fumarate Reductase From The
           Parasitic Nematode Ascaris Suum
 pdb|3VRB|D Chain D, Mitochondrial Rhodoquinol-Fumarate Reductase From The
           Parasitic Nematode Ascaris Suum With The Specific
           Inhibitor Flutolanil And Substrate Fumarate
 pdb|3VRB|H Chain H, Mitochondrial Rhodoquinol-Fumarate Reductase From The
           Parasitic Nematode Ascaris Suum With The Specific
           Inhibitor Flutolanil And Substrate Fumarate
          Length = 156

 Score = 25.4 bits (54), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 29  EVLPRAY-VHREQFSLCLEYAITIHKCQGL 57
            ++P AY +H  +  LCL  A+T+H   G+
Sbjct: 71  PLIPAAYFIHGREMDLCLALALTLHVHWGV 100


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.135    0.413 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,334,421
Number of Sequences: 62578
Number of extensions: 72090
Number of successful extensions: 194
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 193
Number of HSP's gapped (non-prelim): 2
length of query: 90
length of database: 14,973,337
effective HSP length: 57
effective length of query: 33
effective length of database: 11,406,391
effective search space: 376410903
effective search space used: 376410903
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)