BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy14832
         (213 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4F9V|A Chain A, Structure Of C113aC136A MUTANT VARIANT OF GLYCOSYLATED
           GLUTAMINYL Cyclase From Drosophila Melanogaster
 pdb|4F9V|B Chain B, Structure Of C113aC136A MUTANT VARIANT OF GLYCOSYLATED
           GLUTAMINYL Cyclase From Drosophila Melanogaster
          Length = 312

 Score = 31.6 bits (70), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 47  LIRVVLGLGNKYLMLEIKYRIATYLGILFAVSIIGDVLPYPKSYFSQSSHFLNQYF 102
           L++ + GLG +  + E K R+  +  + FA +++G + P  +++ + ++H+ ++YF
Sbjct: 38  LVQSLNGLGFQTEVDEFKQRVPVFGELTFA-NVVGTINPQAQNFLALAAHYDSKYF 92


>pdb|4F9U|A Chain A, Structure Of Glycosylated Glutaminyl Cyclase From
           Drosophila Melanogaster
 pdb|4F9U|B Chain B, Structure Of Glycosylated Glutaminyl Cyclase From
           Drosophila Melanogaster
 pdb|4FWU|A Chain A, Crystal Structure Of Glutaminyl Cyclase From Drosophila
           Melanogaster In Space Group I4
          Length = 312

 Score = 30.4 bits (67), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 47  LIRVVLGLGNKYLMLEIKYRIATYLGILFAVSIIGDVLPYPKSYFSQSSHFLNQYF 102
           L++ + GLG +  + E K R+  +  + FA +++G + P  +++ + + H+ ++YF
Sbjct: 38  LVQSLNGLGFQTEVDEFKQRVPVFGELTFA-NVVGTINPQAQNFLALACHYDSKYF 92


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.140    0.449 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,191,929
Number of Sequences: 62578
Number of extensions: 237951
Number of successful extensions: 515
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 515
Number of HSP's gapped (non-prelim): 3
length of query: 213
length of database: 14,973,337
effective HSP length: 95
effective length of query: 118
effective length of database: 9,028,427
effective search space: 1065354386
effective search space used: 1065354386
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 49 (23.5 bits)