Query         psy14876
Match_columns 121
No_of_seqs    104 out of 169
Neff          5.0 
Searched_HMMs 46136
Date          Fri Aug 16 23:04:12 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14876.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14876hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07657 MNNL:  N terminus of N 100.0 7.9E-40 1.7E-44  222.3   7.5   77    5-84      1-77  (77)
  2 PF08116 Toxin_29:  PhTx neurot  57.1     3.8 8.3E-05   23.4   0.1   10   40-49     16-25  (31)
  3 PF08087 Toxin_18:  Conotoxin O  47.1     5.6 0.00012   22.7  -0.2   16   39-54     15-30  (31)
  4 PF08106 Antimicrobial11:  Form  27.4      38 0.00082   16.5   0.9   10  112-121     4-13  (16)
  5 COG3564 Uncharacterized protei  18.5      62  0.0013   23.4   1.0   10   24-33     31-40  (116)
  6 PF05610 DUF779:  Protein of un  14.5      88  0.0019   22.2   1.0   10   24-33     17-26  (95)
  7 COG0786 GltS Na+/glutamate sym  13.9      47   0.001   29.1  -0.7   32   48-79    328-359 (404)
  8 PF06156 DUF972:  Protein of un  12.7 1.1E+02  0.0024   21.7   1.0   19   49-68     86-104 (107)
  9 COG3657 Uncharacterized protei  12.2      63  0.0014   23.1  -0.3   31    5-36     47-84  (100)
 10 PF12577 PPARgamma_N:  PPAR gam  11.3      86  0.0019   21.8   0.1   11   99-109     7-17  (83)

No 1  
>PF07657 MNNL:  N terminus of Notch ligand;  InterPro: IPR011651 This entry represents a region of conserved sequence at the N terminus of several Notch ligand proteins.; GO: 0007219 Notch signaling pathway, 0007275 multicellular organismal development, 0016021 integral to membrane
Probab=100.00  E-value=7.9e-40  Score=222.35  Aligned_cols=77  Identities=56%  Similarity=1.058  Sum_probs=72.1

Q ss_pred             eeeEEEEEEEEEecCCCCCCCCCCCCCCCCCCCCCcCcCCCcceeeecccccccccCCCCCCccCcccCCCccCCccccc
Q psy14876          5 GSGFFELQILEIANYKGELASGICCGGLHRPDPSISCPVQCNTLFRVCLKEYQSNVTSNGPCSFGNTSSPVLGGNSFTLT   84 (121)
Q Consensus         5 ~sG~FELqL~sf~N~~G~l~~G~CC~g~~~~~~~~~c~~~Crt~FRvCLK~yq~~v~~~gpCtfG~~~TpvLG~nsf~~~   84 (121)
                      ++|+|||||++|+|++|++++|+|||+.   ....+|.++|||||||||||||++|++++|||||+++|||||+|||+++
T Consensus         1 ssG~FEL~l~sf~N~~G~l~~G~CC~~~---~~~~~c~~~C~t~FrvCLK~yQ~~v~~~~pCtfG~~~TpvLG~nsf~~~   77 (77)
T PF07657_consen    1 SSGVFELQLHSFQNPNGELSNGNCCDGG---SSSGCCSDPCRTFFRVCLKHYQAVVSPEGPCTFGNASTPVLGGNSFSLK   77 (77)
T ss_pred             CCcEEEEEEEEEECCCCccCCCCCCCCC---ccCCccCCCccceEEEechhhcccCCCCCCCCCCCeecCccCCCceEeC
Confidence            5899999999999999999999999998   3345699999999999999999999999999999999999999999874


No 2  
>PF08116 Toxin_29:  PhTx neurotoxin family;  InterPro: IPR012634 This family consists of PhTx insecticidal neurotoxins that are found in the venom of Phoneutria nigriventer (Brazilian armed spider). The venom of the P. nigrivente contains numerous neurotoxic polypeptides of 30-140 amino acids, which exert a range of biological effects. While some of these neurotoxins are lethal to mice after intracerebroventricular injections, others are extremely toxic to insects of the orders Diptera and Dictyoptera but had much weaker toxic effects on mice [].; GO: 0009405 pathogenesis, 0005576 extracellular region
Probab=57.13  E-value=3.8  Score=23.36  Aligned_cols=10  Identities=40%  Similarity=0.966  Sum_probs=7.7

Q ss_pred             cCcCCCccee
Q psy14876         40 SCPVQCNTLF   49 (121)
Q Consensus        40 ~c~~~Crt~F   49 (121)
                      ||.+.|+|.|
T Consensus        16 CC~G~C~tAF   25 (31)
T PF08116_consen   16 CCNGRCRTAF   25 (31)
T ss_pred             eecchhHHHH
Confidence            4567899987


No 3  
>PF08087 Toxin_18:  Conotoxin O-superfamily;  InterPro: IPR012623 This family consists of members of the conotoxin O-superfamily. The O-superfamily of conotoxins consists of 3 groups of Conus peptides that belong to the same structural group. These 3 groups differ in their pharmacological properties: the w-conotoxins which inhibit calcium channels, the delta-conotoxins which slow down the inactivation rate of voltage -sensitive sodium channels and the muO-conotoxins block the voltage sensitive sodium currents [].
Probab=47.10  E-value=5.6  Score=22.68  Aligned_cols=16  Identities=31%  Similarity=0.829  Sum_probs=13.7

Q ss_pred             CcCcCCCcceeeeccc
Q psy14876         39 ISCPVQCNTLFRVCLK   54 (121)
Q Consensus        39 ~~c~~~Crt~FRvCLK   54 (121)
                      .||++.|...|..||.
T Consensus        15 ecCSGAcSa~F~~CL~   30 (31)
T PF08087_consen   15 ECCSGACSAAFGFCLH   30 (31)
T ss_pred             hhhcccchHHHhcccC
Confidence            4678899999999985


No 4  
>PF08106 Antimicrobial11:  Formaecin family;  InterPro: IPR012514 This entry consists of the formaecin family of antimicrobial peptides isolated from the bulldog ant Myrmecia gulosa in response to bacterial infection. Formaecins are inducible peptide antibiotics and are active against growing Escherichia coli but were inactive against other Gram-negative and Gram-positive bacteria. Formaecin peptides are 16 amino acids long, are rich in proline and have N-acetylgalactosamine O-linked to a conserved threonine [].; GO: 0042381 hemolymph coagulation, 0042742 defense response to bacterium
Probab=27.39  E-value=38  Score=16.52  Aligned_cols=10  Identities=60%  Similarity=0.816  Sum_probs=7.6

Q ss_pred             cccCCCCCCC
Q psy14876        112 NIRNQKPTPF  121 (121)
Q Consensus       112 ~~~~~~~~~~  121 (121)
                      |--|.||||.
T Consensus         4 npvn~kptp~   13 (16)
T PF08106_consen    4 NPVNNKPTPH   13 (16)
T ss_pred             CcccCCCCCC
Confidence            5668899984


No 5  
>COG3564 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=18.47  E-value=62  Score=23.45  Aligned_cols=10  Identities=50%  Similarity=1.049  Sum_probs=8.1

Q ss_pred             CCCCCCCCCC
Q psy14876         24 ASGICCGGLH   33 (121)
Q Consensus        24 ~~G~CC~g~~   33 (121)
                      .+|.||||.+
T Consensus        31 QSGGCCDGSs   40 (116)
T COG3564          31 QSGGCCDGSS   40 (116)
T ss_pred             ccCCccCCCC
Confidence            6899999863


No 6  
>PF05610 DUF779:  Protein of unknown function (DUF779);  InterPro: IPR008497 This family consists of several bacterial proteins of unknown function.
Probab=14.54  E-value=88  Score=22.19  Aligned_cols=10  Identities=50%  Similarity=1.029  Sum_probs=8.3

Q ss_pred             CCCCCCCCCC
Q psy14876         24 ASGICCGGLH   33 (121)
Q Consensus        24 ~~G~CC~g~~   33 (121)
                      ++|.||||..
T Consensus        17 QSGGCCDGSa   26 (95)
T PF05610_consen   17 QSGGCCDGSA   26 (95)
T ss_pred             eCCCCCCCCc
Confidence            7899999864


No 7  
>COG0786 GltS Na+/glutamate symporter [Amino acid transport and metabolism]
Probab=13.87  E-value=47  Score=29.09  Aligned_cols=32  Identities=34%  Similarity=0.616  Sum_probs=27.4

Q ss_pred             eeeecccccccccCCCCCCccCcccCCCccCC
Q psy14876         48 LFRVCLKEYQSNVTSNGPCSFGNTSSPVLGGN   79 (121)
Q Consensus        48 ~FRvCLK~yq~~v~~~gpCtfG~~~TpvLG~n   79 (121)
                      -||++.|.|.+.|-..|-|-||-+.||.-=.|
T Consensus       328 tfr~mG~~YdAaV~~~G~~G~gLGATPtAian  359 (404)
T COG0786         328 TFRLMGKNYDAAVLAAGHCGFGLGATPTAIAN  359 (404)
T ss_pred             HHHHhCcchhHHHHhcccccCccCCcHHHHHh
Confidence            38999999999998889999999999975443


No 8  
>PF06156 DUF972:  Protein of unknown function (DUF972);  InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication. SUBUNIT: Interacts with both DnaA and DnaN, acting as a bridge between these two proteins. SIMILARITY: Belongs to the YabA family.
Probab=12.71  E-value=1.1e+02  Score=21.74  Aligned_cols=19  Identities=32%  Similarity=0.758  Sum_probs=16.3

Q ss_pred             eeecccccccccCCCCCCcc
Q psy14876         49 FRVCLKEYQSNVTSNGPCSF   68 (121)
Q Consensus        49 FRvCLK~yq~~v~~~gpCtf   68 (121)
                      |.||=-+|-..- .+++|.|
T Consensus        86 FHICn~~yG~~R-~~edClF  104 (107)
T PF06156_consen   86 FHICNVHYGSRR-NDEDCLF  104 (107)
T ss_pred             eeeCcHHhCCcC-CCCCCcc
Confidence            889999998877 6788987


No 9  
>COG3657 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=12.25  E-value=63  Score=23.14  Aligned_cols=31  Identities=29%  Similarity=0.447  Sum_probs=19.4

Q ss_pred             eeeEEEEEEEE-------EecCCCCCCCCCCCCCCCCCC
Q psy14876          5 GSGFFELQILE-------IANYKGELASGICCGGLHRPD   36 (121)
Q Consensus         5 ~sG~FELqL~s-------f~N~~G~l~~G~CC~g~~~~~   36 (121)
                      ..|+|||+|+.       |++. |...-=-+|+|..+++
T Consensus        47 geGV~ELRId~GpGyRvY~~~~-g~v~i~lLCgGdks~q   84 (100)
T COG3657          47 GEGVSELRIDHGPGYRVYFQQR-GLVLILLLCGGDKSTQ   84 (100)
T ss_pred             ccchhhheeccCCceEEEEEec-CcEEEEEeccCchhhH
Confidence            46999999963       4443 3333345677776654


No 10 
>PF12577 PPARgamma_N:  PPAR gamma N-terminal region;  InterPro: IPR022590  This domain is found in eukaryotes, and is typically between 42 and 65 amino acids in length. It is found N-terminal to PF00104 from PFAM and PF00105 from PFAM. There are two completely conserved residues (D and Y) that may be functionally important. Peroxisome proliferator-activated receptors (PPAR) are nuclear hormone receptors that control the expression of genes involved in lipid homeostasis in mammals[]. 
Probab=11.32  E-value=86  Score=21.77  Aligned_cols=11  Identities=27%  Similarity=0.214  Sum_probs=9.2

Q ss_pred             cccCccEEeee
Q psy14876         99 FRWTFSATGSS  109 (121)
Q Consensus        99 F~WPgsFtl~~  109 (121)
                      ++||-.|.|.+
T Consensus         7 ~~Wpv~Fgls~   17 (83)
T PF12577_consen    7 PAWPVGFGLSS   17 (83)
T ss_pred             ccccccccccc
Confidence            58999998875


Done!