Query psy14876
Match_columns 121
No_of_seqs 104 out of 169
Neff 5.0
Searched_HMMs 46136
Date Fri Aug 16 23:04:12 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy14876.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14876hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF07657 MNNL: N terminus of N 100.0 7.9E-40 1.7E-44 222.3 7.5 77 5-84 1-77 (77)
2 PF08116 Toxin_29: PhTx neurot 57.1 3.8 8.3E-05 23.4 0.1 10 40-49 16-25 (31)
3 PF08087 Toxin_18: Conotoxin O 47.1 5.6 0.00012 22.7 -0.2 16 39-54 15-30 (31)
4 PF08106 Antimicrobial11: Form 27.4 38 0.00082 16.5 0.9 10 112-121 4-13 (16)
5 COG3564 Uncharacterized protei 18.5 62 0.0013 23.4 1.0 10 24-33 31-40 (116)
6 PF05610 DUF779: Protein of un 14.5 88 0.0019 22.2 1.0 10 24-33 17-26 (95)
7 COG0786 GltS Na+/glutamate sym 13.9 47 0.001 29.1 -0.7 32 48-79 328-359 (404)
8 PF06156 DUF972: Protein of un 12.7 1.1E+02 0.0024 21.7 1.0 19 49-68 86-104 (107)
9 COG3657 Uncharacterized protei 12.2 63 0.0014 23.1 -0.3 31 5-36 47-84 (100)
10 PF12577 PPARgamma_N: PPAR gam 11.3 86 0.0019 21.8 0.1 11 99-109 7-17 (83)
No 1
>PF07657 MNNL: N terminus of Notch ligand; InterPro: IPR011651 This entry represents a region of conserved sequence at the N terminus of several Notch ligand proteins.; GO: 0007219 Notch signaling pathway, 0007275 multicellular organismal development, 0016021 integral to membrane
Probab=100.00 E-value=7.9e-40 Score=222.35 Aligned_cols=77 Identities=56% Similarity=1.058 Sum_probs=72.1
Q ss_pred eeeEEEEEEEEEecCCCCCCCCCCCCCCCCCCCCCcCcCCCcceeeecccccccccCCCCCCccCcccCCCccCCccccc
Q psy14876 5 GSGFFELQILEIANYKGELASGICCGGLHRPDPSISCPVQCNTLFRVCLKEYQSNVTSNGPCSFGNTSSPVLGGNSFTLT 84 (121)
Q Consensus 5 ~sG~FELqL~sf~N~~G~l~~G~CC~g~~~~~~~~~c~~~Crt~FRvCLK~yq~~v~~~gpCtfG~~~TpvLG~nsf~~~ 84 (121)
++|+|||||++|+|++|++++|+|||+. ....+|.++|||||||||||||++|++++|||||+++|||||+|||+++
T Consensus 1 ssG~FEL~l~sf~N~~G~l~~G~CC~~~---~~~~~c~~~C~t~FrvCLK~yQ~~v~~~~pCtfG~~~TpvLG~nsf~~~ 77 (77)
T PF07657_consen 1 SSGVFELQLHSFQNPNGELSNGNCCDGG---SSSGCCSDPCRTFFRVCLKHYQAVVSPEGPCTFGNASTPVLGGNSFSLK 77 (77)
T ss_pred CCcEEEEEEEEEECCCCccCCCCCCCCC---ccCCccCCCccceEEEechhhcccCCCCCCCCCCCeecCccCCCceEeC
Confidence 5899999999999999999999999998 3345699999999999999999999999999999999999999999874
No 2
>PF08116 Toxin_29: PhTx neurotoxin family; InterPro: IPR012634 This family consists of PhTx insecticidal neurotoxins that are found in the venom of Phoneutria nigriventer (Brazilian armed spider). The venom of the P. nigrivente contains numerous neurotoxic polypeptides of 30-140 amino acids, which exert a range of biological effects. While some of these neurotoxins are lethal to mice after intracerebroventricular injections, others are extremely toxic to insects of the orders Diptera and Dictyoptera but had much weaker toxic effects on mice [].; GO: 0009405 pathogenesis, 0005576 extracellular region
Probab=57.13 E-value=3.8 Score=23.36 Aligned_cols=10 Identities=40% Similarity=0.966 Sum_probs=7.7
Q ss_pred cCcCCCccee
Q psy14876 40 SCPVQCNTLF 49 (121)
Q Consensus 40 ~c~~~Crt~F 49 (121)
||.+.|+|.|
T Consensus 16 CC~G~C~tAF 25 (31)
T PF08116_consen 16 CCNGRCRTAF 25 (31)
T ss_pred eecchhHHHH
Confidence 4567899987
No 3
>PF08087 Toxin_18: Conotoxin O-superfamily; InterPro: IPR012623 This family consists of members of the conotoxin O-superfamily. The O-superfamily of conotoxins consists of 3 groups of Conus peptides that belong to the same structural group. These 3 groups differ in their pharmacological properties: the w-conotoxins which inhibit calcium channels, the delta-conotoxins which slow down the inactivation rate of voltage -sensitive sodium channels and the muO-conotoxins block the voltage sensitive sodium currents [].
Probab=47.10 E-value=5.6 Score=22.68 Aligned_cols=16 Identities=31% Similarity=0.829 Sum_probs=13.7
Q ss_pred CcCcCCCcceeeeccc
Q psy14876 39 ISCPVQCNTLFRVCLK 54 (121)
Q Consensus 39 ~~c~~~Crt~FRvCLK 54 (121)
.||++.|...|..||.
T Consensus 15 ecCSGAcSa~F~~CL~ 30 (31)
T PF08087_consen 15 ECCSGACSAAFGFCLH 30 (31)
T ss_pred hhhcccchHHHhcccC
Confidence 4678899999999985
No 4
>PF08106 Antimicrobial11: Formaecin family; InterPro: IPR012514 This entry consists of the formaecin family of antimicrobial peptides isolated from the bulldog ant Myrmecia gulosa in response to bacterial infection. Formaecins are inducible peptide antibiotics and are active against growing Escherichia coli but were inactive against other Gram-negative and Gram-positive bacteria. Formaecin peptides are 16 amino acids long, are rich in proline and have N-acetylgalactosamine O-linked to a conserved threonine [].; GO: 0042381 hemolymph coagulation, 0042742 defense response to bacterium
Probab=27.39 E-value=38 Score=16.52 Aligned_cols=10 Identities=60% Similarity=0.816 Sum_probs=7.6
Q ss_pred cccCCCCCCC
Q psy14876 112 NIRNQKPTPF 121 (121)
Q Consensus 112 ~~~~~~~~~~ 121 (121)
|--|.||||.
T Consensus 4 npvn~kptp~ 13 (16)
T PF08106_consen 4 NPVNNKPTPH 13 (16)
T ss_pred CcccCCCCCC
Confidence 5668899984
No 5
>COG3564 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=18.47 E-value=62 Score=23.45 Aligned_cols=10 Identities=50% Similarity=1.049 Sum_probs=8.1
Q ss_pred CCCCCCCCCC
Q psy14876 24 ASGICCGGLH 33 (121)
Q Consensus 24 ~~G~CC~g~~ 33 (121)
.+|.||||.+
T Consensus 31 QSGGCCDGSs 40 (116)
T COG3564 31 QSGGCCDGSS 40 (116)
T ss_pred ccCCccCCCC
Confidence 6899999863
No 6
>PF05610 DUF779: Protein of unknown function (DUF779); InterPro: IPR008497 This family consists of several bacterial proteins of unknown function.
Probab=14.54 E-value=88 Score=22.19 Aligned_cols=10 Identities=50% Similarity=1.029 Sum_probs=8.3
Q ss_pred CCCCCCCCCC
Q psy14876 24 ASGICCGGLH 33 (121)
Q Consensus 24 ~~G~CC~g~~ 33 (121)
++|.||||..
T Consensus 17 QSGGCCDGSa 26 (95)
T PF05610_consen 17 QSGGCCDGSA 26 (95)
T ss_pred eCCCCCCCCc
Confidence 7899999864
No 7
>COG0786 GltS Na+/glutamate symporter [Amino acid transport and metabolism]
Probab=13.87 E-value=47 Score=29.09 Aligned_cols=32 Identities=34% Similarity=0.616 Sum_probs=27.4
Q ss_pred eeeecccccccccCCCCCCccCcccCCCccCC
Q psy14876 48 LFRVCLKEYQSNVTSNGPCSFGNTSSPVLGGN 79 (121)
Q Consensus 48 ~FRvCLK~yq~~v~~~gpCtfG~~~TpvLG~n 79 (121)
-||++.|.|.+.|-..|-|-||-+.||.-=.|
T Consensus 328 tfr~mG~~YdAaV~~~G~~G~gLGATPtAian 359 (404)
T COG0786 328 TFRLMGKNYDAAVLAAGHCGFGLGATPTAIAN 359 (404)
T ss_pred HHHHhCcchhHHHHhcccccCccCCcHHHHHh
Confidence 38999999999998889999999999975443
No 8
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication. SUBUNIT: Interacts with both DnaA and DnaN, acting as a bridge between these two proteins. SIMILARITY: Belongs to the YabA family.
Probab=12.71 E-value=1.1e+02 Score=21.74 Aligned_cols=19 Identities=32% Similarity=0.758 Sum_probs=16.3
Q ss_pred eeecccccccccCCCCCCcc
Q psy14876 49 FRVCLKEYQSNVTSNGPCSF 68 (121)
Q Consensus 49 FRvCLK~yq~~v~~~gpCtf 68 (121)
|.||=-+|-..- .+++|.|
T Consensus 86 FHICn~~yG~~R-~~edClF 104 (107)
T PF06156_consen 86 FHICNVHYGSRR-NDEDCLF 104 (107)
T ss_pred eeeCcHHhCCcC-CCCCCcc
Confidence 889999998877 6788987
No 9
>COG3657 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=12.25 E-value=63 Score=23.14 Aligned_cols=31 Identities=29% Similarity=0.447 Sum_probs=19.4
Q ss_pred eeeEEEEEEEE-------EecCCCCCCCCCCCCCCCCCC
Q psy14876 5 GSGFFELQILE-------IANYKGELASGICCGGLHRPD 36 (121)
Q Consensus 5 ~sG~FELqL~s-------f~N~~G~l~~G~CC~g~~~~~ 36 (121)
..|+|||+|+. |++. |...-=-+|+|..+++
T Consensus 47 geGV~ELRId~GpGyRvY~~~~-g~v~i~lLCgGdks~q 84 (100)
T COG3657 47 GEGVSELRIDHGPGYRVYFQQR-GLVLILLLCGGDKSTQ 84 (100)
T ss_pred ccchhhheeccCCceEEEEEec-CcEEEEEeccCchhhH
Confidence 46999999963 4443 3333345677776654
No 10
>PF12577 PPARgamma_N: PPAR gamma N-terminal region; InterPro: IPR022590 This domain is found in eukaryotes, and is typically between 42 and 65 amino acids in length. It is found N-terminal to PF00104 from PFAM and PF00105 from PFAM. There are two completely conserved residues (D and Y) that may be functionally important. Peroxisome proliferator-activated receptors (PPAR) are nuclear hormone receptors that control the expression of genes involved in lipid homeostasis in mammals[].
Probab=11.32 E-value=86 Score=21.77 Aligned_cols=11 Identities=27% Similarity=0.214 Sum_probs=9.2
Q ss_pred cccCccEEeee
Q psy14876 99 FRWTFSATGSS 109 (121)
Q Consensus 99 F~WPgsFtl~~ 109 (121)
++||-.|.|.+
T Consensus 7 ~~Wpv~Fgls~ 17 (83)
T PF12577_consen 7 PAWPVGFGLSS 17 (83)
T ss_pred ccccccccccc
Confidence 58999998875
Done!