Diaphorina citri psyllid: psy14876


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MCARGSGFFELQILEIANYKGELASGICCGGLHRPDPSISCPVQCNTLFRVCLKEYQSNVTSNGPCSFGNTSSPVLGGNSFTLTDPDRANGNLVLPFTFRWTFSATGSSSSNIRNQKPTPF
ccccccCEEEEEEEEEEccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccEEccEEECccccEEEEECccccccccccc
***RGSGFFELQILEIANYKGELASGICC*********ISCPVQCNTLFRVCLKEYQSNVTSNGPCSFGNTSSPVLGGNSFTLTDPDRANGNLVLPFTFRWTFSATGSSS***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCARGSGFFELQILEIANYKGELASGICCGGLHRPDPSISCPVQCNTLFRVCLKEYQSNVTSNGPCSFGNTSSPVLGGNSFTLTDPDRANGNLVLPFTFRWTFSATGSSSSNIRNQKPTPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein jagged-1 Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation (By similarity). Enhances fibroblast growth factor-induced angiogenesis (in vitro).confidentP78504
Protein jagged-1 Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation (By similarity). May regulate fibroblast growth factor-induced angiogenesis.confidentQ9QXX0
Protein jagged-1 Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Enhances fibroblast growth factor-induced angiogenesis (in vitro). Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation. May regulate fibroblast growth factor-induced angiogenesis.confidentQ63722

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030673 [CC]axolemmaprobableGO:0044304, GO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0032589, GO:0071944, GO:0043005, GO:0033267, GO:0044464, GO:0005886, GO:0042995, GO:0044459, GO:0044425
GO:0045746 [BP]negative regulation of Notch signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0045747 [BP]positive regulation of Notch signaling pathwayprobableGO:0023051, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0008593, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0045639 [BP]positive regulation of myeloid cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0050789, GO:0045595, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048518, GO:0002682, GO:0045637, GO:0048522
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0048864 [BP]stem cell developmentprobableGO:0032502, GO:0048863, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699, GO:0048856
GO:0045599 [BP]negative regulation of fat cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523, GO:0045598
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007423 [BP]sensory organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0032495 [BP]response to muramyl dipeptideprobableGO:1901700, GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:1901652, GO:0042221, GO:1901698

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted