Query         psy14879
Match_columns 138
No_of_seqs    199 out of 1465
Neff          7.4 
Searched_HMMs 46136
Date          Fri Aug 16 23:08:22 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14879.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14879hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01607 CBM_14:  Chitin bindin  99.5 4.9E-14 1.1E-18   84.1   3.3   47   81-127     7-53  (53)
  2 smart00494 ChtBD2 Chitin-bindi  99.4 1.3E-12 2.8E-17   78.4   5.3   54   72-128     2-55  (56)
  3 KOG2806|consensus               98.5 2.6E-08 5.7E-13   83.2   1.0   42    1-42    378-421 (432)
  4 PF03427 CBM_19:  Carbohydrate   90.4    0.32 6.9E-06   30.1   2.7   21   90-110    35-55  (61)
  5 cd06543 GH18_PF-ChiA-like PF-C  74.1     1.3 2.9E-05   35.4   0.7   21    1-21    246-266 (294)
  6 PF08475 Baculo_VP91_N:  Viral   65.0      10 0.00022   28.5   3.6   45   82-131   106-150 (183)
  7 KOG3517|consensus               53.6      13 0.00028   29.5   2.6   38    7-44     92-130 (334)
  8 cd00064 FU Furin-like repeats.  51.4      14  0.0003   20.9   2.0   17  102-118    32-48  (49)
  9 KOG4701|consensus               49.8     8.9 0.00019   32.4   1.2   15    4-18    280-294 (568)
 10 PF12662 cEGF:  Complement Clr-  35.9      27 0.00059   17.4   1.3   17  104-120     5-21  (24)
 11 PF00220 Hormone_4:  Neurohypop  33.4      21 0.00045   13.7   0.5    6  103-108     4-9   (9)
 12 PF03286 Pox_Ag35:  Pox virus A  31.0      33 0.00072   26.1   1.7   27   13-44      1-27  (200)
 13 PF14468 DUF4427:  Protein of u  30.6      45 0.00097   23.6   2.1   25    7-41     33-57  (132)
 14 PF01826 TIL:  Trypsin Inhibito  29.6      17 0.00036   21.2  -0.1   26   89-121    27-52  (55)
 15 PF09064 Tme5_EGF_like:  Thromb  25.4      55  0.0012   17.8   1.5   14  102-115    19-32  (34)
 16 PHA02151 hypothetical protein   22.5      52  0.0011   24.5   1.3   15    7-22     93-107 (217)
 17 PF04833 COBRA:  COBRA-like pro  20.7      99  0.0022   23.0   2.5   34   85-118    43-82  (169)

No 1  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.46  E-value=4.9e-14  Score=84.11  Aligned_cols=47  Identities=34%  Similarity=0.815  Sum_probs=35.9

Q ss_pred             cccCCCCCCCceeecCCCcEEEeeCCCCceecCCCCccCCCCCCCCC
Q psy14879         81 SYHPDKADCTHYYMCEGERKHHMPCPSNLVFNPKENVCDWPENVETC  127 (138)
Q Consensus        81 g~~~~p~dC~~fy~C~~G~~~~~~Cp~Gl~fn~~~~~Cd~p~~v~~C  127 (138)
                      |+++++.+|++||+|.+|.++.+.||.|++||+..+.|+++++|..|
T Consensus         7 ~~~~~~~~C~~Y~~C~~g~~~~~~C~~g~~fd~~~~~C~~~~~~~~C   53 (53)
T PF01607_consen    7 GFYPHPDDCRKYYQCVNGQAVEQRCPEGLYFDPSSQRCVPPSNVVQC   53 (53)
T ss_dssp             EEE--SS-SSEEEEEETTEEEEEE-TTS-EE-TTTSSEE-TTT-TT-
T ss_pred             eeEeCCCCCCEEEEeeCCcEECCCCcCCCEECcCcCEEcCCccCCCC
Confidence            78999999999999999999999999999999999999999983346


No 2  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=99.37  E-value=1.3e-12  Score=78.36  Aligned_cols=54  Identities=39%  Similarity=0.947  Sum_probs=47.8

Q ss_pred             cCCCCCCcccccCCCCCCCceeecCCCcEEEeeCCCCceecCCCCccCCCCCCCCCC
Q psy14879         72 SCEEEDGHISYHPDKADCTHYYMCEGERKHHMPCPSNLVFNPKENVCDWPENVETCL  128 (138)
Q Consensus        72 ~C~~~~~~~g~~~~p~dC~~fy~C~~G~~~~~~Cp~Gl~fn~~~~~Cd~p~~v~~C~  128 (138)
                      .|....  .|+++++.+|++||+|.+|..+.+.||.|++||...+.|+|+..+. |.
T Consensus         2 ~C~~~~--~g~~~~~~~C~~y~~C~~~~~~~~~C~~g~~f~~~~~~C~~~~~~~-C~   55 (56)
T smart00494        2 ECPGRG--DGLYPHPTDCSKYYQCSNGRPIVGSCPAGLVFDPATQTCDWPDNVG-CG   55 (56)
T ss_pred             cCCCCC--CccccCcccCCeeEEcCCCcEEeccCcCCCeECCCCCCcCCcccCC-CC
Confidence            465532  3799999999999999999999999999999999999999999885 85


No 3  
>KOG2806|consensus
Probab=98.52  E-value=2.6e-08  Score=83.21  Aligned_cols=42  Identities=29%  Similarity=0.593  Sum_probs=36.7

Q ss_pred             CccccccCceeEEEEeccCCCCCCc-cCC-CCCchhHHHHHhhh
Q psy14879          1 MDWLKEDGYGGIMIWSVDMDDFRGQ-CGS-GKYPLISTMNTELE   42 (138)
Q Consensus         1 ~~~~~~~~lgG~m~w~~d~DD~~g~-c~~-~~~pl~~~i~~~l~   42 (138)
                      |+||++++|||+|+|+||+|||+|. |+. ..+|++..+.+.+.
T Consensus       378 ~~Yvk~~~lGGv~iW~vd~DD~~~~~~~~~~~~~~~~~~~~~~~  421 (432)
T KOG2806|consen  378 ADYAKDEGLGGVAIWNIDQDDESGSLLNAALSRPQTCSICLKNH  421 (432)
T ss_pred             HHHHHhcCCceEEEEeccCCCCCCccccccccccceeecccccc
Confidence            5799999999999999999999997 663 68889988887764


No 4  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=90.42  E-value=0.32  Score=30.10  Aligned_cols=21  Identities=19%  Similarity=0.548  Sum_probs=19.2

Q ss_pred             CceeecCCCcEEEeeCCCCce
Q psy14879         90 THYYMCEGERKHHMPCPSNLV  110 (138)
Q Consensus        90 ~~fy~C~~G~~~~~~Cp~Gl~  110 (138)
                      .+|-+|.+|..+.+.||.|+.
T Consensus        35 G~faiC~~G~Wv~~~C~~Gt~   55 (61)
T PF03427_consen   35 GSFAICDHGTWVITPCPAGTT   55 (61)
T ss_pred             CCEEEcCCCcEEEeeCCCCCE
Confidence            379999999999999999986


No 5  
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain.  Members of this domain family are found not only in archaea but also in eukaryotes and prokaryotes. PF-ChiA exhibits hydrolytic activity toward both colloidal and crystalline (beta/alpha) chitins at high temperature.
Probab=74.10  E-value=1.3  Score=35.38  Aligned_cols=21  Identities=38%  Similarity=0.876  Sum_probs=18.9

Q ss_pred             CccccccCceeEEEEeccCCC
Q psy14879          1 MDWLKEDGYGGIMIWSVDMDD   21 (138)
Q Consensus         1 ~~~~~~~~lgG~m~w~~d~DD   21 (138)
                      ++|++++|||++-+|+++-|-
T Consensus       246 ~~fA~~~~l~~~s~Ws~~RD~  266 (294)
T cd06543         246 VDFAKEKGLGRLSMWSLNRDR  266 (294)
T ss_pred             HHHHHhCCCCeEeeeeccCCC
Confidence            369999999999999999875


No 6  
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=64.96  E-value=10  Score=28.55  Aligned_cols=45  Identities=22%  Similarity=0.352  Sum_probs=35.8

Q ss_pred             ccCCCCCCCceeecCCCcEEEeeCCCCceecCCCCccCCCCCCCCCCCCC
Q psy14879         82 YHPDKADCTHYYMCEGERKHHMPCPSNLVFNPKENVCDWPENVETCLHHT  131 (138)
Q Consensus        82 ~~~~p~dC~~fy~C~~G~~~~~~Cp~Gl~fn~~~~~Cd~p~~v~~C~~~~  131 (138)
                      .-+++.|=++|..=.+.....+.||.+..||..  .|.-..   -|...+
T Consensus       106 V~~~~~d~~kF~~~~DDGwv~~~CP~~~~FD~~--~Cvp~p---~C~~~~  150 (183)
T PF08475_consen  106 VRPHPNDPTKFIARGDDGWVDMDCPENERFDGN--KCVPIP---PCDNKP  150 (183)
T ss_pred             eecCCCCCceEEEEecCCcEEEeCCCccccccc--ceeecC---ccCCCC
Confidence            346788999999887667999999999999988  888642   385543


No 7  
>KOG3517|consensus
Probab=53.56  E-value=13  Score=29.53  Aligned_cols=38  Identities=21%  Similarity=0.358  Sum_probs=28.2

Q ss_pred             cCceeEEEEecc-CCCCCCccCCCCCchhHHHHHhhhcc
Q psy14879          7 DGYGGIMIWSVD-MDDFRGQCGSGKYPLISTMNTELEDY   44 (138)
Q Consensus         7 ~~lgG~m~w~~d-~DD~~g~c~~~~~pl~~~i~~~l~~~   44 (138)
                      ++=-||++|+|- -==-.|+|....-|-.+.|.+.|++.
T Consensus        92 q~DPGIFAWEIRDRLlsdgiCDk~NvPSVSSISRILRNK  130 (334)
T KOG3517|consen   92 QRDPGIFAWEIRDRLLSDGICDKYNVPSVSSISRILRNK  130 (334)
T ss_pred             ccCCceeeehhhhhhhhcccccccCCcchHHHHHHHHhh
Confidence            344699999993 22223589888889999999999764


No 8  
>cd00064 FU Furin-like repeats. Cysteine rich region. Exact function of the domain is not known. Furin is a serine-kinase dependent proprotein processor. Other members of this family include endoproteases and cell surface receptors.
Probab=51.39  E-value=14  Score=20.94  Aligned_cols=17  Identities=24%  Similarity=0.571  Sum_probs=12.8

Q ss_pred             EeeCCCCceecCCCCcc
Q psy14879        102 HMPCPSNLVFNPKENVC  118 (138)
Q Consensus       102 ~~~Cp~Gl~fn~~~~~C  118 (138)
                      +..||.+.+++.....|
T Consensus        32 v~~C~~~~~~~~~~~~C   48 (49)
T cd00064          32 VSECPEGTYADTEGGVC   48 (49)
T ss_pred             cccCCCCceecCcCCcC
Confidence            34799999998666655


No 9  
>KOG4701|consensus
Probab=49.80  E-value=8.9  Score=32.36  Aligned_cols=15  Identities=20%  Similarity=0.760  Sum_probs=12.5

Q ss_pred             ccccCceeEEEEecc
Q psy14879          4 LKEDGYGGIMIWSVD   18 (138)
Q Consensus         4 ~~~~~lgG~m~w~~d   18 (138)
                      +++..|||||.|+..
T Consensus       280 a~S~~fGGv~LWd~s  294 (568)
T KOG4701|consen  280 ANSTLFGGVTLWDTS  294 (568)
T ss_pred             hhccccccEEEeech
Confidence            467789999999983


No 10 
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=35.91  E-value=27  Score=17.36  Aligned_cols=17  Identities=24%  Similarity=0.732  Sum_probs=13.4

Q ss_pred             eCCCCceecCCCCccCC
Q psy14879        104 PCPSNLVFNPKENVCDW  120 (138)
Q Consensus       104 ~Cp~Gl~fn~~~~~Cd~  120 (138)
                      .|++|+..++....|.-
T Consensus         5 ~C~~Gy~l~~d~~~C~D   21 (24)
T PF12662_consen    5 SCPPGYQLSPDGRSCED   21 (24)
T ss_pred             eCCCCCcCCCCCCcccc
Confidence            58999888887777754


No 11 
>PF00220 Hormone_4:  Neurohypophysial hormones, N-terminal Domain;  InterPro: IPR022423 Oxytocin (or ocytocin) and vasopressin [] are small (nine amino acid residues), structurally and functionally related neurohypophysial peptide hormones. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland while vasopressin has a direct antidiuretic action on the kidney and also causes vasoconstriction of the peripheral vessels. Like the majority of active peptides, both hormones are synthesized as larger protein precursors that are enzymatically converted to their mature forms. Peptides belonging to this family are also found in birds, fish, reptiles and amphibians (mesotocin, isotocin, valitocin, glumitocin, aspargtocin, vasotocin, seritocin, asvatocin, phasvatocin), in worms (annetocin), octopi (cephalotocin), locust (locupressin or neuropeptide F1/F2) and in molluscs (conopressins G and S) [].  The pattern developed to detect this category of peptides spans their entire sequence and includes four invariant amino acid residues.  .; GO: 0005185 neurohypophyseal hormone activity, 0005576 extracellular region
Probab=33.44  E-value=21  Score=13.72  Aligned_cols=6  Identities=33%  Similarity=0.839  Sum_probs=3.1

Q ss_pred             eeCCCC
Q psy14879        103 MPCPSN  108 (138)
Q Consensus       103 ~~Cp~G  108 (138)
                      .+||-|
T Consensus         4 ~nCP~G    9 (9)
T PF00220_consen    4 RNCPIG    9 (9)
T ss_pred             ccCCCC
Confidence            456644


No 12 
>PF03286 Pox_Ag35:  Pox virus Ag35 surface protein;  InterPro: IPR004966 The Pox virus Ag35 surface protein is an evelope protein known as protein H5.; GO: 0019031 viral envelope
Probab=30.99  E-value=33  Score=26.12  Aligned_cols=27  Identities=26%  Similarity=0.677  Sum_probs=21.3

Q ss_pred             EEEeccCCCCCCccCCCCCchhHHHHHhhhcc
Q psy14879         13 MIWSVDMDDFRGQCGSGKYPLISTMNTELEDY   44 (138)
Q Consensus        13 m~w~~d~DD~~g~c~~~~~pl~~~i~~~l~~~   44 (138)
                      |.|+|.+    |.||. .|-=|..|++.|...
T Consensus         1 MsWs~~~----~~~~~-~f~tl~eiR~hlrs~   27 (200)
T PF03286_consen    1 MSWSINL----GNGGS-NFKTLEEIRAHLRST   27 (200)
T ss_pred             CceeEec----CCCCc-cceeHHHHHHHHhhh
Confidence            8999997    35665 788899999999653


No 13 
>PF14468 DUF4427:  Protein of unknown function (DUF4427)
Probab=30.65  E-value=45  Score=23.59  Aligned_cols=25  Identities=12%  Similarity=0.335  Sum_probs=19.6

Q ss_pred             cCceeEEEEeccCCCCCCccCCCCCchhHHHHHhh
Q psy14879          7 DGYGGIMIWSVDMDDFRGQCGSGKYPLISTMNTEL   41 (138)
Q Consensus         7 ~~lgG~m~w~~d~DD~~g~c~~~~~pl~~~i~~~l   41 (138)
                      .++||+.+|-.|.          ..++.+++-+.-
T Consensus        33 ~e~G~~wvWi~DN----------~~~~vRALl~~g   57 (132)
T PF14468_consen   33 REFGNAWVWIHDN----------QSEVVRALLQAG   57 (132)
T ss_pred             hhcCceEEEEecC----------cCHHHHHHHHcC
Confidence            4679999999986          578888776653


No 14 
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=29.64  E-value=17  Score=21.16  Aligned_cols=26  Identities=31%  Similarity=0.575  Sum_probs=17.7

Q ss_pred             CCceeecCCCcEEEeeCCCCceecCCCCccCCC
Q psy14879         89 CTHYYMCEGERKHHMPCPSNLVFNPKENVCDWP  121 (138)
Q Consensus        89 C~~fy~C~~G~~~~~~Cp~Gl~fn~~~~~Cd~p  121 (138)
                      |.  ..|..|    =.|+.|++++.. ..|..+
T Consensus        27 C~--~~C~~g----C~C~~G~v~~~~-~~CV~~   52 (55)
T PF01826_consen   27 CS--EPCVEG----CFCPPGYVRNDN-GRCVPP   52 (55)
T ss_dssp             CS--SS-ESE----EEETTTEEEETT-SEEEEG
T ss_pred             cC--CCCCcc----CCCCCCeeEcCC-CCEEcH
Confidence            55  345554    459999999988 777654


No 15 
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=25.41  E-value=55  Score=17.79  Aligned_cols=14  Identities=14%  Similarity=0.527  Sum_probs=10.7

Q ss_pred             EeeCCCCceecCCC
Q psy14879        102 HMPCPSNLVFNPKE  115 (138)
Q Consensus       102 ~~~Cp~Gl~fn~~~  115 (138)
                      .=.||+|++.++..
T Consensus        19 ~C~CPeGyIlde~~   32 (34)
T PF09064_consen   19 QCFCPEGYILDEGS   32 (34)
T ss_pred             ceeCCCceEecCCc
Confidence            44699999988764


No 16 
>PHA02151 hypothetical protein
Probab=22.50  E-value=52  Score=24.46  Aligned_cols=15  Identities=47%  Similarity=0.993  Sum_probs=11.7

Q ss_pred             cCceeEEEEeccCCCC
Q psy14879          7 DGYGGIMIWSVDMDDF   22 (138)
Q Consensus         7 ~~lgG~m~w~~d~DD~   22 (138)
                      -||-|+|-| ||.||.
T Consensus        93 gg~~gv~dw-ldnd~i  107 (217)
T PHA02151         93 GGLTGVMDW-LDNDDI  107 (217)
T ss_pred             ccceeeeee-ecCCce
Confidence            578899999 577775


No 17 
>PF04833 COBRA:  COBRA-like protein;  InterPro: IPR006918 In Arabidopsis thaliana (Mouse-ear cress) members of the family are all extracellular glycosyl-phosphatidyl inositol-anchored proteins (GPI-linked) []. The type example of the family is COBRA (Q94KT8 from SWISSPROT) and the family is generally annotated as COBRA-like (COBL). COBRA is involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition. It may act by recruiting cellulose synthesizing complexes to discrete positions on the cell surface. Some members of this family are annotated as phytochelatin synthase, but these annotations are incorrect [].
Probab=20.67  E-value=99  Score=22.96  Aligned_cols=34  Identities=26%  Similarity=0.674  Sum_probs=21.5

Q ss_pred             CCCCCCcee------ecCCCcEEEeeCCCCceecCCCCcc
Q psy14879         85 DKADCTHYY------MCEGERKHHMPCPSNLVFNPKENVC  118 (138)
Q Consensus        85 ~p~dC~~fy------~C~~G~~~~~~Cp~Gl~fn~~~~~C  118 (138)
                      +..||++||      +|=.-.+...+=|.|.-+|.....|
T Consensus        43 dqgdCs~~~~~~~~ph~C~k~P~IvDLpp~~~~n~qi~nC   82 (169)
T PF04833_consen   43 DQGDCSKFYKDGDFPHCCKKRPTIVDLPPGTPYNQQIGNC   82 (169)
T ss_pred             cCCcccccccCCCCCcccCCCCEEEeCCCCCCCccccccc
Confidence            456777777      4444455566667888888775544


Done!