Diaphorina citri psyllid: psy14880

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------

MSSFDDYIQLWAHFQNKAAASLDEAVGHNRTKLIVWSSHLTDPEIILNYLDPQTCGTQQVVREPLLLVTLMALCRWQMCTRQQVPCLLPRFGAYSPAKVYTPLEVQELVHYAKLRGVRVIFELDAPAHAGNGWQWGPRFGAYSPAKVYTPLEVQELVHYAKLRGIRVIFELDAPAHAGNGWQWGPRYGLGDLIVCLNDPSWRANCIQPPCGQLNPINPHVYTVLKDIYGELMGMAKYGDEMFHMGADELVTLMALCRWQMCTRQQVPCVQPISGVDHLSPHLWTVFIKCWNNTPAIVDFMLAHGKNTTFDDYIQLWAHFQNKAAASLDEAVGHNRTKLIVWSSHLTDPEIILNYLDPKRYIIQTWVPRIDPLADLLISKGYQVIISTKDAWYLDHGFWGVTSYYRWQRVYDNLLPSSPLVLGGEVAMWTEYVDDQSLDGRLWPRTAAAAERLWSNPKSSSSEAETRFLEQRERLVEMGIRAEVTTPEWCYLNDGQCR

cccHHHHHHHHHHHccccEEEcccccccccccEEEccccccccHHHHHccccccccccccccHHHHHHHHHcEEEEEcccccccccccccccccccccccccccHHHHHHHHHccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHcccccccccccccccccccccccccEEcccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHcccccccEEEEEccccccHHHHHHHHccccEEEccccccccccccccccccccccccccccccccccEEEEEECccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccc

****DDYIQLWAHFQNKAAASLDEAVGHNRTKLIVWSSHLTDPEIILNYLDPQTCGTQQVVREPLLLVTLMALCRWQMCTRQQVPCLLPRFGAYSPAKVYTPLEVQELVHYAKLRGVRVIFELDAPAHAGNGWQWGPRFGAYSPAKVYTPLEVQELVHYAKLRGIRVIFELDAPAHAGNGWQWGPRYGLGDLIVCLNDPSWRANCIQPPCGQLNPINPHVYTVLKDIYGELMGMAKYGDEMFHMGADELVTLMALCRWQMCTRQQVPCVQPISGVDHLSPHLWTVFIKCWNNTPAIVDFMLAHGKNTTFDDYIQLWAHFQNKAAASLDEAVGHNRTKLIVWSSHLTDPEIILNYLDPKRYIIQTWVPRIDPLADLLISKGYQVIISTKDAWYLDHGFWGVTSYYRWQRVYDNLLPSSPLVLGGEVAMWTEYVDDQSLDGRLWPRTAAAAERLWSNPKSSSSEAETRFLEQRERLVEMGIRAEVTTPEWCYLN*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016231 [MF]	beta-N-acetylglucosaminidase activity	probable	GO:0016787, GO:0016798, GO:0015929, GO:0003824, GO:0004563, GO:0003674, GO:0004553
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OZO, chain A
Confidence level:very confident
Coverage over the Query: 4-57,71-93,108-110,139-248,285-497
View the alignment between query and template
View the model in PyMOL

Template: 3RCN, chain A
Confidence level:very confident
Coverage over the Query: 4-57,71-92,107-248,285-343,355-485
View the alignment between query and template
View the model in PyMOL

Template: 1C7S, chain A
Confidence level:very confident
Coverage over the Query: 4-57,71-92,107-492
View the alignment between query and template
View the model in PyMOL