Diaphorina citri psyllid: psy14892


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
LHCVKAGPELSNKLSHLIQLHYDLASTTVTGIPMKEEQNANSSANYDVEIFHPSEVHAALLKGSQEFPYRAAELHCVKAGPELSNKLSHLIQMHYDLASTTVTGIPMKEEQNANSSANYDVEIFHPSEVHAALLK
ccccccccHHHHHHHHHHHHHHccccCEECcccccHHccccccccCEEEEECcHHHHHHHHcccccccccEEEEEEECcccccHHHHHHHHHHHcccccEEECcccccccccccccccccEEccccHHHHHHHHc
*******PELSNKLSHLIQLHYDLASTTVTGIPM**********NYDVEIFHPSEVHAALLKGSQEFPYRAAELHCVKAGPELSNKLSHLIQMHYDLASTTVTGI***************VEIFHPSE*****L*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LHCVKAGPELSNKLSHLIQLHYDLASTTVTGIPMKEEQNANSSANYDVEIFHPSEVHAALLKGSQEFPYRAAELHCVKAGPELSNKLSHLIQMHYDLASTTVTGIPMKEEQNANSSANYDVEIFHPSEVHAALLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein asunder homolog Crucial regulator of the mitotic cell cycle and development.confidentQ8QZV7
Protein asunder homolog Crucial regulator of the mitotic cell cycle and development.confidentQ9NVM9
Protein asunder Plays a role as a regulator of spermatogenesis. Crucial regulator of the mitotic cell cycle and development. Required for the correct dynein-dynactin perinuclear localization important for nucleus-centrosome coupling that occur upon meiotic progression of primary spermatocytes. Crucial regulator of the mitotic cell cycle and development. Plays a role in sperm motility and fertility. May have a role in the PNG/PLU/GNU pathway.confidentQ9VEX5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007346 [BP]regulation of mitotic cell cycleprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted