Query         psy149
Match_columns 86
No_of_seqs    101 out of 193
Neff          5.1 
Searched_HMMs 46136
Date          Fri Aug 16 23:39:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy149.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/149hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1625|consensus               99.9 1.4E-26 3.1E-31  189.0   8.3   76   10-85    343-418 (600)
  2 COG5214 POL12 DNA polymerase a  99.9 1.1E-21 2.4E-26  157.8   7.7   81    2-82    299-383 (581)
  3 PF04042 DNA_pol_E_B:  DNA poly  99.6 3.2E-16 6.9E-21  110.9   1.9   73   10-82      1-76  (209)
  4 PF10686 DUF2493:  Protein of u  89.2     1.3 2.7E-05   27.5   4.7   38    6-47      2-39  (71)
  5 PRK11340 phosphodiesterase Yae  88.6     1.4 3.1E-05   32.7   5.5   48    6-54     48-95  (271)
  6 PRK04036 DNA polymerase II sma  88.5     1.1 2.3E-05   36.7   5.2   50    5-54    241-299 (504)
  7 COG5493 Uncharacterized conser  87.7    0.53 1.1E-05   35.6   2.7   29   28-56    184-212 (231)
  8 PRK03170 dihydrodipicolinate s  86.3    0.99 2.1E-05   33.7   3.5   37   12-48      8-44  (292)
  9 cd00950 DHDPS Dihydrodipicolin  85.1     1.2 2.7E-05   32.9   3.5   37   12-48      7-43  (284)
 10 cd00408 DHDPS-like Dihydrodipi  84.4     1.4   3E-05   32.4   3.5   34   14-47      6-39  (281)
 11 TIGR00619 sbcd exonuclease Sbc  84.1     1.5 3.3E-05   32.4   3.7   32   25-56     25-56  (253)
 12 PRK03620 5-dehydro-4-deoxygluc  83.6     1.5 3.3E-05   33.2   3.5   37   11-47     13-49  (303)
 13 PLN02417 dihydrodipicolinate s  83.4     1.6 3.4E-05   32.8   3.5   35   14-48     10-44  (280)
 14 cd00951 KDGDH 5-dehydro-4-deox  83.3     1.6 3.4E-05   32.8   3.5   34   14-47      9-42  (289)
 15 cd07385 MPP_YkuE_C Bacillus su  83.2     3.1 6.8E-05   28.9   4.8   47    8-55      2-48  (223)
 16 TIGR03249 KdgD 5-dehydro-4-deo  82.2     1.9   4E-05   32.5   3.5   34   14-47     14-47  (296)
 17 cd00954 NAL N-Acetylneuraminic  81.7       2 4.3E-05   32.2   3.5   34   15-48     10-44  (288)
 18 PRK04147 N-acetylneuraminate l  81.5     2.1 4.5E-05   32.2   3.5   36   12-47     10-46  (293)
 19 cd07401 MPP_TMEM62_N Homo sapi  81.2     4.3 9.3E-05   29.9   5.1   28   28-55     22-49  (256)
 20 TIGR02313 HpaI-NOT-DapA 2,4-di  80.4     2.3   5E-05   32.2   3.4   34   14-47      9-42  (294)
 21 TIGR00683 nanA N-acetylneurami  80.0     2.4 5.3E-05   32.0   3.5   33   15-47     10-43  (290)
 22 PF00701 DHDPS:  Dihydrodipicol  79.9     1.8 3.8E-05   32.2   2.7   38   11-48      7-44  (289)
 23 COG0329 DapA Dihydrodipicolina  79.3     2.6 5.7E-05   32.2   3.5   45   15-69     14-59  (299)
 24 TIGR00674 dapA dihydrodipicoli  77.8     3.2 6.9E-05   31.0   3.5   34   14-47      7-40  (285)
 25 PF07788 DUF1626:  Protein of u  76.6     2.8   6E-05   26.4   2.4   29   25-53     31-59  (70)
 26 cd07366 3MGA_Dioxygenase Subun  76.5     2.4 5.1E-05   33.3   2.6   31   26-56     73-108 (328)
 27 TIGR00583 mre11 DNA repair pro  76.5     2.8 6.2E-05   33.7   3.1   34   25-58     28-61  (405)
 28 PF06838 Met_gamma_lyase:  Meth  76.1     2.5 5.4E-05   34.5   2.6   44   13-56    162-209 (403)
 29 cd00953 KDG_aldolase KDG (2-ke  75.9     3.5 7.6E-05   30.9   3.3   32   15-47     10-41  (279)
 30 cd07365 MhpB_like Subunit B of  75.8     2.6 5.7E-05   32.7   2.7   22   28-49     31-52  (310)
 31 PRK10966 exonuclease subunit S  75.6     3.8 8.3E-05   32.7   3.6   29   28-56     28-56  (407)
 32 PRK13363 protocatechuate 4,5-d  74.8     3.3 7.3E-05   32.6   3.0   22   27-48     76-97  (335)
 33 PHA02546 47 endonuclease subun  74.5     4.6 9.9E-05   31.1   3.7   29   26-54     26-54  (340)
 34 COG0420 SbcD DNA repair exonuc  73.9     3.7   8E-05   31.7   3.0   35   24-58     25-59  (390)
 35 cd00840 MPP_Mre11_N Mre11 nucl  73.0       5 0.00011   27.6   3.2   30   25-54     27-56  (223)
 36 PF03808 Glyco_tran_WecB:  Glyc  71.8     8.6 0.00019   26.8   4.3   33    7-45     74-107 (172)
 37 cd02071 MM_CoA_mut_B12_BD meth  71.6     7.9 0.00017   25.4   3.8   23   25-47     36-58  (122)
 38 COG2350 Uncharacterized protei  71.2     5.1 0.00011   26.2   2.8   28   42-71     36-67  (92)
 39 TIGR00696 wecB_tagA_cpsF bacte  71.2     8.2 0.00018   27.5   4.1   33    7-45     74-106 (177)
 40 cd06533 Glyco_transf_WecG_TagA  71.1     8.5 0.00018   26.9   4.1   33    7-45     72-105 (171)
 41 CHL00073 chlN photochlorophyll  70.7     5.2 0.00011   32.8   3.3   33   27-62    379-411 (457)
 42 cd07359 PCA_45_Doxase_B_like S  69.9     5.5 0.00012   29.5   3.1   23   26-48     31-53  (271)
 43 PRK13370 mhpB 3-(2,3-dihydroxy  69.2     4.6 9.9E-05   31.4   2.6   23   26-48     29-51  (313)
 44 PF02310 B12-binding:  B12 bind  69.0     5.9 0.00013   25.0   2.7   22   25-46     65-86  (121)
 45 cd07368 PhnC_Bs_like PhnC is a  68.8     5.9 0.00013   29.9   3.1   22   26-47     33-54  (277)
 46 cd07386 MPP_DNA_pol_II_small_a  67.3     8.1 0.00018   27.9   3.5   28   26-53     17-49  (243)
 47 PF08660 Alg14:  Oligosaccharid  67.1     6.5 0.00014   27.8   2.8   16   33-48     86-101 (170)
 48 PRK13373 putative dioxygenase;  66.3     5.4 0.00012   31.9   2.5   23   26-48     33-55  (344)
 49 PF08759 DUF1792:  Domain of un  66.2     6.1 0.00013   29.9   2.6   25   24-48    151-177 (225)
 50 PRK13364 protocatechuate 4,5-d  66.2     5.9 0.00013   30.3   2.6   23   25-47     34-56  (278)
 51 PRK13358 protocatechuate 4,5-d  65.9       6 0.00013   29.4   2.6   23   26-48     29-51  (269)
 52 cd00952 CHBPH_aldolase Trans-o  65.8     8.2 0.00018   29.4   3.4   33   15-47     11-50  (309)
 53 TIGR00215 lpxB lipid-A-disacch  65.7     7.8 0.00017   30.1   3.3   22   30-52     80-101 (385)
 54 cd07400 MPP_YydB Bacillus subt  64.8     9.7 0.00021   24.7   3.2   27   28-54     24-50  (144)
 55 cd00842 MPP_ASMase acid sphing  64.2     8.7 0.00019   28.3   3.2   43   12-54     38-83  (296)
 56 PTZ00235 DNA polymerase epsilo  63.6      17 0.00037   28.4   4.8   64    8-74     28-96  (291)
 57 cd07320 Extradiol_Dioxygenase_  63.1     8.7 0.00019   27.9   3.0   25   27-51     25-49  (260)
 58 COG1409 Icc Predicted phosphoh  62.3       8 0.00017   27.3   2.6   27   21-47     15-41  (301)
 59 cd02067 B12-binding B12 bindin  61.7     8.3 0.00018   24.7   2.4   20   24-43     63-83  (119)
 60 cd07951 ED_3B_N_AMMECR1 The N-  61.6      10 0.00022   27.7   3.1   21   28-48     27-47  (256)
 61 cd07950 Gallate_Doxase_N The N  61.5       8 0.00017   29.4   2.6   23   25-47     34-56  (277)
 62 PF14582 Metallophos_3:  Metall  61.5     6.4 0.00014   30.4   2.1   41    7-52      5-45  (255)
 63 PRK09453 phosphodiesterase; Pr  61.0      11 0.00024   25.9   3.0   30   23-52     11-40  (182)
 64 PF02900 LigB:  Catalytic LigB   60.4       7 0.00015   28.8   2.1   25   28-52     30-54  (272)
 65 PF14359 DUF4406:  Domain of un  60.3      32 0.00069   22.1   4.9   56   13-78      3-58  (92)
 66 COG0707 MurG UDP-N-acetylgluco  60.2      14 0.00031   29.1   3.8   42   11-52     55-104 (357)
 67 PRK13365 protocatechuate 4,5-d  59.9     8.9 0.00019   29.2   2.6   23   26-48     35-57  (279)
 68 PHA02729 hypothetical protein;  59.8      11 0.00025   24.9   2.8   37   17-56     38-77  (94)
 69 PRK11439 pphA serine/threonine  59.7     7.8 0.00017   27.8   2.2   31   23-53     27-58  (218)
 70 TIGR03728 glyco_access_1 glyco  59.1     8.9 0.00019   29.8   2.5   26   24-49    169-196 (265)
 71 cd07949 PCA_45_Doxase_B_like_1  59.1      10 0.00022   28.8   2.8   24   25-48     34-57  (276)
 72 PRK13609 diacylglycerol glucos  59.0     8.8 0.00019   28.9   2.4   22   29-50     94-115 (380)
 73 cd07395 MPP_CSTP1 Homo sapiens  58.3      38 0.00082   24.4   5.6   48    6-53      3-63  (262)
 74 TIGR00640 acid_CoA_mut_C methy  57.7      32  0.0007   23.3   4.9   49   17-79     31-79  (132)
 75 TIGR03568 NeuC_NnaA UDP-N-acet  57.6      28  0.0006   26.9   5.0   51   28-78     82-145 (365)
 76 cd07364 PCA_45_Dioxygenase_B S  57.2      11 0.00023   28.7   2.7   34   25-58     34-72  (277)
 77 cd00144 MPP_PPP_family phospho  57.1      10 0.00022   26.4   2.3   31   24-54      9-39  (225)
 78 cd07410 MPP_CpdB_N Escherichia  57.1      18 0.00039   26.5   3.8   32   22-53     26-58  (277)
 79 cd08165 MPP_MPPE1 human MPPE1   56.9      14 0.00031   25.3   3.0   28   27-54     26-53  (156)
 80 PRK03692 putative UDP-N-acetyl  56.9      20 0.00044   26.8   4.0   33    7-45    130-163 (243)
 81 cd07402 MPP_GpdQ Enterobacter   56.9      16 0.00034   25.7   3.3   30   25-54     24-55  (240)
 82 PRK13367 protocatechuate 4,5-d  56.0      11 0.00023   30.9   2.6   19   30-48     39-57  (420)
 83 PRK13366 protocatechuate 4,5-d  55.9      11 0.00024   28.9   2.6   34   25-58     34-72  (284)
 84 cd07391 MPP_PF1019 Pyrococcus   55.8      19 0.00041   24.6   3.5   29   26-54     28-56  (172)
 85 TIGR03729 acc_ester putative p  55.7      16 0.00034   26.2   3.2   25   28-52     21-45  (239)
 86 PRK10878 hypothetical protein;  55.7     0.9   2E-05   28.6  -2.9   16   44-59      6-21  (72)
 87 cd02067 B12-binding B12 bindin  55.5      18 0.00038   23.1   3.1   21   26-46     37-57  (119)
 88 cd07396 MPP_Nbla03831 Homo sap  55.3      11 0.00024   27.7   2.4   30   25-54     26-55  (267)
 89 COG1423 ATP-dependent DNA liga  55.0      17 0.00038   29.5   3.6   50    2-58     95-157 (382)
 90 COG1922 WecG Teichoic acid bio  54.6      22 0.00048   27.2   4.0   32    8-45    135-167 (253)
 91 cd01829 SGNH_hydrolase_peri2 S  54.5      64  0.0014   21.7   7.1   55   28-82     48-105 (200)
 92 PRK13372 pcmA protocatechuate   54.1      12 0.00026   30.9   2.6   16   33-48    189-204 (444)
 93 cd07367 CarBb CarBb is the B s  53.9      13 0.00028   27.9   2.6   23   26-48     29-51  (268)
 94 PF13778 DUF4174:  Domain of un  53.9      62  0.0013   21.4   6.6   61    3-73     39-108 (118)
 95 PHA02239 putative protein phos  53.1      16 0.00035   27.0   3.0   29   24-52     12-42  (235)
 96 cd07392 MPP_PAE1087 Pyrobaculu  52.5      18 0.00039   24.0   2.9   29   24-54     10-38  (188)
 97 PRK00166 apaH diadenosine tetr  51.6      14 0.00031   28.0   2.5   30   24-53     12-42  (275)
 98 PRK13608 diacylglycerol glucos  51.5      15 0.00032   28.3   2.6   22   29-50     94-115 (391)
 99 cd00838 MPP_superfamily metall  51.3      32 0.00069   20.6   3.7   23   33-55     20-42  (131)
100 cd07373 2A5CPDO_A The alpha su  51.2      22 0.00048   26.6   3.5   26   26-51     29-54  (271)
101 PF14606 Lipase_GDSL_3:  GDSL-l  51.0      33 0.00071   24.9   4.2   69    9-81     62-131 (178)
102 COG1889 NOP1 Fibrillarin-like   50.9      47   0.001   25.4   5.1   29   23-55    108-136 (231)
103 PF05582 Peptidase_U57:  YabG p  50.7      17 0.00037   28.5   2.8   17   31-47    146-162 (287)
104 cd07383 MPP_Dcr2 Saccharomyces  50.6      59  0.0013   22.5   5.4   30   26-55     28-57  (199)
105 PF01973 MAF_flag10:  Protein o  50.2      25 0.00055   23.9   3.4    9    8-16     26-34  (170)
106 KOG0338|consensus               50.2      16 0.00036   31.5   2.9   51   33-83    296-357 (691)
107 PF08261 Carcinustatin:  Carcin  49.8     6.8 0.00015   15.2   0.3    6   14-19      1-6   (8)
108 PRK15118 universal stress glob  49.7      22 0.00047   22.9   2.9   21   25-45     89-109 (144)
109 COG2039 Pcp Pyrrolidone-carbox  49.3      18 0.00038   27.2   2.6   23   26-48     47-69  (207)
110 KOG3861|consensus               49.1      19 0.00042   29.3   3.0   39    6-48     51-89  (438)
111 TIGR01551 major_capsid_P2 phag  48.9      25 0.00054   28.0   3.6   47   13-59    179-236 (327)
112 TIGR02855 spore_yabG sporulati  48.8      18  0.0004   28.3   2.8   18   30-47    144-161 (283)
113 cd07422 MPP_ApaH Escherichia c  48.4      17 0.00036   27.4   2.4   30   24-53     10-40  (257)
114 cd07362 HPCD_like Class III ex  48.2      22 0.00047   26.8   3.0   24   25-48     29-52  (272)
115 cd07393 MPP_DR1119 Deinococcus  47.8      22 0.00048   25.6   2.9   26   27-52     27-54  (232)
116 KOG2852|consensus               47.5      11 0.00024   30.4   1.4   13    8-20    198-210 (380)
117 cd07372 2A5CPDO_B The beta sub  47.5      23  0.0005   27.2   3.1   24   26-49     37-60  (294)
118 PF02684 LpxB:  Lipid-A-disacch  47.3      21 0.00045   28.5   2.9   19   28-46     71-89  (373)
119 TIGR00668 apaH bis(5'-nucleosy  46.9      19 0.00042   27.8   2.6   30   24-53     12-42  (279)
120 cd07388 MPP_Tt1561 Thermus the  46.7      24 0.00051   26.1   3.0   42    7-53      4-45  (224)
121 KOG3818|consensus               46.5      13 0.00029   31.2   1.8   30   24-53    298-327 (525)
122 cd07361 MEMO_like Memo (mediat  46.0      17 0.00036   26.9   2.1   13   36-48     61-73  (266)
123 cd07370 HPCD The Class III ext  46.0      12 0.00026   28.0   1.4   25   26-50     32-56  (280)
124 cd01830 XynE_like SGNH_hydrola  45.8      80  0.0017   21.7   5.4   54   28-82     62-116 (204)
125 PF00149 Metallophos:  Calcineu  45.8      46 0.00099   19.9   3.8   29   28-56     20-48  (200)
126 PRK03881 hypothetical protein;  45.8      23 0.00051   28.7   3.1   23   26-48     32-54  (467)
127 cd07384 MPP_Cdc1_like Saccharo  45.2      33 0.00071   23.8   3.4   28   28-55     34-61  (171)
128 PF10996 Beta-Casp:  Beta-Casp   44.9      39 0.00085   21.5   3.5   35    9-48     82-116 (126)
129 PF12850 Metallophos_2:  Calcin  44.7      24 0.00053   22.6   2.5   26   24-51     12-37  (156)
130 cd07425 MPP_Shelphs Shewanella  44.6      21 0.00045   25.6   2.4   30   24-53      9-46  (208)
131 PRK09982 universal stress prot  44.2      69  0.0015   20.9   4.7   20   26-45     90-109 (142)
132 cd07369 PydA_Rs_like PydA is a  43.8      22 0.00048   27.9   2.6   23   25-47     32-54  (329)
133 COG1091 RfbD dTDP-4-dehydrorha  43.7      36 0.00078   26.4   3.7   37   18-54     29-65  (281)
134 TIGR01133 murG undecaprenyldip  43.5      30 0.00064   25.2   3.1   21   30-50     81-101 (348)
135 cd07424 MPP_PrpA_PrpB PrpA and  43.3      23 0.00049   25.0   2.4   30   24-53     12-42  (207)
136 TIGR01763 MalateDH_bact malate  43.1      30 0.00066   26.3   3.2   36   10-45     73-115 (305)
137 PRK13195 pyrrolidone-carboxyla  43.0      27 0.00058   26.1   2.8   27   28-54     50-76  (222)
138 cd08166 MPP_Cdc1_like_1 unchar  43.0      31 0.00068   25.2   3.1   24   31-54     34-57  (195)
139 PRK10116 universal stress prot  42.9      33 0.00071   21.9   2.9   20   26-45     89-108 (142)
140 KOG1257|consensus               42.6      25 0.00054   30.1   2.8   21   25-45    375-395 (582)
141 PF06925 MGDG_synth:  Monogalac  42.2      32 0.00069   23.4   2.9   22   28-49     78-99  (169)
142 PRK13193 pyrrolidone-carboxyla  42.2      26 0.00057   25.7   2.6   32   23-54     43-75  (209)
143 COG1408 Predicted phosphohydro  41.9      37 0.00079   26.0   3.4   27   26-52     60-86  (284)
144 cd00844 MPP_Dbr1_N Dbr1 RNA la  41.8      64  0.0014   24.3   4.7   48    5-55     26-84  (262)
145 COG1880 CdhB CO dehydrogenase/  41.4      42 0.00092   24.5   3.5   42   11-52     66-121 (170)
146 PF00582 Usp:  Universal stress  41.4      43 0.00092   20.1   3.2   21   26-46     89-109 (140)
147 PF05036 SPOR:  Sporulation rel  41.4      49  0.0011   18.7   3.3   28   12-44     46-74  (76)
148 COG0803 LraI ABC-type metal io  41.1      44 0.00095   25.4   3.8   54   24-77     38-103 (303)
149 PF03167 UDG:  Uracil DNA glyco  40.8      52  0.0011   20.9   3.6   22   28-49     75-96  (152)
150 cd02068 radical_SAM_B12_BD B12  40.7      23 0.00051   22.9   2.0   29   25-53     52-81  (127)
151 cd00845 MPP_UshA_N_like Escher  40.7      34 0.00074   24.3   3.0   32   23-54     20-52  (252)
152 cd04501 SGNH_hydrolase_like_4   40.6      93   0.002   20.6   5.0   15   33-47     53-67  (183)
153 cd07405 MPP_UshA_N Escherichia  40.5      61  0.0013   24.2   4.4   42    5-46    128-180 (285)
154 PF03721 UDPG_MGDP_dh_N:  UDP-g  40.3      37  0.0008   24.0   3.1   36   10-45     80-118 (185)
155 PRK01021 lpxB lipid-A-disaccha  40.2      30 0.00064   29.7   2.9   19   27-45    298-316 (608)
156 TIGR03015 pepcterm_ATPase puta  40.0      43 0.00093   23.8   3.4   34   15-48     11-51  (269)
157 PRK15005 universal stress prot  39.8      40 0.00087   21.5   3.0   22   26-48     94-115 (144)
158 TIGR02370 pyl_corrinoid methyl  39.7      32 0.00069   24.6   2.7   20   26-45    122-141 (197)
159 TIGR02298 HpaD_Fe 3,4-dihydrox  39.7      30 0.00064   26.3   2.6   28   25-52     33-60  (282)
160 COG2875 CobM Precorrin-4 methy  39.6      34 0.00074   26.5   2.9   29   26-54    205-235 (254)
161 PF13941 MutL:  MutL protein     39.3      26 0.00056   28.9   2.4   24   25-48    110-133 (457)
162 KOG1432|consensus               39.0      62  0.0013   26.4   4.4   24   29-52     89-113 (379)
163 cd07399 MPP_YvnB Bacillus subt  38.8      47   0.001   23.6   3.4   27   28-54     24-50  (214)
164 KOG2442|consensus               38.8      28  0.0006   29.5   2.5   23    1-23    386-408 (541)
165 PLN02533 probable purple acid   38.6      67  0.0014   25.8   4.6   45   29-81    155-199 (427)
166 PF02350 Epimerase_2:  UDP-N-ac  38.4      31 0.00067   26.7   2.6   51   28-78     56-123 (346)
167 PF03464 eRF1_2:  eRF1 domain 2  38.2      35 0.00075   22.7   2.5   14   36-49     70-83  (133)
168 COG4100 Cystathionine beta-lya  38.2      41 0.00089   27.4   3.3   43   14-56    174-220 (416)
169 cd01145 TroA_c Periplasmic bin  37.8      69  0.0015   22.6   4.2   52   25-76      9-72  (203)
170 PRK09968 serine/threonine-spec  37.8      28 0.00061   25.0   2.2   30   23-52     25-55  (218)
171 cd02069 methionine_synthase_B1  37.6      36 0.00077   24.8   2.7   21   25-45    125-145 (213)
172 cd06346 PBP1_ABC_ligand_bindin  37.5      61  0.0013   23.6   4.0   32   13-48    170-201 (312)
173 PF07355 GRDB:  Glycine/sarcosi  37.5      41  0.0009   27.0   3.2   46    7-54     49-94  (349)
174 COG0763 LpxB Lipid A disacchar  37.3      34 0.00074   27.8   2.8   18   29-46     75-92  (381)
175 PRK02261 methylaspartate mutas  37.3      39 0.00085   23.0   2.7   20   26-45     41-60  (137)
176 COG0683 LivK ABC-type branched  37.2      66  0.0014   24.5   4.2   41    6-51    175-215 (366)
177 cd07371 2A5CPDO_AB The alpha a  37.2      43 0.00093   25.0   3.1   23   26-48     26-48  (268)
178 PRK15456 universal stress prot  37.0      45 0.00098   21.5   2.9   22   26-48     92-113 (142)
179 cd07413 MPP_PA3087 Pseudomonas  36.9      31 0.00068   24.9   2.3   30   24-53     10-47  (222)
180 TIGR03011 sulf_tusB_dsrH sulfu  36.6      39 0.00085   21.0   2.5   29   11-47      2-30  (94)
181 PF10035 DUF2179:  Uncharacteri  36.6      70  0.0015   18.0   3.4   41    8-48      3-49  (55)
182 TIGR00040 yfcE phosphoesterase  36.6      44 0.00095   22.2   2.9   27   24-50     12-39  (158)
183 cd07410 MPP_CpdB_N Escherichia  36.6      62  0.0014   23.7   3.9   43    5-47    138-191 (277)
184 COG0299 PurN Folate-dependent   36.5      38 0.00083   25.3   2.7   19   29-47     69-87  (200)
185 cd03146 GAT1_Peptidase_E Type   36.5      64  0.0014   23.0   3.9   37    9-45      1-37  (212)
186 cd07423 MPP_PrpE Bacillus subt  36.4      34 0.00074   24.6   2.4   29   24-52     12-50  (234)
187 cd00293 USP_Like Usp: Universa  36.2      50  0.0011   19.6   2.9   19   27-45     81-99  (130)
188 PF04016 DUF364:  Domain of unk  36.1      40 0.00086   23.2   2.6   27   22-50     72-98  (147)
189 PF01470 Peptidase_C15:  Pyrogl  35.9      27 0.00058   25.2   1.8   27   24-50     44-71  (202)
190 PRK13196 pyrrolidone-carboxyla  35.9      42 0.00091   24.6   2.9   26   24-49     45-71  (211)
191 PRK05335 tRNA (uracil-5-)-meth  35.9      39 0.00085   27.7   2.9   39    9-59    129-167 (436)
192 PF00072 Response_reg:  Respons  35.8      40 0.00086   20.1   2.3   19   27-45     31-49  (112)
193 PRK13194 pyrrolidone-carboxyla  35.7      39 0.00084   24.8   2.6   27   23-49     43-70  (208)
194 PRK11148 cyclic 3',5'-adenosin  35.6      41 0.00089   24.7   2.8   48    5-52     12-68  (275)
195 KOG1342|consensus               35.4      27 0.00059   28.8   1.9   26   57-82    227-252 (425)
196 PF04392 ABC_sub_bind:  ABC tra  35.4      29 0.00064   25.6   2.0   24   24-47     44-67  (294)
197 PF07297 DPM2:  Dolichol phosph  35.3      16 0.00036   23.4   0.6   13   45-57     26-38  (78)
198 TIGR01854 lipid_A_lpxH UDP-2,3  35.2      41 0.00088   24.1   2.7   25   28-52     17-43  (231)
199 cd07406 MPP_CG11883_N Drosophi  35.0      59  0.0013   23.8   3.6   34   20-53     18-52  (257)
200 cd02070 corrinoid_protein_B12-  35.0      43 0.00093   23.8   2.7   21   25-45    119-139 (201)
201 cd06366 PBP1_GABAb_receptor Li  34.9      83  0.0018   23.1   4.3   40   12-53    167-206 (350)
202 TIGR02201 heptsyl_trn_III lipo  34.9      85  0.0019   23.4   4.4   39   10-48    184-222 (344)
203 PRK00025 lpxB lipid-A-disaccha  34.7      47   0.001   24.7   3.0   18   30-47     76-93  (380)
204 cd03786 GT1_UDP-GlcNAc_2-Epime  34.6      50  0.0011   24.2   3.1   23   27-49     76-98  (363)
205 smart00865 Tubulin_C Tubulin/F  34.5 1.1E+02  0.0024   18.7   4.7   38   10-52     57-95  (120)
206 TIGR03445 mycothiol_MshB 1D-my  34.5      59  0.0013   24.8   3.5   23   27-49    111-133 (284)
207 PF07555 NAGidase:  beta-N-acet  34.5   1E+02  0.0023   24.0   5.0   41   26-76     56-96  (306)
208 PRK13625 bis(5'-nucleosyl)-tet  34.2      37  0.0008   24.8   2.3   29   24-52     12-49  (245)
209 TIGR00137 gid_trmFO tRNA:m(5)U  34.2      72  0.0016   26.1   4.2   37    9-54    128-168 (433)
210 cd01833 XynB_like SGNH_hydrola  34.2 1.2E+02  0.0026   19.5   4.6   22   26-47     64-85  (157)
211 cd01020 TroA_b Metal binding p  34.2      70  0.0015   23.5   3.8   53   25-77      9-74  (264)
212 PF00551 Formyl_trans_N:  Formy  33.8      48   0.001   23.1   2.8   24   29-52     69-94  (181)
213 PF13472 Lipase_GDSL_2:  GDSL-l  33.8      23  0.0005   22.4   1.1   44   35-83     57-100 (179)
214 cd03785 GT1_MurG MurG is an N-  33.5      55  0.0012   23.8   3.2   21   30-50     80-100 (350)
215 TIGR00642 mmCoA_mut_beta methy  32.8      51  0.0011   28.2   3.2   36   12-47    519-554 (619)
216 cd01832 SGNH_hydrolase_like_1   32.7 1.3E+02  0.0029   19.8   4.8   22   31-52     59-80  (185)
217 cd07409 MPP_CD73_N CD73 ecto-5  32.7   1E+02  0.0023   22.8   4.6   42    5-46    139-189 (281)
218 TIGR01917 gly_red_sel_B glycin  32.6      54  0.0012   27.1   3.2   42   11-54     49-90  (431)
219 PRK14820 NADH dehydrogenase su  32.4 1.3E+02  0.0028   22.0   4.9   36    5-47     71-108 (180)
220 PF07521 RMMBL:  RNA-metabolisi  32.3      59  0.0013   17.8   2.5   18   29-46     21-38  (43)
221 COG2099 CobK Precorrin-6x redu  32.3      26 0.00057   27.1   1.3   31    6-45    172-202 (257)
222 cd06368 PBP1_iGluR_non_NMDA_li  32.0      55  0.0012   23.6   2.9   24   27-50    168-191 (324)
223 TIGR01526 nadR_NMN_Atrans nico  31.9 1.7E+02  0.0037   22.5   5.8   47   30-80    259-308 (325)
224 cd05781 DNA_polB_B3_exo DEDDy   31.9      50  0.0011   23.3   2.6   23   22-44     46-68  (188)
225 TIGR01918 various_sel_PB selen  31.8      57  0.0012   27.0   3.2   43   10-54     48-90  (431)
226 PF13477 Glyco_trans_4_2:  Glyc  31.7      79  0.0017   19.9   3.3   26   23-48     58-83  (139)
227 cd05785 DNA_polB_like2_exo Unc  31.7      46   0.001   24.0   2.5   21   24-44     58-78  (207)
228 PHA02538 N capsid protein; Pro  31.6      55  0.0012   26.3   3.1   46   14-59    191-247 (348)
229 TIGR00236 wecB UDP-N-acetylglu  31.3      61  0.0013   24.2   3.1   22   28-49     75-96  (365)
230 cd05776 DNA_polB_alpha_exo ina  31.3      48   0.001   24.2   2.5   19   26-44     84-102 (234)
231 cd04121 Rab40 Rab40 subfamily.  31.2      53  0.0011   23.0   2.6   66   17-82     86-171 (189)
232 COG1284 Uncharacterized conser  30.6      74  0.0016   24.6   3.6   43    5-47    227-275 (289)
233 cd01823 SEST_like SEST_like. A  30.6 1.2E+02  0.0025   21.5   4.4   26   26-51    131-158 (259)
234 PRK15411 rcsA colanic acid cap  30.6      52  0.0011   23.3   2.6   21   26-46     34-54  (207)
235 cd02065 B12-binding_like B12 b  30.1      65  0.0014   20.1   2.7   21   26-46     37-57  (125)
236 CHL00175 minD septum-site dete  30.1   1E+02  0.0022   22.5   4.1   31   22-52    109-140 (281)
237 cd01988 Na_H_Antiporter_C The   30.1      72  0.0016   19.6   2.9   20   26-45     81-100 (132)
238 COG2248 Predicted hydrolase (m  30.1      49  0.0011   26.2   2.5   24   27-50    189-212 (304)
239 cd06382 PBP1_iGluR_Kainate N-t  29.8      62  0.0013   23.6   2.9   21   28-48    170-190 (327)
240 cd06363 PBP1_Taste_receptor Li  29.7      55  0.0012   25.1   2.7   25   27-51    222-246 (410)
241 PF01624 MutS_I:  MutS domain I  29.4      58  0.0013   21.0   2.4   21   26-46      1-21  (113)
242 PF12683 DUF3798:  Protein of u  29.3      25 0.00055   27.4   0.8   45   27-71     74-118 (275)
243 COG0859 RfaF ADP-heptose:LPS h  29.3 1.3E+02  0.0029   22.8   4.7   41    8-48    176-217 (334)
244 TIGR00504 pyro_pdase pyrogluta  29.3      62  0.0013   23.7   2.8   27   24-50     42-69  (212)
245 COG1206 Gid NAD(FAD)-utilizing  29.3      81  0.0018   26.1   3.7   41    9-61    131-171 (439)
246 PRK09620 hypothetical protein;  29.2 1.2E+02  0.0027   22.2   4.4   43    7-50      3-54  (229)
247 cd07380 MPP_CWF19_N Schizosacc  29.1      68  0.0015   22.2   2.9   18   38-55     25-42  (150)
248 cd07378 MPP_ACP5 Homo sapiens   28.9      65  0.0014   23.2   2.9   25   27-51     19-44  (277)
249 cd06360 PBP1_alkylbenzenes_lik  28.9      67  0.0015   23.2   2.9   22   28-49    178-199 (336)
250 COG2129 Predicted phosphoester  28.7      65  0.0014   24.5   2.9   28   23-50     14-41  (226)
251 cd06342 PBP1_ABC_LIVBP_like Ty  28.7 1.3E+02  0.0027   21.7   4.3   22   27-48    178-199 (334)
252 cd01827 sialate_O-acetylestera  28.5      60  0.0013   21.6   2.5   24   26-49     93-117 (188)
253 PRK12863 YciI-like protein; Re  28.5      67  0.0014   20.1   2.5   24   30-54     23-46  (94)
254 cd07952 ED_3B_like Uncharacter  28.5 1.1E+02  0.0023   22.6   4.0   30   22-51     16-47  (256)
255 cd05777 DNA_polB_delta_exo DED  28.4      60  0.0013   23.4   2.6   21   24-44     71-91  (230)
256 PLN02331 phosphoribosylglycina  28.4      64  0.0014   23.6   2.7   19   29-47     68-86  (207)
257 PRK10422 lipopolysaccharide co  28.4 1.3E+02  0.0028   22.7   4.5   39   10-48    186-224 (352)
258 cd00841 MPP_YfcE Escherichia c  28.3      68  0.0015   20.9   2.7   27   25-53     12-38  (155)
259 TIGR01319 glmL_fam conserved h  27.8      50  0.0011   27.5   2.3   21   28-48    109-129 (463)
260 TIGR00162 conserved hypothetic  27.8 1.1E+02  0.0025   21.9   3.9   45    6-50     13-58  (188)
261 TIGR00936 ahcY adenosylhomocys  27.6      56  0.0012   26.4   2.5   38   10-47     60-114 (406)
262 PF03470 zf-XS:  XS zinc finger  27.6      72  0.0016   18.3   2.3   21   16-37      2-23  (43)
263 cd06325 PBP1_ABC_uncharacteriz  27.5 1.4E+02  0.0031   20.7   4.3   38    5-48     32-69  (281)
264 PRK15401 alpha-ketoglutarate-d  27.5 1.6E+02  0.0035   21.8   4.8   49    4-52     54-135 (213)
265 PRK06411 NADH dehydrogenase su  27.3 1.6E+02  0.0034   21.6   4.6   36    5-47     72-109 (183)
266 cd01989 STK_N The N-terminal d  27.3      85  0.0018   20.0   3.0   20   26-45     90-109 (146)
267 PF14237 DUF4339:  Domain of un  27.2      92   0.002   17.0   2.7   22   14-44     11-34  (45)
268 cd01987 USP_OKCHK USP domain i  27.0      88  0.0019   19.3   2.9   22   26-47     72-93  (124)
269 cd05784 DNA_polB_II_exo DEDDy   27.0      66  0.0014   23.0   2.6   20   25-44     52-71  (193)
270 cd06359 PBP1_Nba_like Type I p  27.0      83  0.0018   23.0   3.2   21   29-49    176-196 (333)
271 TIGR03669 urea_ABC_arch urea A  26.8 1.2E+02  0.0027   23.3   4.2   25   27-51    176-200 (374)
272 PF09822 ABC_transp_aux:  ABC-t  26.6 1.7E+02  0.0036   21.4   4.7   40    6-49    196-235 (271)
273 PRK02842 light-independent pro  26.6      86  0.0019   24.9   3.4   31   27-60    348-378 (427)
274 PF03104 DNA_pol_B_exo1:  DNA p  26.6      55  0.0012   23.9   2.2   21   24-44    222-242 (325)
275 COG5012 Predicted cobalamin bi  26.6      54  0.0012   24.9   2.1   20   26-45    142-161 (227)
276 TIGR00024 SbcD_rel_arch putati  26.5      74  0.0016   23.3   2.8   25   27-51     46-70  (225)
277 cd07411 MPP_SoxB_N Thermus the  26.2      81  0.0017   23.1   3.0   32   22-53     32-65  (264)
278 TIGR00758 UDG_fam4 uracil-DNA   26.1      71  0.0015   22.2   2.6   18   31-48     92-109 (173)
279 cd06329 PBP1_SBP_like_3 Peripl  26.1 1.1E+02  0.0024   22.5   3.7   22   23-47    188-209 (342)
280 PRK13197 pyrrolidone-carboxyla  25.9      79  0.0017   23.1   2.9   25   24-48     45-70  (215)
281 PF05125 Phage_cap_P2:  Phage m  25.8      19 0.00041   28.7  -0.4   37   23-59    196-242 (333)
282 TIGR00639 PurN phosphoribosylg  25.8      80  0.0017   22.6   2.8   19   29-47     69-87  (190)
283 cd00636 TroA-like Helical back  25.8      70  0.0015   19.4   2.2   14   34-47     56-69  (148)
284 PLN02605 monogalactosyldiacylg  25.6      87  0.0019   23.8   3.1   22   30-51     91-112 (382)
285 TIGR03446 mycothiol_Mca mycoth  25.5      95   0.002   23.8   3.3   28   28-55    110-137 (283)
286 cd01831 Endoglucanase_E_like E  25.4      95   0.002   20.6   3.0   25   27-51     82-107 (169)
287 cd07381 MPP_CapA CapA and rela  25.4 1.8E+02  0.0038   20.8   4.6   42    4-46    129-181 (239)
288 cd06350 PBP1_GPCR_family_C_lik  25.3      85  0.0018   22.8   2.9   25   27-51    205-229 (348)
289 PLN02747 N-carbamolyputrescine  25.3      92   0.002   22.9   3.1   42    1-45      1-44  (296)
290 cd05160 DEDDy_DNA_polB_exo DED  25.2      77  0.0017   21.8   2.6   21   25-45     64-84  (199)
291 cd05780 DNA_polB_Kod1_like_exo  25.1      77  0.0017   22.2   2.6   20   25-44     57-76  (195)
292 cd01825 SGNH_hydrolase_peri1 S  25.0 2.1E+02  0.0045   18.8   5.1   25   25-49     80-105 (189)
293 cd06332 PBP1_aromatic_compound  25.0      96  0.0021   22.2   3.1   23   23-48    173-195 (333)
294 PF00102 Y_phosphatase:  Protei  24.8 2.3E+02  0.0049   19.3   4.9   40    6-52     40-79  (235)
295 cd06379 PBP1_iGluR_NMDA_NR1 N-  24.7      86  0.0019   23.6   2.9   26   27-52    201-226 (377)
296 TIGR01957 nuoB_fam NADH-quinon  24.6 1.4E+02   0.003   20.9   3.8   36    5-47     55-92  (145)
297 PRK07259 dihydroorotate dehydr  24.6   1E+02  0.0022   23.0   3.3   34   10-51     15-48  (301)
298 COG1058 CinA Predicted nucleot  24.3 1.8E+02  0.0038   22.3   4.6   37   29-78     48-86  (255)
299 cd02072 Glm_B12_BD B12 binding  24.2      95  0.0021   21.3   2.8   20   26-45     37-56  (128)
300 cd02810 DHOD_DHPD_FMN Dihydroo  24.2   1E+02  0.0022   22.6   3.2   11   10-20     12-22  (289)
301 cd07404 MPP_MS158 Microscilla   24.2      40 0.00086   22.5   1.0   21   33-53     20-40  (166)
302 PF02807 ATP-gua_PtransN:  ATP:  24.1      91   0.002   19.6   2.5   26   54-81     47-72  (76)
303 PF13483 Lactamase_B_3:  Beta-l  24.0 1.7E+02  0.0038   19.3   4.1   17   28-44    144-160 (163)
304 TIGR03010 sulf_tusC_dsrF sulfu  24.0 1.5E+02  0.0033   19.1   3.7   41    8-50      2-42  (116)
305 PF14826 FACT-Spt16_Nlob:  FACT  23.8 2.4E+02  0.0052   19.7   4.9   38    7-46     28-66  (163)
306 cd06269 PBP1_glutamate_recepto  23.8 1.4E+02  0.0031   20.4   3.7   23   26-48    182-204 (298)
307 KOG2774|consensus               23.7      29 0.00063   27.5   0.2   33   11-46     85-117 (366)
308 cd06349 PBP1_ABC_ligand_bindin  23.7      91   0.002   22.8   2.9   23   28-50    179-201 (340)
309 cd07382 MPP_DR1281 Deinococcus  23.6 1.9E+02   0.004   21.8   4.6   42    4-46    105-147 (255)
310 cd08183 Fe-ADH2 Iron-containin  23.6 1.1E+02  0.0025   23.6   3.5   26   22-47     58-83  (374)
311 smart00739 KOW KOW (Kyprides,   23.5      73  0.0016   15.0   1.6   13    8-20      6-18  (28)
312 cd07412 MPP_YhcR_N Bacillus su  23.4 1.7E+02  0.0037   21.8   4.3   43    4-46    145-198 (288)
313 PF00071 Ras:  Ras family;  Int  23.2      41 0.00088   21.6   0.8   62   17-78     79-161 (162)
314 PF08846 DUF1816:  Domain of un  23.0      50  0.0011   20.6   1.2   24   35-58     14-37  (68)
315 COG0648 Nfo Endonuclease IV [D  23.0 2.4E+02  0.0051   21.9   5.1   56   12-72    141-198 (280)
316 PRK08057 cobalt-precorrin-6x r  22.9      91   0.002   23.4   2.8   22   29-56     55-76  (248)
317 PF12327 FtsZ_C:  FtsZ family,   22.8      55  0.0012   20.9   1.4   43    7-54     38-81  (95)
318 cd06384 PBP1_NPR_B Ligand-bind  22.8      94   0.002   23.7   2.9   22   27-49    191-212 (399)
319 cd06348 PBP1_ABC_ligand_bindin  22.7   1E+02  0.0022   22.6   2.9   25   28-52    181-205 (344)
320 cd00839 MPP_PAPs purple acid p  22.6 2.5E+02  0.0054   20.3   5.0   24   29-52     21-46  (294)
321 cd06338 PBP1_ABC_ligand_bindin  22.5   1E+02  0.0022   22.5   2.9   24   28-51    185-208 (345)
322 TIGR01821 5aminolev_synth 5-am  22.4   2E+02  0.0043   21.9   4.6   30    7-38    177-206 (402)
323 TIGR00661 MJ1255 conserved hyp  22.4      94   0.002   23.1   2.8   23   27-49     81-103 (321)
324 PF13353 Fer4_12:  4Fe-4S singl  22.4      80  0.0017   20.1   2.1   29   23-51     36-66  (139)
325 cd06335 PBP1_ABC_ligand_bindin  22.4   1E+02  0.0023   22.8   3.0   35   13-51    171-205 (347)
326 cd06355 PBP1_FmdD_like Peripla  22.3 1.1E+02  0.0023   22.9   3.0   24   28-51    177-200 (348)
327 cd05779 DNA_polB_epsilon_exo D  22.3      90  0.0019   22.6   2.6   22   23-44     72-93  (204)
328 PF13528 Glyco_trans_1_3:  Glyc  22.3      92   0.002   22.5   2.6   22   28-49     83-104 (318)
329 PRK11756 exonuclease III; Prov  22.3   1E+02  0.0022   22.3   2.8   21   27-47     14-34  (268)
330 PF13458 Peripla_BP_6:  Peripla  22.2 1.2E+02  0.0027   21.7   3.3   24   26-49    177-200 (343)
331 cd01979 Pchlide_reductase_N Pc  22.1 1.1E+02  0.0024   23.9   3.2   32   27-61    333-364 (396)
332 PF13659 Methyltransf_26:  Meth  22.1      66  0.0014   19.7   1.6   26   29-54     60-85  (117)
333 cd01137 PsaA Metal binding pro  22.1 1.1E+02  0.0025   22.9   3.1   53   24-76     23-87  (287)
334 PRK11573 hypothetical protein;  22.0 1.4E+02  0.0031   23.8   3.8   47   26-80    271-317 (413)
335 PLN02495 oxidoreductase, actin  21.9 1.1E+02  0.0024   24.6   3.2   34   10-51     24-57  (385)
336 PF03514 GRAS:  GRAS domain fam  21.9   1E+02  0.0023   24.2   3.0   26   27-52    223-248 (374)
337 PTZ00198 60S ribosomal protein  21.8      37 0.00081   23.6   0.5   25   49-74     22-47  (122)
338 cd06270 PBP1_GalS_like Ligand   21.8 2.7E+02  0.0058   19.2   4.9   26   26-51     42-67  (268)
339 cd01016 TroA Metal binding pro  21.7 1.8E+02  0.0039   21.6   4.1   53   25-77      8-72  (276)
340 TIGR00655 PurU formyltetrahydr  21.7      99  0.0021   23.6   2.8   19   29-47    150-168 (280)
341 cd06337 PBP1_ABC_ligand_bindin  21.4 1.1E+02  0.0023   22.9   2.9   24   28-51    192-215 (357)
342 TIGR03590 PseG pseudaminic aci  21.3      97  0.0021   22.9   2.6   26   27-52     68-93  (279)
343 PF03372 Exo_endo_phos:  Endonu  21.3      97  0.0021   20.4   2.4   20   28-47     18-37  (249)
344 cd01976 Nitrogenase_MoFe_alpha  21.3 1.3E+02  0.0028   23.9   3.5   17   28-44    358-374 (421)
345 KOG0086|consensus               21.2   2E+02  0.0044   21.4   4.2   66   17-82     89-175 (214)
346 cd02940 DHPD_FMN Dihydropyrimi  21.1 1.2E+02  0.0026   22.8   3.2   11   10-20     15-25  (299)
347 cd03309 CmuC_like CmuC_like. P  21.1   2E+02  0.0042   22.3   4.3   71    9-83    115-209 (321)
348 TIGR03018 pepcterm_TyrKin exop  21.0 1.4E+02  0.0031   20.8   3.4   45    7-52    114-162 (207)
349 PRK00726 murG undecaprenyldiph  20.9 1.2E+02  0.0026   22.4   3.1   20   30-49     82-101 (357)
350 PRK14817 NADH dehydrogenase su  20.9 2.7E+02  0.0059   20.4   4.8   36    5-47     73-110 (181)
351 PRK09426 methylmalonyl-CoA mut  20.9 1.9E+02   0.004   25.2   4.5   52   14-79    608-659 (714)
352 PF12847 Methyltransf_18:  Meth  20.9      86  0.0019   18.9   2.0   38    7-45     70-108 (112)
353 cd06356 PBP1_Amide_Urea_BP_lik  20.8 1.2E+02  0.0025   22.4   3.0   23   27-49    175-197 (334)
354 cd01836 FeeA_FeeB_like SGNH_hy  20.8 2.3E+02  0.0049   18.9   4.2   24   29-52     54-80  (191)
355 cd04506 SGNH_hydrolase_YpmR_li  20.8   1E+02  0.0022   20.9   2.5   23   26-48    106-129 (204)
356 cd06358 PBP1_NHase Type I peri  20.8 1.2E+02  0.0026   22.2   3.0   25   28-52    176-200 (333)
357 PF06162 DUF976:  Caenorhabditi  20.7   1E+02  0.0023   22.4   2.6   26   23-48     65-90  (166)
358 cd00047 PTPc Protein tyrosine   20.6 2.3E+02   0.005   19.8   4.4   39    7-52     40-78  (231)
359 PRK12446 undecaprenyldiphospho  20.6 1.1E+02  0.0023   23.6   2.8   20   32-51     84-103 (352)
360 PRK15454 ethanol dehydrogenase  20.4 1.7E+02  0.0036   23.1   3.9   26   22-47     89-114 (395)
361 cd06331 PBP1_AmiC_like Type I   20.4 1.2E+02  0.0027   22.1   3.0   25   28-52    176-200 (333)
362 cd04502 SGNH_hydrolase_like_7   20.4 2.6E+02  0.0057   18.3   4.5   15   37-51     48-62  (171)
363 KOG3488|consensus               20.3      32  0.0007   22.1  -0.1   10   45-54     28-37  (81)
364 cd06340 PBP1_ABC_ligand_bindin  20.3 1.8E+02  0.0039   21.5   3.9   34   14-51    178-211 (347)
365 PRK00994 F420-dependent methyl  20.3 1.5E+02  0.0032   23.3   3.4   28   22-49     42-70  (277)
366 cd00501 Peptidase_C15 Pyroglut  20.2 1.1E+02  0.0025   21.5   2.7   30   25-54     45-75  (194)
367 PRK10964 ADP-heptose:LPS hepto  20.2 2.3E+02   0.005   21.0   4.4   29   20-48    191-219 (322)
368 cd04724 Tryptophan_synthase_al  20.2 1.4E+02  0.0031   21.8   3.3   30   22-51    112-141 (242)
369 PRK15404 leucine ABC transport  20.1 1.2E+02  0.0025   23.1   2.9   21   28-48    205-225 (369)
370 TIGR01501 MthylAspMutase methy  20.1 1.3E+02  0.0028   20.7   2.9   20   26-45     39-58  (134)
371 PF01637 Arch_ATPase:  Archaeal  20.1      89  0.0019   21.0   2.0   21   28-48      8-28  (234)
372 cd06328 PBP1_SBP_like_2 Peripl  20.1 1.8E+02   0.004   21.4   3.9   30   13-46    169-198 (333)
373 cd00762 NAD_bind_malic_enz NAD  20.0      51  0.0011   25.2   0.9   19   27-45     94-112 (254)
374 PF03949 Malic_M:  Malic enzyme  20.0      50  0.0011   25.3   0.9   18   29-46     96-113 (255)

No 1  
>KOG1625|consensus
Probab=99.93  E-value=1.4e-26  Score=189.01  Aligned_cols=76  Identities=47%  Similarity=0.847  Sum_probs=73.4

Q ss_pred             EEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHHHHhhccccCCC
Q psy149           10 MFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDSIVQPLEKPG   85 (86)
Q Consensus        10 i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~i~~~~~~~g   85 (86)
                      |||||||||++|||.|+||.|||+||+.++||||||+|||||++|++|++|.++.||+|+|+++|.+|++.+.+++
T Consensus       343 ivvasGPyt~sDnl~yepL~dll~~v~~~~pdvLIL~GPFlD~~h~~i~~~~~t~t~delF~~~i~~ile~~~~~~  418 (600)
T KOG1625|consen  343 IVVASGPYTASDNLSYEPLCDLLDYVNAERPDVLILFGPFLDSKHPLINKGALTITFDELFEKLILGILETLVGSK  418 (600)
T ss_pred             EEEEecCccCccccchhHHHHHHHHHhcCCCCEEEEeccccCccChhhccCCcCccHHHHHHHHHHHHHHhccCCc
Confidence            8999999999999999999999999999999999999999999999999999999999999999999999987543


No 2  
>COG5214 POL12 DNA polymerase alpha-primase complex, polymerase-associated subunit B [DNA replication, recombination, and repair]
Probab=99.85  E-value=1.1e-21  Score=157.77  Aligned_cols=81  Identities=31%  Similarity=0.514  Sum_probs=77.1

Q ss_pred             CcCCCceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCc----CCCHHHHHHHHHHHh
Q psy149            2 TLTRRSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSL----AETFEDFYVKLIDSI   77 (86)
Q Consensus         2 ~l~~~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~----~~t~eelF~~~i~~i   77 (86)
                      .+++++++|+++||||...|||+++||.+++++|+++..|||||+|||||.+|++|+.|.+    +.+++|+|.+.+++|
T Consensus       299 n~~~q~~~iv~~sGPy~~~dd~s~~pl~~~id~vn~n~vdvlIl~GPFidi~h~li~~G~~~~t~~~~l~ElF~~r~tpi  378 (581)
T COG5214         299 NTNNQPTSIVAFSGPYGPRDDLSGSPLFDAIDRVNANDVDVLILIGPFIDINHILIQYGATQSTPDSMLKELFIPRITPI  378 (581)
T ss_pred             ccCCCceEEEEEcCCCCCccccCcChHHHHHHHhccCCccEEEEeccccCcchhhhhhCCCCCCChhHHHHHHHHhhhHH
Confidence            5789999999999999999999999999999999999999999999999999999999987    568999999999999


Q ss_pred             hcccc
Q psy149           78 VQPLE   82 (86)
Q Consensus        78 ~~~~~   82 (86)
                      +++..
T Consensus       379 L~~~~  383 (581)
T COG5214         379 LDRNA  383 (581)
T ss_pred             HhccC
Confidence            99875


No 3  
>PF04042 DNA_pol_E_B:  DNA polymerase alpha/epsilon subunit B;  InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast. In addition, DNA polymerase epsilon may be involved in DNA repair and cell-cycle checkpoint control. The enzyme consists of at least four subunits in mammalian cells as well as in yeast. The largest subunit of DNA polymerase epsilon is responsible for polymerase activity. In mouse, the DNA polymerase epsilon subunit B is the second largest subunit of the DNA polymerase. A part of the N-terminal was found to be responsible for the interaction with SAP18. Experimental evidence suggests that this subunit may recruit histone deacetylase to the replication fork to modify the chromatin structure [].; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3E0J_C 3FLO_G.
Probab=99.59  E-value=3.2e-16  Score=110.91  Aligned_cols=73  Identities=38%  Similarity=0.777  Sum_probs=61.3

Q ss_pred             EEEEeCCCCCCCCCCCchHHHHHHHHh-hCCCCEEEeeccccCCCCccccCCCc--CCCHHHHHHHHHHHhhcccc
Q psy149           10 MFVSAGPYTQSDTLSYKPLEDLIALTV-QQEPDVLILIGPLLDTSHPLLLNGSL--AETFEDFYVKLIDSIVQPLE   82 (86)
Q Consensus        10 i~vAaGPfT~~d~l~y~pL~~ll~~v~-~~~PdvlIL~GPFiD~~h~~i~~g~~--~~t~eelF~~~i~~i~~~~~   82 (86)
                      |++|||||+.+++++|++|.++++.++ +.+|++|||+|||+|..|+.++.++.  ..++++.|.+.+.+.++++.
T Consensus         1 Iv~~Sg~~~~~~~~~~~~L~~~l~~~~~~~~p~~lIl~G~fi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~   76 (209)
T PF04042_consen    1 IVFASGPFLDSDNLSLEPLRDLLSGVEDASKPDVLILMGPFIDSPHPYISSGSVPDSYSFEEDFLKELDSFLESIL   76 (209)
T ss_dssp             EEEEES--CTTT-HHHHHHHHHHHCCCHCTTECEEEEES-SCBTTSHHHHHT---HHCCHHHHHHHHCHHHHCCCH
T ss_pred             CEEEecCccCCCHhHHHHHHHHHHhccccCCCcEEEEeCCCcCccccccccccccccccccHHHHHHHHHHHhhcc
Confidence            799999999999999999999999999 99999999999999999999988876  77888888888888777764


No 4  
>PF10686 DUF2493:  Protein of unknown function (DUF2493);  InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  Members of this family are mainly Proteobacteria. The function is not known. 
Probab=89.19  E-value=1.3  Score=27.50  Aligned_cols=38  Identities=11%  Similarity=0.269  Sum_probs=31.3

Q ss_pred             CceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149            6 RSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus         6 ~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      +.++|+|+.|....    |++.+.+-|+++....|+.+|+-|
T Consensus         2 ~g~rVli~GgR~~~----D~~~i~~~Ld~~~~~~~~~~lvhG   39 (71)
T PF10686_consen    2 EGMRVLITGGRDWT----DHELIWAALDKVHARHPDMVLVHG   39 (71)
T ss_pred             CCCEEEEEECCccc----cHHHHHHHHHHHHHhCCCEEEEEC
Confidence            45788999987765    677788888889888899998877


No 5  
>PRK11340 phosphodiesterase YaeI; Provisional
Probab=88.61  E-value=1.4  Score=32.71  Aligned_cols=48  Identities=21%  Similarity=0.298  Sum_probs=33.6

Q ss_pred             CceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149            6 RSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus         6 ~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      ++++|+..|=.--.. ....+.+..+++.+++.+||++++.|=++|..+
T Consensus        48 ~~~rI~~lSDlH~~~-~~~~~~l~~~v~~i~~~~pDlVli~GD~~d~~~   95 (271)
T PRK11340         48 APFKILFLADLHYSR-FVPLSLISDAIALGIEQKPDLILLGGDYVLFDM   95 (271)
T ss_pred             CCcEEEEEcccCCCC-cCCHHHHHHHHHHHHhcCCCEEEEccCcCCCCc
Confidence            356777765332211 112345889999999999999999999999543


No 6  
>PRK04036 DNA polymerase II small subunit; Validated
Probab=88.49  E-value=1.1  Score=36.72  Aligned_cols=50  Identities=16%  Similarity=0.151  Sum_probs=42.0

Q ss_pred             CCceeEEEEeCCCCCCCCCCCchHHHHHHHHh---------hCCCCEEEeeccccCCCC
Q psy149            5 RRSLSMFVSAGPYTQSDTLSYKPLEDLIALTV---------QQEPDVLILIGPLLDTSH   54 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~---------~~~PdvlIL~GPFiD~~h   54 (86)
                      ..+.++++.||-.-.++......|..|+++++         ..+|+.+|++|-++|..+
T Consensus       241 ~~~~~i~~ISDlHlgs~~~~~~~l~~li~~L~g~~~~~~~~~~~~d~lVIaGDivd~~~  299 (504)
T PRK04036        241 DEKVYAVFISDVHVGSKEFLEDAFEKFIDWLNGEVGNEEEIASRVKYLIIAGDLVDGIG  299 (504)
T ss_pred             CCccEEEEEcccCCCCcchhHHHHHHHHHHHhCCCccchhhhhcCCEEEEeCccccccc
Confidence            34678999999987776666677899999999         778999999999999754


No 7  
>COG5493 Uncharacterized conserved protein containing a coiled-coil domain [Function unknown]
Probab=87.72  E-value=0.53  Score=35.58  Aligned_cols=29  Identities=17%  Similarity=0.265  Sum_probs=26.1

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCCCCcc
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDTSHPL   56 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~~h~~   56 (86)
                      -.+|-++++..+||.+|.+|||||-.+|-
T Consensus       184 k~elYer~~gvki~~vivitpFihdr~p~  212 (231)
T COG5493         184 KKELYERAKGVKINKVIVITPFIHDRYPD  212 (231)
T ss_pred             HHHHHHHhcCCccceEEEEcccccccChH
Confidence            45788999999999999999999999875


No 8  
>PRK03170 dihydrodipicolinate synthase; Provisional
Probab=86.27  E-value=0.99  Score=33.70  Aligned_cols=37  Identities=16%  Similarity=0.490  Sum_probs=33.1

Q ss_pred             EEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           12 VSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        12 vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      ..-=||+.+.++|++.+.++++++.+...|-++++|=
T Consensus         8 ~~~TPf~~dg~iD~~~l~~~i~~l~~~Gv~gi~~~Gs   44 (292)
T PRK03170          8 ALVTPFKEDGSVDFAALRKLVDYLIANGTDGLVVVGT   44 (292)
T ss_pred             eeeCCcCCCCCcCHHHHHHHHHHHHHcCCCEEEECCc
Confidence            3456999999999999999999999999999998873


No 9  
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis. It catalyzes the aldol condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a Schiff base formation between pyruvate and a lysine residue. The functional enzyme is a homotetramer consisting of a dimer of dimers. DHDPS is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways.
Probab=85.13  E-value=1.2  Score=32.93  Aligned_cols=37  Identities=22%  Similarity=0.532  Sum_probs=33.0

Q ss_pred             EEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           12 VSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        12 vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      ..-=||+.+.++|++.+.++++++.+...|-++++|-
T Consensus         7 ~~~TPf~~dg~iD~~~~~~~i~~l~~~Gv~gl~v~Gs   43 (284)
T cd00950           7 ALVTPFKDDGSVDFDALERLIEFQIENGTDGLVVCGT   43 (284)
T ss_pred             eeeCCcCCCCCcCHHHHHHHHHHHHHcCCCEEEECCC
Confidence            3346999999999999999999999999999998873


No 10 
>cd00408 DHDPS-like Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stablilzes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.
Probab=84.36  E-value=1.4  Score=32.42  Aligned_cols=34  Identities=21%  Similarity=0.503  Sum_probs=31.6

Q ss_pred             eCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           14 AGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        14 aGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      -=||+.+..+|++.+.++++++.+...|.+.++|
T Consensus         6 ~TPf~~dg~iD~~~~~~~i~~l~~~Gv~gi~~~G   39 (281)
T cd00408           6 VTPFTADGEVDLDALRRLVEFLIEAGVDGLVVLG   39 (281)
T ss_pred             eCCcCCCCCcCHHHHHHHHHHHHHcCCCEEEECC
Confidence            4599999999999999999999999999999888


No 11 
>TIGR00619 sbcd exonuclease SbcD. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=84.13  E-value=1.5  Score=32.37  Aligned_cols=32  Identities=28%  Similarity=0.527  Sum_probs=27.7

Q ss_pred             CchHHHHHHHHhhCCCCEEEeeccccCCCCcc
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGPLLDTSHPL   56 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~   56 (86)
                      +.-|..+++.+++++||+||+.|=++|...|.
T Consensus        25 ~~~l~~l~~~~~~~~~D~lli~GDi~d~~~p~   56 (253)
T TIGR00619        25 KAFLDDLLEFAKAEQIDALLVAGDVFDTANPP   56 (253)
T ss_pred             HHHHHHHHHHHHHcCCCEEEECCccCCCCCCC
Confidence            34578899999999999999999999988764


No 12 
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional
Probab=83.63  E-value=1.5  Score=33.24  Aligned_cols=37  Identities=8%  Similarity=0.183  Sum_probs=33.0

Q ss_pred             EEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           11 FVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        11 ~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      ...-=||+.+.++|++.|..++++..+...|-++.+|
T Consensus        13 ~a~vTPf~~dg~iD~~~l~~li~~l~~~Gv~Gi~~~G   49 (303)
T PRK03620         13 SFPVTPFDADGSFDEAAYREHLEWLAPYGAAALFAAG   49 (303)
T ss_pred             EeeeCCCCCCCCcCHHHHHHHHHHHHHcCCCEEEECc
Confidence            3344699999999999999999999999999999888


No 13 
>PLN02417 dihydrodipicolinate synthase
Probab=83.44  E-value=1.6  Score=32.77  Aligned_cols=35  Identities=17%  Similarity=0.439  Sum_probs=32.0

Q ss_pred             eCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           14 AGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        14 aGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      -=||+.+.++|++.+.++++++.+...|-++++|-
T Consensus        10 ~TPf~~~g~iD~~~~~~~i~~l~~~Gv~Gi~~~Gs   44 (280)
T PLN02417         10 KTPYLPDGRFDLEAYDSLVNMQIENGAEGLIVGGT   44 (280)
T ss_pred             eCCcCCCCCcCHHHHHHHHHHHHHcCCCEEEECcc
Confidence            35999999999999999999999999999999883


No 14 
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases. The enzyme is involved in glucarate metabolism, and its mechanism presumbly involves a Schiff-base intermediate similar to members of DHDPS family. While in the case of Pseudomonas sp. 5-dehydro-4-deoxy-D-glucarate is degraded by KDGDH to 2,5-dioxopentanoate, in certain species of Enterobacteriaceae it is degraded instead to pyruvate and glycerate.
Probab=83.30  E-value=1.6  Score=32.85  Aligned_cols=34  Identities=6%  Similarity=0.139  Sum_probs=31.7

Q ss_pred             eCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           14 AGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        14 aGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      -=||+.+.++|++.+..+++++.+...|-++++|
T Consensus         9 vTPf~~dg~iD~~~l~~l~~~l~~~Gv~gi~v~G   42 (289)
T cd00951           9 VTHFDADGSFDEDAYRAHVEWLLSYGAAALFAAG   42 (289)
T ss_pred             ecCCCCCCCcCHHHHHHHHHHHHHcCCCEEEECc
Confidence            4599999999999999999999999999999988


No 15 
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain. YkuE is an uncharacterized Bacillus subtilis protein with a C-terminal metallophosphatase domain and an N-terminal twin-arginine (RR) motif. An RR-signal peptide derived from the Bacillus subtilis YkuE protein can direct Tat-dependent secretion of agarase in Streptomyces lividans. This is an indication that YkuE is transported by the Bacillus subtilis Tat (Twin-arginine translocation) pathway machinery.  YkuE belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-dia
Probab=83.23  E-value=3.1  Score=28.90  Aligned_cols=47  Identities=26%  Similarity=0.293  Sum_probs=32.6

Q ss_pred             eeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCCc
Q psy149            8 LSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSHP   55 (86)
Q Consensus         8 l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~   55 (86)
                      ++|++.|=.-... ....+-+..+++.+++.+||++++.|=++|...+
T Consensus         2 ~~i~~~sDlH~~~-~~~~~~~~~~~~~~~~~~~d~vl~~GD~~~~~~~   48 (223)
T cd07385           2 LRIAHLSDLHLGP-FVSRERLERLVEKINALKPDLVVLTGDLVDGSVD   48 (223)
T ss_pred             CEEEEEeecCCCc-cCCHHHHHHHHHHHhccCCCEEEEcCcccCCcch
Confidence            4566655332211 1112468899999999999999999999987653


No 16 
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Probab=82.19  E-value=1.9  Score=32.53  Aligned_cols=34  Identities=12%  Similarity=0.235  Sum_probs=31.5

Q ss_pred             eCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           14 AGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        14 aGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      -=||+.+.++|++.|..++++..+...|-+.++|
T Consensus        14 vTPf~~dg~iD~~~l~~li~~l~~~Gv~gi~v~G   47 (296)
T TIGR03249        14 VTPFDADGSFDEAAYRENIEWLLGYGLEALFAAG   47 (296)
T ss_pred             eCCcCCCCCcCHHHHHHHHHHHHhcCCCEEEECC
Confidence            4599999999999999999999999999999887


No 17 
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid). It has a widespread application as biocatalyst for the synthesis of sialic acid and its derivatives. This enzyme has been shown to be quite specific for pyruvate as the donor, but flexible to a variety of D- and, to some extent, L-hexoses and pentoses as acceptor substrates. NAL is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases.
Probab=81.70  E-value=2  Score=32.19  Aligned_cols=34  Identities=15%  Similarity=0.361  Sum_probs=31.5

Q ss_pred             CCCCCCCCCCCchHHHHHHHHhhC-CCCEEEeecc
Q psy149           15 GPYTQSDTLSYKPLEDLIALTVQQ-EPDVLILIGP   48 (86)
Q Consensus        15 GPfT~~d~l~y~pL~~ll~~v~~~-~PdvlIL~GP   48 (86)
                      =||+.+.++|++.+..+++++.+. ..|-++++|-
T Consensus        10 TPf~~dg~iD~~~~~~~i~~l~~~~Gv~gi~~~Gs   44 (288)
T cd00954          10 TPFDENGEINEDVLRAIVDYLIEKQGVDGLYVNGS   44 (288)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHhcCCCCEEEECcC
Confidence            499999999999999999999998 9999999883


No 18 
>PRK04147 N-acetylneuraminate lyase; Provisional
Probab=81.51  E-value=2.1  Score=32.17  Aligned_cols=36  Identities=19%  Similarity=0.344  Sum_probs=33.0

Q ss_pred             EEeCCCCCCCCCCCchHHHHHHHHhh-CCCCEEEeec
Q psy149           12 VSAGPYTQSDTLSYKPLEDLIALTVQ-QEPDVLILIG   47 (86)
Q Consensus        12 vAaGPfT~~d~l~y~pL~~ll~~v~~-~~PdvlIL~G   47 (86)
                      .--=||+.+..+|++.+.++++++.+ ...|-++..|
T Consensus        10 a~~TPf~~dg~iD~~~~~~li~~l~~~~Gv~gi~v~G   46 (293)
T PRK04147         10 ALLTPFDEDGQIDEQGLRRLVRFNIEKQGIDGLYVGG   46 (293)
T ss_pred             eeECcCCCCCCcCHHHHHHHHHHHHhcCCCCEEEECC
Confidence            34569999999999999999999999 9999999988


No 19 
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain. TMEM62 (transmembrane protein 62) is an uncharacterized Homo sapiens transmembrane protein with an N-terminal metallophosphatase domain.  TMEM62 belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.
Probab=81.23  E-value=4.3  Score=29.86  Aligned_cols=28  Identities=14%  Similarity=0.112  Sum_probs=24.1

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCCCCc
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDTSHP   55 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~~h~   55 (86)
                      +..+++.+++.+||.+|+.|=++|....
T Consensus        22 ~~~~~~~i~~~~pd~i~~~GD~~d~~~~   49 (256)
T cd07401          22 ETFCSNFIDVIKPALVLATGDLTDNKTG   49 (256)
T ss_pred             HHHHHHHHHhhCCCEEEEcccccccccc
Confidence            3667888999999999999999997763


No 20 
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase. This model represents a subset of the DapA (dihydrodipicolinate synthase) family which has apparently evolved a separate function. The product of DapA, dihydrodipicolinate, results from the non-enzymatic cyclization and dehydration of 6-amino-2,4-dihydroxyhept-2-ene-1,7-dioic acid, which is different from the substrate of this reaction only in the presence of the amino group. In the absence of this amino group, and running the reaction in the opposite direction, the reaction corresponds to the HpaI aldolase component of the 4-hydroxyphenylacetic acid catabolism pathway (see TIGR02311). At present, this variant of DapA is found only in Oceanobacillus iheyensis HTE831 and Thermus thermophilus HB27. In both of these cases, one or more other DapA genes can be found and the one identified by this model is part of an operon for 4-hydroxyphenylacetic acid catabolism.
Probab=80.37  E-value=2.3  Score=32.16  Aligned_cols=34  Identities=15%  Similarity=0.407  Sum_probs=31.8

Q ss_pred             eCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           14 AGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        14 aGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      -=||+.+.++|++-+..+++++.....|-++.+|
T Consensus         9 ~TPf~~dg~iD~~~l~~lv~~~~~~Gv~gi~v~G   42 (294)
T TIGR02313         9 ITPFKRNGDIDEEALRELIEFQIEGGSHAISVGG   42 (294)
T ss_pred             eCCcCCCCCcCHHHHHHHHHHHHHcCCCEEEECc
Confidence            4599999999999999999999999999999988


No 21 
>TIGR00683 nanA N-acetylneuraminate lyase. N-acetylneuraminate lyase is also known as N-acetylneuraminic acid aldolase, sialic acid aldolase, or sialate lyase. It is an intracellular enzyme. The structure of this homotetrameric enzyme related to dihydrodipicolinate synthase is known. In Clostridium tertium, the enzyme appears to be in an operon with a secreted sialidase that releases sialic acid from host sialoglycoconjugates. In several E. coli strains, however, this enzyme is responsible for N-acetyl-D-neuraminic acid synthesis for capsule production by condensing N-acetyl-D-mannosamine and pyruvate.
Probab=80.02  E-value=2.4  Score=31.97  Aligned_cols=33  Identities=21%  Similarity=0.310  Sum_probs=30.8

Q ss_pred             CCCCCCCCCCCchHHHHHHHHhhCC-CCEEEeec
Q psy149           15 GPYTQSDTLSYKPLEDLIALTVQQE-PDVLILIG   47 (86)
Q Consensus        15 GPfT~~d~l~y~pL~~ll~~v~~~~-PdvlIL~G   47 (86)
                      =||+.+.++|++.+..++++..+.. .|-++++|
T Consensus        10 TPf~~dg~iD~~~~~~~i~~~i~~G~v~gi~~~G   43 (290)
T TIGR00683        10 VSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGG   43 (290)
T ss_pred             cCCCCCCCcCHHHHHHHHHHHHhCCCcCEEEECC
Confidence            4999999999999999999999988 99999987


No 22 
>PF00701 DHDPS:  Dihydrodipicolinate synthetase family;  InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants. The enzyme catalyses the condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a ping-pong mechanism in which pyruvate binds to the enzyme by forming a Schiff-base with a lysine residue []. Three other proteins are structurally related to DHDPS and probably also act via a similar catalytic mechanism. These are Escherichia coli N-acetylneuraminate lyase (4.1.3.3 from EC) (gene nanA), which catalyzes the condensation of N-acetyl-D-mannosamine and pyruvate to form N-acetylneuraminate; Rhizobium meliloti (Sinorhizobium meliloti) protein mosA [], which is involved in the biosynthesis of the rhizopine 3-o-methyl-scyllo-inosamine; and E. coli hypothetical protein yjhH. The sequences of DHDPS from different sources are well-conserved. The structure takes the form of a homotetramer, in which 2 monomers are related by an approximate 2-fold symmetry []. Each monomer comprises 2 domains: an 8-fold alpha-/beta-barrel, and a C-terminal alpha-helical domain. The fold resembles that of N-acetylneuraminate lyase. The active site lysine is located in the barrel domain, and has access via 2 channels on the C-terminal side of the barrel.; GO: 0016829 lyase activity, 0008152 metabolic process; PDB: 3B4U_B 3S8H_A 3QZE_B 1XXX_F 3L21_F 3IRD_A 3A5F_B 3G0S_B 3DAQ_C 3UQN_A ....
Probab=79.86  E-value=1.8  Score=32.22  Aligned_cols=38  Identities=18%  Similarity=0.389  Sum_probs=30.7

Q ss_pred             EEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           11 FVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        11 ~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      ....=||+.+.++|++-+.++++++.+...|-++..|-
T Consensus         7 ~~~~TPf~~dg~id~~~~~~~i~~l~~~Gv~gl~~~Gs   44 (289)
T PF00701_consen    7 PALITPFNADGSIDEDALKRLIDFLIEAGVDGLVVLGS   44 (289)
T ss_dssp             EEE---BETTSSB-HHHHHHHHHHHHHTTSSEEEESST
T ss_pred             eeeeCCCCCCcCcCHHHHHHHHHHHHHcCCCEEEECCC
Confidence            34456999999999999999999999999999999885


No 23 
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]
Probab=79.35  E-value=2.6  Score=32.18  Aligned_cols=45  Identities=20%  Similarity=0.427  Sum_probs=37.2

Q ss_pred             CCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCc-CCCHHHH
Q psy149           15 GPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSL-AETFEDF   69 (86)
Q Consensus        15 GPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~-~~t~eel   69 (86)
                      =||+.+..+||+-+..++++..+...|-++.+|          ..|+. ..|.||-
T Consensus        14 TPF~~dg~vD~~a~~~lv~~li~~Gv~gi~~~G----------ttGE~~~Ls~eEr   59 (299)
T COG0329          14 TPFDEDGSVDEEALRRLVEFLIAAGVDGLVVLG----------TTGESPTLTLEER   59 (299)
T ss_pred             cCCCCCCCcCHHHHHHHHHHHHHcCCCEEEECC----------CCccchhcCHHHH
Confidence            499988889999999999999999999999988          34553 4566664


No 24 
>TIGR00674 dapA dihydrodipicolinate synthase. Dihydrodipicolinate synthase is a homotetrameric enzyme of lysine biosynthesis. E. coli has several paralogs closely related to dihydrodipicoline synthase (DapA), as well as the more distant N-acetylneuraminate lyase. In Pyrococcus horikoshii, the bidirectional best hit with E. coli is to an uncharacterized paralog of DapA, not DapA itself, and it is omitted from the seed. The putative members from the Chlamydias (pathogens with a parasitic metabolism) are easily the most divergent members of the multiple alignment.
Probab=77.80  E-value=3.2  Score=30.99  Aligned_cols=34  Identities=21%  Similarity=0.655  Sum_probs=31.2

Q ss_pred             eCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           14 AGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        14 aGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      -=||+.+..+|++.+..+++++.+...|-+..+|
T Consensus         7 ~TPf~~~g~iD~~~~~~~i~~l~~~Gv~Gi~~~G   40 (285)
T TIGR00674         7 ITPFKEDGSVDFAALEKLIDFQIENGTDAIVVVG   40 (285)
T ss_pred             eCCcCCCCCcCHHHHHHHHHHHHHcCCCEEEECc
Confidence            3499999999999999999999999999988887


No 25 
>PF07788 DUF1626:  Protein of unknown function (DUF1626);  InterPro: IPR012431 This is a family consisting of sequences from hypothetical proteins of unknown function expressed by certain species of archaea. One member (Q9YCN7 from SWISSPROT) is thought to be similar to tropomyosin []. 
Probab=76.63  E-value=2.8  Score=26.40  Aligned_cols=29  Identities=24%  Similarity=0.421  Sum_probs=24.7

Q ss_pred             CchHHHHHHHHhhCCCCEEEeeccccCCC
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGPLLDTS   53 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GPFiD~~   53 (86)
                      |..-.+|-+++...+++-+++++||||..
T Consensus        31 f~rk~~lYek~~grk~~r~ivVtp~id~~   59 (70)
T PF07788_consen   31 FKRKAELYEKVHGRKVDRLIVVTPYIDDR   59 (70)
T ss_pred             HHHHHHHHHHHHCCCcceEEEEEeecCHH
Confidence            45556788898899999999999999976


No 26 
>cd07366 3MGA_Dioxygenase Subunit B of the Class III Extradiol ring-cleavage dioxygenase, 3-O-Methylgallate Dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 3-O-Methylgallate. 3-O-Methylgallate Dioxygenase catalyzes the oxidization and subsequent ring-opening of 3-O-Methylgallate (3MGA) between carbons 2 and 3. 3-O-Methylgallate Dioxygenase is a key enzyme in the syringate degradation pathway, in which the syringate is first converted to 3-O-Methylgallate by O-demethylase. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which uses a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.
Probab=76.54  E-value=2.4  Score=33.29  Aligned_cols=31  Identities=19%  Similarity=0.340  Sum_probs=23.7

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc-----ccCCCCcc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP-----LLDTSHPL   56 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP-----FiD~~h~~   56 (86)
                      +.+.++-+.+++.+|||+|++||     |-+..-|.
T Consensus        73 ~a~~~~~~~i~~~~PDvlVIispDH~~~f~~~~~P~  108 (328)
T cd07366          73 AALDRLADFIRAARIDVAVIVGDDQKELFDEALLPA  108 (328)
T ss_pred             HHHHHHHHHHHHhCCCEEEEEcCccHhhhccccCCc
Confidence            45677778888899999999999     55544444


No 27 
>TIGR00583 mre11 DNA repair protein (mre11). All proteins in this family for which functions are known are subunits of a nuclease complex made up of multiple proteins including MRE11 and RAD50 homologs. The functions of this nuclease complex include recombinational repair and non-homolgous end joining. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). The proteins in this family are distantly related to proteins in the SbcCD complex of bacteria.
Probab=76.47  E-value=2.8  Score=33.66  Aligned_cols=34  Identities=21%  Similarity=0.501  Sum_probs=30.6

Q ss_pred             CchHHHHHHHHhhCCCCEEEeeccccCCCCcccc
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLL   58 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~   58 (86)
                      ++-|.++++.+.+++||.|++.|=++|...|..+
T Consensus        28 ~~~f~eil~~a~~~~vD~VLiaGDLFd~~~Ps~~   61 (405)
T TIGR00583        28 WNTFEEVLQIAKEQDVDMILLGGDLFHENKPSRK   61 (405)
T ss_pred             HHHHHHHHHHHHHcCCCEEEECCccCCCCCCCHH
Confidence            5678999999999999999999999999998733


No 28 
>PF06838 Met_gamma_lyase:  Methionine gamma-lyase ;  InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [].; PDB: 3JZL_A 3I16_C 3GWP_A 3FD0_B 3HT4_F.
Probab=76.08  E-value=2.5  Score=34.52  Aligned_cols=44  Identities=23%  Similarity=0.566  Sum_probs=33.1

Q ss_pred             EeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEee----ccccCCCCcc
Q psy149           13 SAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILI----GPLLDTSHPL   56 (86)
Q Consensus        13 AaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~----GPFiD~~h~~   56 (86)
                      =|-=|++..+|+-+-+.++++.|++.+||++|++    |-|++..-|.
T Consensus       162 RSrGYs~R~sl~i~~I~~~i~~vk~~~p~~iifVDNCYGEFvE~~EP~  209 (403)
T PF06838_consen  162 RSRGYSWRPSLTIEEIKEIIKFVKEINPDVIIFVDNCYGEFVETQEPT  209 (403)
T ss_dssp             -S-TTSSS----HHHHHHHHHHHHHH-TTSEEEEE-TTTTTTSSS-GG
T ss_pred             cCCCCCCCCCCCHHHHHHHHHHHHhhCCCeEEEEeCCcceeccccCcc
Confidence            3556999999999999999999999999999996    9999988864


No 29 
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea. This subfamily of enzymes is adapted for high thermostability and shows specificity for non-phosphorylated substrates. The enzyme catalyses the reversible aldol cleavage of 2-keto-3-dexoygluconate to pyruvate and glyceraldehyde, the third step of a modified non-phosphorylated Entner-Doudoroff pathway of glucose oxidation. KDG aldolase shows no significant sequence similarity to microbial 2-keto-3-deoxyphosphogluconate (KDPG) aldolases, and the enzyme shows no activity with glyceraldehyde 3-phosphate as substrate. The enzyme is a tetramer and a member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=75.90  E-value=3.5  Score=30.88  Aligned_cols=32  Identities=13%  Similarity=0.304  Sum_probs=30.2

Q ss_pred             CCCCCCCCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           15 GPYTQSDTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        15 GPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      =||+. .++|++.+.++++++.+...|-++.+|
T Consensus        10 TPf~~-g~iD~~~~~~li~~l~~~Gv~Gl~~~G   41 (279)
T cd00953          10 TPFTG-NKIDKEKFKKHCENLISKGIDYVFVAG   41 (279)
T ss_pred             cCcCC-CCcCHHHHHHHHHHHHHcCCcEEEEcc
Confidence            59997 999999999999999999999999988


No 30 
>cd07365 MhpB_like Subunit B of the Class III Extradiol ring-cleavage dioxygenase, 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB), which catalyzes the oxidization and subsequent ring-opening of 2,3-dihydroxyphenylpropionate. 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB) catalyzes the oxidization and subsequent ring-opening of 2,3-dihydroxyphenylpropionate, yielding the product 2-hydroxy-6-oxo-nona-2,4-diene 1,9-dicarboxylate.  It is an essential enzyme in the beta-phenylpropionic degradation pathway, in which beta-phenylpropionic is first hydrolyzed to produce 2,3-dihydroxyphenylpropionate. The enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the ca
Probab=75.84  E-value=2.6  Score=32.66  Aligned_cols=22  Identities=18%  Similarity=0.434  Sum_probs=16.5

Q ss_pred             HHHHHHHHhhCCCCEEEeeccc
Q psy149           28 LEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      +.++-+.+.+.+||++|++||=
T Consensus        31 ~~~l~~~l~~~~PD~iVIigph   52 (310)
T cd07365          31 FAAARAFVAAFDPELVVLFAPD   52 (310)
T ss_pred             HHHHHHHHHHcCCCEEEEEcCC
Confidence            3445556666889999999994


No 31 
>PRK10966 exonuclease subunit SbcD; Provisional
Probab=75.63  E-value=3.8  Score=32.66  Aligned_cols=29  Identities=28%  Similarity=0.507  Sum_probs=25.1

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCCCCcc
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDTSHPL   56 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~~h~~   56 (86)
                      |..+++.+++.+||+||+.|=++|...|.
T Consensus        28 l~~l~~~i~~~~~D~viIaGDifD~~~p~   56 (407)
T PRK10966         28 LDWLLEQVQEHQVDAIIVAGDIFDTGSPP   56 (407)
T ss_pred             HHHHHHHHHhcCCCEEEECCccccCCCCc
Confidence            56788889999999999999999987653


No 32 
>PRK13363 protocatechuate 4,5-dioxygenase subunit beta; Provisional
Probab=74.79  E-value=3.3  Score=32.58  Aligned_cols=22  Identities=18%  Similarity=0.332  Sum_probs=18.7

Q ss_pred             hHHHHHHHHhhCCCCEEEeecc
Q psy149           27 PLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      .+.++-+.+++.+||++|++||
T Consensus        76 a~~~~~~~i~~~~PDvlViisp   97 (335)
T PRK13363         76 AIERMRDAIEAARIDVAVIVGN   97 (335)
T ss_pred             HHHHHHHHHHHhCCCEEEEEcC
Confidence            4666777888899999999988


No 33 
>PHA02546 47 endonuclease subunit; Provisional
Probab=74.53  E-value=4.6  Score=31.12  Aligned_cols=29  Identities=17%  Similarity=0.240  Sum_probs=25.6

Q ss_pred             chHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      +-|..+++++++++||+||+.|=++|...
T Consensus        26 ~~l~~ii~~a~~~~vD~VliaGDlfD~~~   54 (340)
T PHA02546         26 KFIKQAIEYSKAHGITTWIQLGDTFDVRK   54 (340)
T ss_pred             HHHHHHHHHHHHcCCCEEEECCcccCCCC
Confidence            45788899999999999999999999853


No 34 
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair]
Probab=73.88  E-value=3.7  Score=31.73  Aligned_cols=35  Identities=23%  Similarity=0.514  Sum_probs=31.4

Q ss_pred             CCchHHHHHHHHhhCCCCEEEeeccccCCCCcccc
Q psy149           24 SYKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLL   58 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~   58 (86)
                      .|.-|.++++.+.++++|+||.-|=..|...|..+
T Consensus        25 ~~~~f~~~l~~a~~~~vD~vliAGDlFd~~~Ps~~   59 (390)
T COG0420          25 QKKAFDELLEIAKEEKVDFVLIAGDLFDTNNPSPR   59 (390)
T ss_pred             HHHHHHHHHHHHHHccCCEEEEccccccCCCCCHH
Confidence            35678899999999999999999999999998865


No 35 
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain. Mre11 (also known as SbcD in Escherichia coli) is a subunit of the MRX protein complex. This complex includes: Mre11, Rad50, and Xrs2/Nbs1, and plays a vital role in several nuclear processes including DNA double-strand break repair, telomere length maintenance, cell cycle checkpoint control, and meiotic recombination, in eukaryotes.  During double-strand break repair, the MRX complex is required to hold the two ends of a broken chromosome together.  In vitro studies show that Mre11 has 3'-5' exonuclease activity on dsDNA templates and endonuclease activity on dsDNA and ssDNA templates. In addition to the N-terminal phosphatase domain, the eukaryotic MRE11 members of this family have a C-terminal DNA binding domain (not included in this alignment model).  MRE11-like proteins are found in prokaryotes and archaea was well as in eukaryotes.  Mre11 belongs to the metallophosphatase (MPP) superfamily.  MPPs are functi
Probab=72.98  E-value=5  Score=27.59  Aligned_cols=30  Identities=20%  Similarity=0.699  Sum_probs=26.3

Q ss_pred             CchHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      ++-|..+++.+++.+||.+|+.|=++|...
T Consensus        27 ~~~~~~~~~~~~~~~~d~i~~~GD~~~~~~   56 (223)
T cd00840          27 FEAFEEIVELAIEEKVDFVLIAGDLFDSNN   56 (223)
T ss_pred             HHHHHHHHHHHHhcCCCEEEECCcccCCCC
Confidence            445889999999999999999999998765


No 36 
>PF03808 Glyco_tran_WecB:  Glycosyl transferase WecB/TagA/CpsF family;  InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway.; GO: 0009058 biosynthetic process
Probab=71.82  E-value=8.6  Score=26.80  Aligned_cols=33  Identities=18%  Similarity=0.374  Sum_probs=25.0

Q ss_pred             ceeEE-EEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEe
Q psy149            7 SLSMF-VSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus         7 ~l~i~-vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .++|+ ..+|||+.      +-..++++.|++.+||+|++
T Consensus        74 ~l~ivg~~~g~f~~------~~~~~i~~~I~~~~pdiv~v  107 (172)
T PF03808_consen   74 GLRIVGYHHGYFDE------EEEEAIINRINASGPDIVFV  107 (172)
T ss_pred             CeEEEEecCCCCCh------hhHHHHHHHHHHcCCCEEEE
Confidence            56676 45677722      36789999999999998876


No 37 
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain. This domain binds to B12 (adenosylcobamide), which initiates the conversion of succinyl CoA and methylmalonyl CoA by forming an adenosyl radical, which then undergoes a rearrangement exchanging a hydrogen atom with a group attached to a neighboring carbon atom. This family is present in both mammals and bacteria. Bacterial members are heterodimers and involved in the fermentation of pyruvate to propionate. Mammalian members are homodimers and responsible for the conversion of odd-chain fatty acids and branched-chain amino acids via propionyl CoA to succinyl CoA for further degradation.
Probab=71.60  E-value=7.9  Score=25.40  Aligned_cols=23  Identities=22%  Similarity=0.385  Sum_probs=19.1

Q ss_pred             CchHHHHHHHHhhCCCCEEEeec
Q psy149           25 YKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      +.|..++++.+.+.+||++.+.+
T Consensus        36 ~vp~e~~~~~a~~~~~d~V~iS~   58 (122)
T cd02071          36 RQTPEEIVEAAIQEDVDVIGLSS   58 (122)
T ss_pred             CCCHHHHHHHHHHcCCCEEEEcc
Confidence            34888999999999999998854


No 38 
>COG2350 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=71.24  E-value=5.1  Score=26.20  Aligned_cols=28  Identities=39%  Similarity=0.587  Sum_probs=18.6

Q ss_pred             EEEeeccccCCCCccccCCCc----CCCHHHHHH
Q psy149           42 VLILIGPLLDTSHPLLLNGSL----AETFEDFYV   71 (86)
Q Consensus        42 vlIL~GPFiD~~h~~i~~g~~----~~t~eelF~   71 (86)
                      .++..|||.|.+---  .|..    ..+.+|-|.
T Consensus        36 ~ll~sGP~~~~dg~~--~~s~~i~ea~~l~da~~   67 (92)
T COG2350          36 RLLTSGPFPDRDGGP--TGSLVIAEAESLEDAFA   67 (92)
T ss_pred             eEEEeCCCCCCCCCC--ccceEEEeccchhhHHH
Confidence            999999999988633  1111    456666554


No 39 
>TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family. The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway.
Probab=71.17  E-value=8.2  Score=27.53  Aligned_cols=33  Identities=12%  Similarity=0.254  Sum_probs=24.5

Q ss_pred             ceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEe
Q psy149            7 SLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus         7 ~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .+.|+-.+|||..+      --.++++.|++.+||+|++
T Consensus        74 ~l~i~g~~g~f~~~------~~~~i~~~I~~s~~dil~V  106 (177)
T TIGR00696        74 KLKIVGAFGPLEPE------ERKAALAKIARSGAGIVFV  106 (177)
T ss_pred             CCEEEEECCCCChH------HHHHHHHHHHHcCCCEEEE
Confidence            45666557998533      3367999999999998775


No 40 
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
Probab=71.06  E-value=8.5  Score=26.87  Aligned_cols=33  Identities=18%  Similarity=0.296  Sum_probs=24.6

Q ss_pred             ceeEEE-EeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEe
Q psy149            7 SLSMFV-SAGPYTQSDTLSYKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus         7 ~l~i~v-AaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .++|+- .+|||..+      ...++++.|++.+||+|++
T Consensus        72 ~l~i~g~~~g~~~~~------~~~~i~~~I~~~~pdiv~v  105 (171)
T cd06533          72 GLKIVGYHHGYFGPE------EEEEIIERINASGADILFV  105 (171)
T ss_pred             CcEEEEecCCCCChh------hHHHHHHHHHHcCCCEEEE
Confidence            456655 57777754      4456999999999998876


No 41 
>CHL00073 chlN photochlorophyllide reductase subunit N
Probab=70.72  E-value=5.2  Score=32.85  Aligned_cols=33  Identities=24%  Similarity=0.326  Sum_probs=27.7

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCc
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSL   62 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~   62 (86)
                      -+.++.+.+++.+||++| .|  ++..+|+++.|--
T Consensus       379 D~~el~~~i~~~~pDLlI-gG--~~~~~Pl~~~G~p  411 (457)
T CHL00073        379 DNYNQIQRIRELQPDLAI-TG--MAHANPLEARGIN  411 (457)
T ss_pred             CHHHHHHHHhhCCCCEEE-cc--ccccCchhhcCCc
Confidence            477888899999999988 66  3999999998853


No 42 
>cd07359 PCA_45_Doxase_B_like Subunit B of the Class III Extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, and simlar enzymes. This subfamily of class III extradiol dioxygenases consists of a number of proteins with known enzymatic activities: Protocatechuate (PCA) 4,5-dioxygenase (LigAB), 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB), 3-O-Methylgallate Dioxygenase, 2-aminophenol 1,6-dioxygenase, as well as proteins without any known enzymatic activity. These proteins play essential roles in the degradation of aromatic compounds by catalyzing the incorporation of both atoms of molecular oxygen into their preferred substrates. As members of the Class III extradiol dioxygenase family, the enzymes use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model repres
Probab=69.88  E-value=5.5  Score=29.50  Aligned_cols=23  Identities=17%  Similarity=0.400  Sum_probs=17.9

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +.|.++-+.+.+.+||++|++||
T Consensus        31 ~~l~~~~~~l~~~~Pd~ivvis~   53 (271)
T cd07359          31 AAFARIRDRLEAARPDVVVVVGN   53 (271)
T ss_pred             HHHHHHHHHHHHhCCCEEEEEeC
Confidence            44556666666679999999999


No 43 
>PRK13370 mhpB 3-(2,3-dihydroxyphenyl)propionate dioxygenase; Provisional
Probab=69.17  E-value=4.6  Score=31.40  Aligned_cols=23  Identities=13%  Similarity=0.419  Sum_probs=17.7

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +.+.++-+.+.+.+||++|++||
T Consensus        29 ~a~~~l~~~l~~~~PD~iVIigp   51 (313)
T PRK13370         29 AVIAAAREFVAAFDPELVVLFAP   51 (313)
T ss_pred             HHHHHHHHHHHHhCCCEEEEEcC
Confidence            34455666667788999999999


No 44 
>PF02310 B12-binding:  B12 binding domain;  InterPro: IPR006158  The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin). Cobalamin-binding domains are mainly found in two families of enzymes present in animals and prokaryotes, which perform distinct kinds of reactions at the cobalt-carbon bond. Enzymes that require methylcobalamin carry out methyl transfer reactions. Enzymes that require adenosylcobalamin catalyse reactions in which the first step is the cleavage of adenosylcobalamin to form cob(II)alamin and the 5'-deoxyadenosyl radical, and thus act as radical generators. In both types of enzymes the B12-binding domain uses a histidine to bind the cobalt atom of cobalamin cofactors. This histidine is embedded in a DXHXXG sequence, the most conserved primary sequence motif of the domain [, , ]. Proteins containing the cobalamin-binding domain include:    Animal and prokaryotic methionine synthase (2.1.1.13 from EC), which catalyse the transfer of a methyl group from methyl-cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Animal and prokaryotic methylmalonyl-CoA mutase (5.4.99.2 from EC), which are involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle.  Prokaryotic lysine 5,6-aminomutase (5.4.3.4 from EC).  Prokaryotic glutamate mutase (5.4.99.1 from EC) [].  Prokaryotic methyleneglutarate mutase (5.4.99.4 from EC).  Prokaryotic isobutyryl-CoA mutase (5.4.99.13 from EC).    The core structure of the cobalamin-binding domain is characterised by a five-stranded alpha/beta (Rossmann) fold, which consists of 5 parallel beta-sheets surrounded by 4-5 alpha helices in three layers (alpha/beta/alpha) []. Upon binding cobalamin, important elements of the binding site appear to become structured, including an alpha-helix that forms on one side of the cleft accommodating the nucleotide 'tail' of the cofactor. In cobalamin, the cobalt atom can be either free (dmb-off) or bound to dimethylbenzimidazole (dmb-on) according to the pH. When bound to the cobalamin-binding domain, the dimethylbenzimidazole ligand is replaced by the active histidine (His-on) of the DXHXXG motif. The replacement of dimethylbenzimidazole by histidine allows switching between the catalytic and activation cycles []. In methionine synthase the cobalamin cofactor is sandwiched between the cobalamin-binding domain and an approximately 90 residues N-terminal domain forming a helical bundle comprising two pairs of antiparallel helices []. In methionine synthase, there is a second, adjacent domain involved in cobalamin binding that forms a 4-helical bundle cap (IPR003759 from INTERPRO); in the conversion to the active conformation of this enzyme, the 4-helical cap rotates to allow the cobalamin cofactor to bind the activation domain (IPR004223 from INTERPRO) [].; GO: 0031419 cobalamin binding, 0046872 metal ion binding; PDB: 1Y80_A 3BUL_A 1K7Y_A 1BMT_A 3IV9_A 1K98_A 3IVA_A 3KP1_A 3KOW_A 3KOZ_A ....
Probab=68.98  E-value=5.9  Score=25.03  Aligned_cols=22  Identities=14%  Similarity=0.324  Sum_probs=13.2

Q ss_pred             CchHHHHHHHHhhCCCCEEEee
Q psy149           25 YKPLEDLIALTVQQEPDVLILI   46 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~   46 (86)
                      +....++++.+++..|++.|++
T Consensus        65 ~~~~~~l~~~~k~~~p~~~iv~   86 (121)
T PF02310_consen   65 LPEAKRLARAIKERNPNIPIVV   86 (121)
T ss_dssp             HHHHHHHHHHHHTTCTTSEEEE
T ss_pred             HHHHHHHHHHHHhcCCCCEEEE
Confidence            4556666666666777744433


No 45 
>cd07368 PhnC_Bs_like PhnC is a Class III Extradiol ring-cleavage dioxygenase involved in the polycyclic aromatic hydrocarbon (PAH) catabolic pathway. This subfamily is composed of Burkholderia sp. PhnC and similar poteins. PhnC is one of nine protein products encoded by the phn locus. These proteins are involved in the polycyclic aromatic hydrocarbon (PAH) catabolic pathway. PhnC is a member of the class III extradiol dioxygenase family, a group os enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.
Probab=68.84  E-value=5.9  Score=29.94  Aligned_cols=22  Identities=9%  Similarity=0.090  Sum_probs=19.0

Q ss_pred             chHHHHHHHHhhCCCCEEEeec
Q psy149           26 KPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      +.+.++-+.+++.+||++|++|
T Consensus        33 ~a~~~~~~~v~~~~pD~ivvi~   54 (277)
T cd07368          33 HAYAICAERLAALQVTSVVVIG   54 (277)
T ss_pred             HHHHHHHHHHHHcCCCEEEEEc
Confidence            5677777888899999999998


No 46 
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain. The small subunit of the archeal DNA polymerase II contains a C-terminal metallophosphatase domain.  This domain is thought to be functionally active because the active site residues required for phosphoesterase activity in other members of this superfamily are intact.  The archeal replicative DNA polymerases are thought to possess intrinsic phosphatase activity that hydrolyzes the pyrophosphate released during nucleotide polymerization.  This domain belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiestera
Probab=67.32  E-value=8.1  Score=27.89  Aligned_cols=28  Identities=21%  Similarity=0.351  Sum_probs=22.7

Q ss_pred             chHHHHHHHHhhC-----CCCEEEeeccccCCC
Q psy149           26 KPLEDLIALTVQQ-----EPDVLILIGPLLDTS   53 (86)
Q Consensus        26 ~pL~~ll~~v~~~-----~PdvlIL~GPFiD~~   53 (86)
                      ..+..|+++++..     +||.||++|-++|..
T Consensus        17 ~~~~~l~~~l~~~~~~~~~~d~lvi~GDl~d~~   49 (243)
T cd07386          17 DAFEKFVRWLNGEDDSASRVKYLIIAGDLVDGI   49 (243)
T ss_pred             HHHHHHHHHHcCCcccccCccEEEEeCCccccc
Confidence            3567788888775     459999999999985


No 47 
>PF08660 Alg14:  Oligosaccharide biosynthesis protein Alg14 like;  InterPro: IPR013969  Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane []. 
Probab=67.07  E-value=6.5  Score=27.78  Aligned_cols=16  Identities=38%  Similarity=0.715  Sum_probs=13.2

Q ss_pred             HHHhhCCCCEEEeecc
Q psy149           33 ALTVQQEPDVLILIGP   48 (86)
Q Consensus        33 ~~v~~~~PdvlIL~GP   48 (86)
                      ..+.++|||++|..||
T Consensus        86 ~il~r~rPdvii~nGp  101 (170)
T PF08660_consen   86 RILRRERPDVIISNGP  101 (170)
T ss_pred             HHHHHhCCCEEEEcCC
Confidence            3446689999999999


No 48 
>PRK13373 putative dioxygenase; Provisional
Probab=66.26  E-value=5.4  Score=31.92  Aligned_cols=23  Identities=22%  Similarity=0.187  Sum_probs=18.9

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +.+.++=+.+++.+|||+|++|+
T Consensus        33 ~a~~~ir~~i~e~kPDVvVv~~n   55 (344)
T PRK13373         33 QAADRLGRSLDAARPDVIIAFLD   55 (344)
T ss_pred             HHHHHHHHHHHHhCCCEEEEEcc
Confidence            44666777788899999999987


No 49 
>PF08759 DUF1792:  Domain of unknown function (DUF1792);  InterPro: IPR014869 This domain is found at the C terminus of proteins such as Q97P75 from SWISSPROT that also contain the glycosyl transferase domain at the N terminus. Sometimes it is found independently. 
Probab=66.18  E-value=6.1  Score=29.93  Aligned_cols=25  Identities=20%  Similarity=0.587  Sum_probs=22.1

Q ss_pred             CCchHHHHHHHHhhCCCC--EEEeecc
Q psy149           24 SYKPLEDLIALTVQQEPD--VLILIGP   48 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~Pd--vlIL~GP   48 (86)
                      -|+-.+++++.+++...|  +||++||
T Consensus       151 Af~~~d~I~~~i~~~~~~~LiLiaLGP  177 (225)
T PF08759_consen  151 AFSKYDEILEAIKKYAKDKLILIALGP  177 (225)
T ss_pred             hHHHHHHHHHHHHHhCCCcEEEEecCC
Confidence            588999999999999888  6777899


No 50 
>PRK13364 protocatechuate 4,5-dioxygenase subunit beta; Provisional
Probab=66.17  E-value=5.9  Score=30.28  Aligned_cols=23  Identities=13%  Similarity=0.261  Sum_probs=20.2

Q ss_pred             CchHHHHHHHHhhCCCCEEEeec
Q psy149           25 YKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      ++-+.++-+.+++.+||++|++|
T Consensus        34 ~~a~~~~~~~v~~~~PDvvVvis   56 (278)
T PRK13364         34 FDGFPPVREWLEKVKPDVAVVFY   56 (278)
T ss_pred             HHHHHHHHHHHHHhCCCEEEEEC
Confidence            56677788888899999999999


No 51 
>PRK13358 protocatechuate 4,5-dioxygenase subunit beta; Provisional
Probab=65.90  E-value=6  Score=29.42  Aligned_cols=23  Identities=26%  Similarity=0.491  Sum_probs=16.7

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +-|+++-+.+.+.+||++|++||
T Consensus        29 ~~l~~~~~~l~~~~Pd~iViis~   51 (269)
T PRK13358         29 EGMREIGRRLRELRPDVLVVIGS   51 (269)
T ss_pred             HHHHHHHHHHHHcCCCEEEEEeC
Confidence            34455555555579999999999


No 52 
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA). HBPHA catalyzes HBP to salicyaldehyde and pyruvate. This reaction is part of the degradative pathways for naphthalene and naphthalenesulfonates by bacteria. CBPHA is homologous to HBPHA and catalyzes the cleavage of CBP to 2-carboxylbenzaldehyde and pyruvate during the degradation of phenanthrene. They are member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=65.79  E-value=8.2  Score=29.42  Aligned_cols=33  Identities=18%  Similarity=0.319  Sum_probs=29.6

Q ss_pred             CCCCCC-------CCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           15 GPYTQS-------DTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        15 GPfT~~-------d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      =||+.+       .++||+.|..+++++.....|-++.+|
T Consensus        11 TPf~~~~~~~~~~g~iD~~~l~~lv~~li~~Gv~Gi~v~G   50 (309)
T cd00952          11 TPSKPDASDWRATDTVDLDETARLVERLIAAGVDGILTMG   50 (309)
T ss_pred             cCccCCccccccCCCcCHHHHHHHHHHHHHcCCCEEEECc
Confidence            488875       489999999999999999999999887


No 53 
>TIGR00215 lpxB lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA
Probab=65.70  E-value=7.8  Score=30.07  Aligned_cols=22  Identities=32%  Similarity=0.514  Sum_probs=16.6

Q ss_pred             HHHHHHhhCCCCEEEeeccccCC
Q psy149           30 DLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        30 ~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      +..+.+++.|||+||++| +.+.
T Consensus        80 ~~~~~l~~~kPd~vi~~g-~~~~  101 (385)
T TIGR00215        80 EVVQLAKQAKPDLLVGID-APDF  101 (385)
T ss_pred             HHHHHHHhcCCCEEEEeC-CCCc
Confidence            334556789999999999 7553


No 54 
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain. YydB (BSU40220) is an uncharacterized Bacillus subtilis protein that  belongs to the following Bacillus subtilis gene cluster yydB-yydC-yydD-yydG-yydH-yydI-yydJ.  YydB belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productiv
Probab=64.77  E-value=9.7  Score=24.68  Aligned_cols=27  Identities=26%  Similarity=0.500  Sum_probs=22.8

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      |..+++.+++.+||.+|++|=++|..-
T Consensus        24 l~~~~~~~~~~~~d~vi~~GDl~~~~~   50 (144)
T cd07400          24 LDRLLAEIKALDPDLVVITGDLTQRGL   50 (144)
T ss_pred             HHHHHHHHhccCCCEEEECCCCCCCCC
Confidence            556888899999999999999988643


No 55 
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain. Acid sphingomyelinase (ASMase) is a ubiquitously expressed phosphodiesterase which hydrolyzes sphingomyelin in acid pH conditions to form ceramide, a bioactive second messenger, as part of the sphingomyelin signaling pathway.  ASMase is localized at the noncytosolic leaflet of biomembranes (for example the luminal leaflet of endosomes, lysosomes and phagosomes, and the extracellular leaflet of plasma membranes).  ASMase-deficient humans develop Niemann-Pick disease. This disease is characterized by lysosomal storage of sphingomyelin in all tissues.  Although ASMase-deficient mice are resistant to stress-induced apoptosis, they have greater susceptibility to bacterial infection. The latter correlates with defective phagolysosomal fusion and antibacterial killing activity in ASMase-deficient macrophages.  ASMase belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but
Probab=64.25  E-value=8.7  Score=28.29  Aligned_cols=43  Identities=19%  Similarity=0.418  Sum_probs=33.2

Q ss_pred             EEeCCCCCCC-CCCCchHHHHHHHHhhC--CCCEEEeeccccCCCC
Q psy149           12 VSAGPYTQSD-TLSYKPLEDLIALTVQQ--EPDVLILIGPLLDTSH   54 (86)
Q Consensus        12 vAaGPfT~~d-~l~y~pL~~ll~~v~~~--~PdvlIL~GPFiD~~h   54 (86)
                      .++|||..-. +..+.-+...++.+++.  +||.+|..|=.++...
T Consensus        38 ~~~~~~G~~~CD~p~~l~~s~l~~i~~~~~~~dfii~tGD~v~h~~   83 (296)
T cd00842          38 PPAGPWGDYGCDSPWRLVESALEAIKKNHPKPDFILWTGDLVRHDV   83 (296)
T ss_pred             CCCCCCcCcCCCCcHHHHHHHHHHHHHhCCCCCEEEEcCCCCCCCc
Confidence            4577777664 45567788999999997  9999999996665543


No 56 
>PTZ00235 DNA polymerase epsilon subunit B; Provisional
Probab=63.60  E-value=17  Score=28.41  Aligned_cols=64  Identities=14%  Similarity=0.267  Sum_probs=36.7

Q ss_pred             eeEEEEeCCCCCCCCCCCchHHHHHHHHh-h----CCCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHH
Q psy149            8 LSMFVSAGPYTQSDTLSYKPLEDLIALTV-Q----QEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLI   74 (86)
Q Consensus         8 l~i~vAaGPfT~~d~l~y~pL~~ll~~v~-~----~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i   74 (86)
                      .+++|- |=--.++--..+.|..+++... .    +.|-+.||||.|...  |....+.-...+.+-|.+.-
T Consensus        28 ~~~Vil-SDV~LD~p~tl~~L~kvf~~y~~~~~~~~~P~~fVL~GnF~S~--p~~~~~~~~~~yk~~Fd~La   96 (291)
T PTZ00235         28 HNWIIM-HDVYLDSPYTFEVLDKMLSLYVNTYPENELPVGFIFMGDFISL--KFDYNRNFHKVYIKGFEKLS   96 (291)
T ss_pred             eEEEEE-EeeccCCHHHHHHHHHHHHHhhccCcccCCCeEEEEecCccCC--cccCCCCchHHHHHHHHHHH
Confidence            444444 3222333344577888887763 2    459999999999855  43322223334556665543


No 57 
>cd07320 Extradiol_Dioxygenase_3B_like Subunit B of Class III Extradiol ring-cleavage dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site of the aromatic ring. Intradiol enzymes cleave the aromatic ring between two hydroxyl groups, whereas extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Extradiol dioxygenases can be further divided into three classes. Class I and II enzymes are evolutionary related and show sequence similarity, with the two-domain class II enzymes evolving from the class I enzyme through gene duplication. Class III enzymes are different in sequence and structure and usually have two subunits, designated A and B. This model represents the catalytic subunit B of extradiol dioxygenase class
Probab=63.08  E-value=8.7  Score=27.88  Aligned_cols=25  Identities=16%  Similarity=0.287  Sum_probs=20.0

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      .+.++-+.+++.+||++|++||==.
T Consensus        25 ~~~~~~~~~~~~~pd~iviis~hh~   49 (260)
T cd07320          25 QPIEISKRIKEKRPDTIIVVSPHHL   49 (260)
T ss_pred             HHHHHHHHHHHhCCCEEEEEeCCcc
Confidence            4777777787789999999997444


No 58 
>COG1409 Icc Predicted phosphohydrolases [General function prediction only]
Probab=62.30  E-value=8  Score=27.29  Aligned_cols=27  Identities=37%  Similarity=0.477  Sum_probs=23.7

Q ss_pred             CCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           21 DTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        21 d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      .....+-+.++++.|+..+||.||+.|
T Consensus        15 ~~~~~~~~~~~~~~i~~~~~D~~v~tG   41 (301)
T COG1409          15 GVDSEELLEALLAAIEQLKPDLLVVTG   41 (301)
T ss_pred             ccchHHHHHHHHHHHhcCCCCEEEEcc
Confidence            455667899999999999999999999


No 59 
>cd02067 B12-binding B12 binding domain (B12-BD). This domain binds different cobalamid derivates, like B12 (adenosylcobamide) or methylcobalamin or methyl-Co(III) 5-hydroxybenzimidazolylcobamide, it is found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase. Cobalamin undergoes a conformational change on binding the protein; the dimethylbenzimidazole group, which is coordinated to the cobalt in the free cofactor, moves away from the corrin and is replaced by a histidine contributed by the protein. The sequence Asp-X-His-X-X-Gly, which contains this histidine ligand, is conserved in many cobalamin-binding proteins.
Probab=61.73  E-value=8.3  Score=24.70  Aligned_cols=20  Identities=10%  Similarity=0.135  Sum_probs=10.4

Q ss_pred             CCchHHHHHHHHhhCCC-CEE
Q psy149           24 SYKPLEDLIALTVQQEP-DVL   43 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~P-dvl   43 (86)
                      .+..+.++++.+++..| ++.
T Consensus        63 ~~~~~~~~i~~l~~~~~~~~~   83 (119)
T cd02067          63 HMTLMKEVIEELKEAGLDDIP   83 (119)
T ss_pred             cHHHHHHHHHHHHHcCCCCCe
Confidence            34455555555555555 543


No 60 
>cd07951 ED_3B_N_AMMECR1 The N-terminal domain, an extradiol dioxygenase class III subunit B-like domain, of unknown proteins containing a C-terminal AMMECR1 domain. This subfamily is composed of uncharacterized proteins containing an N-terminal domain with similarity to the catalytic B subunit of class III extradiol dioxygenases and a C-terminal AMMECR1-like domain. This model represents the N-terminal domain. Class III extradiol dioxygenases use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon, however, proteins in this subfamily do not contain a potential metal binding site and may not exhibit class III extradiol dioxygenase-like activity. The AMMECR1 protein was proposed to be a regulatory factor that is potentially involved in the development of AMME contiguous gene deletion syndrome.
Probab=61.61  E-value=10  Score=27.70  Aligned_cols=21  Identities=19%  Similarity=0.428  Sum_probs=14.8

Q ss_pred             HHHHHHHHhhCCCCEEEeecc
Q psy149           28 LEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GP   48 (86)
                      |.++-+.+.+.+||++|++||
T Consensus        27 ~~~~~~~l~~~~pd~ivvvg~   47 (256)
T cd07951          27 CEAAARRLAAARPDTIVVVSP   47 (256)
T ss_pred             HHHHHHHHHHcCCCEEEEECC
Confidence            334444444479999999999


No 61 
>cd07950 Gallate_Doxase_N The N-terminal domain of the Class III extradiol dioxygenase, Gallate Dioxygenase, which catalyzes the oxidization and subsequent ring-opening of gallate. Gallate Dioxygenase catalyzes the oxidization and subsequent ring-opening of gallate, an intermediate in the degradation of the aromatic compound, syringate. The reaction product of gallate dioxygenase is 4-oxalomesaconate. The amino acid sequence of the N-terminal and C-terminal regions of gallate dioxygenase exhibits homology with the sequence of PCA 4,5-dioxygenase B (catalytic) and A subunits, respectively. The enzyme is estimated to be a homodimer according to the Escherichia coli enzyme. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. In this subfamily, the subunits A and B are fused to make a single polypeptide chain. The dimer interface for this subfamily may resemble the tetramer interface of classical LigAB en
Probab=61.46  E-value=8  Score=29.38  Aligned_cols=23  Identities=26%  Similarity=0.475  Sum_probs=20.0

Q ss_pred             CchHHHHHHHHhhCCCCEEEeec
Q psy149           25 YKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      ++-+.++-+++++.+||++|+++
T Consensus        34 ~~a~~~~~~~i~~~~PD~iVvi~   56 (277)
T cd07950          34 FDGYEPVKQWLAEQKPDVLFMVY   56 (277)
T ss_pred             HHHHHHHHHHHHHhCCCEEEEEc
Confidence            45677888888999999999999


No 62 
>PF14582 Metallophos_3:  Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A.
Probab=61.46  E-value=6.4  Score=30.38  Aligned_cols=41  Identities=20%  Similarity=0.429  Sum_probs=27.4

Q ss_pred             ceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCC
Q psy149            7 SLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus         7 ~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      +=+|+..|+|=.     +++-|..|++.+.+.+||+|+++|=.+-.
T Consensus         5 ~~kilA~s~~~g-----~~e~l~~l~~~~~e~~~D~~v~~G~~~~~   45 (255)
T PF14582_consen    5 VRKILAISNFRG-----DFELLERLVEVIPEKGPDAVVFVGDLLKA   45 (255)
T ss_dssp             --EEEEEE--TT------HHHHHHHHHHHHHHT-SEEEEES-SS-T
T ss_pred             chhheeecCcch-----HHHHHHHHHhhccccCCCEEEEecccccc
Confidence            346666666643     46889999999999999999999977644


No 63 
>PRK09453 phosphodiesterase; Provisional
Probab=60.95  E-value=11  Score=25.93  Aligned_cols=30  Identities=27%  Similarity=0.278  Sum_probs=26.2

Q ss_pred             CCCchHHHHHHHHhhCCCCEEEeeccccCC
Q psy149           23 LSYKPLEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      .++..+..+++.+++.+||.+|++|=++|.
T Consensus        11 g~~~~~~~~l~~~~~~~~d~ii~lGDi~~~   40 (182)
T PRK09453         11 GSLPATEKALELFAQSGADWLVHLGDVLYH   40 (182)
T ss_pred             CCHHHHHHHHHHHHhcCCCEEEEccccccc
Confidence            346788999999999999999999999884


No 64 
>PF02900 LigB:  Catalytic LigB subunit of aromatic ring-opening dioxygenase;  InterPro: IPR004183 Dioxygenases catalyse the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms. Cleavage of aromatic rings is one of the most important functions of dioxygenases, which play key roles in the degradation of aromatic compounds. The substrates of ring-cleavage dioxygenases can be classified into two groups according to the mode of scission of the aromatic ring. Intradiol enzymes (IPR000627 from INTERPRO) use a non-haem Fe(III) to cleave the aromatic ring between two hydroxyl groups (ortho-cleavage), whereas extradiol enzymes use a non-haem Fe(II) to cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon (meta-cleavage) [, ]. These two subfamilies differ in sequence, structural fold, iron ligands, and the orientation of second sphere active site amino acid residues. Extradiol dioxygenases are usually homo-multimeric, bind one atom of ferrous ion per subunit and have a subunit size of about 33 kDa. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes (IPR000486 from INTERPRO) show sequence similarity, with the two-domain class II enzymes having evolved from a class I enzyme through gene duplication. Class III enzymes are different in sequence and structure, but they do share several common active-site characteristics with the class II enzymes, in particular the coordination sphere and the disposition of the putative catalytic base are very similar. Class III enzymes usually have two subunits, designated A and B. Enzymes that belong to the extradiol class III family include Protocatechuate 4,5-dioxygenase (4,5-PCD; LigAB) (1.13.11.8 from EC) []; and 2'-aminobiphenyl-2,3-diol 1,2-dioxygenase (CarBaBb) []. The crystal structure of dioxygenase LigAB revealed that the molecule is an alpha2beta2 tetramer. The active site contains a non-heme iron coordinated by His12, His61, Glu242, and a water molecule located in a deep cleft of the beta subunit, which is covered by the alpha subunit []. This entry represents the structural domain of subunit B.; GO: 0008198 ferrous iron binding, 0016491 oxidoreductase activity, 0006725 cellular aromatic compound metabolic process; PDB: 2PW6_A 1B4U_D 1BOU_B.
Probab=60.38  E-value=7  Score=28.75  Aligned_cols=25  Identities=32%  Similarity=0.472  Sum_probs=16.0

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      +.++-+.+.+.+||++|+++|==-.
T Consensus        30 ~~~~~~~l~~~~pd~ivvis~h~~~   54 (272)
T PF02900_consen   30 LQELGRRLREAKPDVIVVISPHWFT   54 (272)
T ss_dssp             HHHHHHHCHSTS-SEEEEEEEEECC
T ss_pred             HHHHHHHHHHcCCCEEEEEeCCcch
Confidence            4444455556799999999983333


No 65 
>PF14359 DUF4406:  Domain of unknown function (DUF4406)
Probab=60.32  E-value=32  Score=22.08  Aligned_cols=56  Identities=13%  Similarity=0.128  Sum_probs=39.9

Q ss_pred             EeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHHHHhh
Q psy149           13 SAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDSIV   78 (86)
Q Consensus        13 AaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~i~   78 (86)
                      =|||+|--.+.++..+.+.-+++++.- +.++         ||......-..+.++..+..+.-+.
T Consensus         3 IaGPmtG~~~~N~~~f~~~a~~L~~~G-~~vv---------nPa~~~~~~~~~~~~ym~~~l~~L~   58 (92)
T PF14359_consen    3 IAGPMTGLPDYNRPAFNAAAKRLRAKG-YEVV---------NPAELGIPEGLSWEEYMRICLAMLS   58 (92)
T ss_pred             EeCCcCCCcchHHHHHHHHHHHHHHCC-CEEe---------CchhhCCCCCCCHHHHHHHHHHHHH
Confidence            389999989999999999888888855 4333         4443322225678888887777665


No 66 
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane]
Probab=60.15  E-value=14  Score=29.07  Aligned_cols=42  Identities=21%  Similarity=0.383  Sum_probs=28.4

Q ss_pred             EEEeCCCCCCCCCC--CchHHHHH------HHHhhCCCCEEEeeccccCC
Q psy149           11 FVSAGPYTQSDTLS--YKPLEDLI------ALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        11 ~vAaGPfT~~d~l~--y~pL~~ll------~~v~~~~PdvlIL~GPFiD~   52 (86)
                      .|.+|++.....+.  ..|+.-+.      +.+++.|||++|-+|+|+-.
T Consensus        55 ~I~~~~~~~~~~~~~~~~~~~~~~~~~~a~~il~~~kPd~vig~Ggyvs~  104 (357)
T COG0707          55 LIPSGGLRRKGSLKLLKAPFKLLKGVLQARKILKKLKPDVVIGTGGYVSG  104 (357)
T ss_pred             EEecccccccCcHHHHHHHHHHHHHHHHHHHHHHHcCCCEEEecCCcccc
Confidence            46777777665554  33433333      34677999999999999853


No 67 
>PRK13365 protocatechuate 4,5-dioxygenase subunit beta; Provisional
Probab=59.93  E-value=8.9  Score=29.19  Aligned_cols=23  Identities=26%  Similarity=0.328  Sum_probs=18.2

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +-+.++-+.|++.+||++|++|+
T Consensus        35 ~a~~~i~~~v~~~~PDviVvi~s   57 (279)
T PRK13365         35 DGYEPVAAWLAEQKADVLVFFYN   57 (279)
T ss_pred             HHHHHHHHHHHHhCCCEEEEEcC
Confidence            45666777788899999999954


No 68 
>PHA02729 hypothetical protein; Provisional
Probab=59.82  E-value=11  Score=24.95  Aligned_cols=37  Identities=27%  Similarity=0.399  Sum_probs=30.2

Q ss_pred             CCCCCCCCCchHHHHHHHHh---hCCCCEEEeeccccCCCCcc
Q psy149           17 YTQSDTLSYKPLEDLIALTV---QQEPDVLILIGPLLDTSHPL   56 (86)
Q Consensus        17 fT~~d~l~y~pL~~ll~~v~---~~~PdvlIL~GPFiD~~h~~   56 (86)
                      |++..+-+|+=|.+|+.+++   +.+.|--+|.|   |++.+.
T Consensus        38 W~P~tedDYkFL~~LV~~v~~n~~tk~dYYVLsg---d~~~~t   77 (94)
T PHA02729         38 WTPVTEDDYKFLSRLVLMAKLNRDTVFDYYVLTG---DIEQPT   77 (94)
T ss_pred             eecCcchHHHHHHHHHHHHhhccccceeeEEEec---CCCCce
Confidence            56677789999999999998   57899999999   665543


No 69 
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional
Probab=59.68  E-value=7.8  Score=27.83  Aligned_cols=31  Identities=23%  Similarity=0.275  Sum_probs=26.2

Q ss_pred             CCCchHHHHHHHHhhC-CCCEEEeeccccCCC
Q psy149           23 LSYKPLEDLIALTVQQ-EPDVLILIGPLLDTS   53 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~-~PdvlIL~GPFiD~~   53 (86)
                      =.|+.|.++++++... +.|.||++|=+||.-
T Consensus        27 G~~~~L~~lL~~i~~~~~~D~li~lGDlvDrG   58 (218)
T PRK11439         27 GCFEQLMRKLRHCRFDPWRDLLISVGDLIDRG   58 (218)
T ss_pred             CCHHHHHHHHHhcCCCcccCEEEEcCcccCCC
Confidence            3678999999999765 789999999999953


No 70 
>TIGR03728 glyco_access_1 glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.
Probab=59.15  E-value=8.9  Score=29.76  Aligned_cols=26  Identities=12%  Similarity=0.581  Sum_probs=21.8

Q ss_pred             CCchHHHHHHHHhhCCCC--EEEeeccc
Q psy149           24 SYKPLEDLIALTVQQEPD--VLILIGPL   49 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~Pd--vlIL~GPF   49 (86)
                      .|+-.+++++.+++...|  +||++||=
T Consensus       169 Ay~~yd~I~e~i~~~~k~~LiLlaLGPT  196 (265)
T TIGR03728       169 AFSKYDEILEAIRENAKNKLILLMLGPT  196 (265)
T ss_pred             HHHHHHHHHHHHHHhCCCeEEEEecCCc
Confidence            488899999999999998  55567993


No 71 
>cd07949 PCA_45_Doxase_B_like_1 The B subunit of unknown Class III extradiol dioxygenases with similarity to Protocatechuate 4,5-dioxygenase. This subfamily is composed of proteins of unknown function with similarity to the B subunit of Protocatechuate 4,5-dioxygenase (LigAB). LigAB belongs to the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Dioxygenases play key roles in the degradation of aromatic compounds. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.
Probab=59.14  E-value=10  Score=28.81  Aligned_cols=24  Identities=13%  Similarity=0.254  Sum_probs=20.9

Q ss_pred             CchHHHHHHHHhhCCCCEEEeecc
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      ++-+.++-+.+++.+||++|++++
T Consensus        34 ~~a~~~~~~~v~~~~PD~iVvis~   57 (276)
T cd07949          34 FDGFPPVHDWLEKAKPDVAVVFYN   57 (276)
T ss_pred             HHHHHHHHHHHHHcCCCEEEEECC
Confidence            456778888889999999999997


No 72 
>PRK13609 diacylglycerol glucosyltransferase; Provisional
Probab=59.01  E-value=8.8  Score=28.86  Aligned_cols=22  Identities=27%  Similarity=0.472  Sum_probs=18.6

Q ss_pred             HHHHHHHhhCCCCEEEeecccc
Q psy149           29 EDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      ..+.+.+++.+||++|..+|+.
T Consensus        94 ~~l~~~l~~~~pD~Vi~~~~~~  115 (380)
T PRK13609         94 KRLKLLLQAEKPDIVINTFPII  115 (380)
T ss_pred             HHHHHHHHHhCcCEEEEcChHH
Confidence            4677778889999999999975


No 73 
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain. CSTP1 (complete S-transactivated protein 1) is an uncharacterized Homo sapiens protein with a metallophosphatase domain, that is transactivated by the complete S protein of hepatitis B virus.  CSTP1 belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is th
Probab=58.31  E-value=38  Score=24.40  Aligned_cols=48  Identities=13%  Similarity=0.208  Sum_probs=33.0

Q ss_pred             CceeEEEEeCCCCCCC-CC------CCc----hHHHHHHHHhhC--CCCEEEeeccccCCC
Q psy149            6 RSLSMFVSAGPYTQSD-TL------SYK----PLEDLIALTVQQ--EPDVLILIGPLLDTS   53 (86)
Q Consensus         6 ~~l~i~vAaGPfT~~d-~l------~y~----pL~~ll~~v~~~--~PdvlIL~GPFiD~~   53 (86)
                      .+.+++++|-|--... ..      .|.    -|+.+++.+++.  +||.+|+.|=.+|..
T Consensus         3 ~~~~f~~~sD~h~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~~~pd~ii~~GDl~~~~   63 (262)
T cd07395           3 GPFYFIQGADPQLGLIKKNLEGGGDEWDEEIKLTEQAVQAINKLNPKPKFVVVCGDLVNAM   63 (262)
T ss_pred             CCEEEEEecCCccchhhccccCchhhhhhHHHHHHHHHHHHHhcCCCCCEEEEeCCcCCCC
Confidence            4677777776654421 11      222    267888888887  999999999888754


No 74 
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain. Methylmalonyl-CoA mutase (EC 5.4.99.2) catalyzes a reversible isomerization between L-methylmalonyl-CoA and succinyl-CoA. The enzyme uses an adenosylcobalamin cofactor. It may be a homodimer, as in mitochondrion, or a heterodimer with partially homologous beta chain that does not bind the adenosylcobalamin cofactor, as in Propionibacterium freudenreichii. The most similar archaeal sequences are separate chains, such as AF2215 and AF2219 of Archaeoglobus fulgidus, that correspond roughly to the first 500 and last 130 residues, respectively of known methylmalonyl-CoA mutases. This model describes the C-terminal domain subfamily. In a neighbor-joining tree (methylaspartate mutase S chain as the outgroup), AF2219 branches with a coenzyme B12-dependent enzyme known not to be 5.4.99.2.
Probab=57.70  E-value=32  Score=23.27  Aligned_cols=49  Identities=12%  Similarity=0.125  Sum_probs=33.8

Q ss_pred             CCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHHHHhhc
Q psy149           17 YTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDSIVQ   79 (86)
Q Consensus        17 fT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~i~~   79 (86)
                      |.--+.--+.+-.++++.+.++++|++.+++              +..+..+.++.++..+-+
T Consensus        31 feVi~lg~~~s~e~~v~aa~e~~adii~iSs--------------l~~~~~~~~~~~~~~L~~   79 (132)
T TIGR00640        31 FDVDVGPLFQTPEEIARQAVEADVHVVGVSS--------------LAGGHLTLVPALRKELDK   79 (132)
T ss_pred             cEEEECCCCCCHHHHHHHHHHcCCCEEEEcC--------------chhhhHHHHHHHHHHHHh
Confidence            4434444566788999999999999999953              445555566666665544


No 75 
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing. This family of enzymes catalyzes the combined epimerization and UDP-hydrolysis of UDP-N-acetylglucosamine to N-acetylmannosamine. This is in contrast to the related enzyme WecB (TIGR00236) which retains the UDP moiety. NeuC acts in concert with NeuA and NeuB to synthesize CMP-N5-acetyl-neuraminate.
Probab=57.56  E-value=28  Score=26.93  Aligned_cols=51  Identities=12%  Similarity=0.302  Sum_probs=32.1

Q ss_pred             HHHHHHHHhhCCCCEEEeec-cc-----------cCCCCccccCCCcC-CCHHHHHHHHHHHhh
Q psy149           28 LEDLIALTVQQEPDVLILIG-PL-----------LDTSHPLLLNGSLA-ETFEDFYVKLIDSIV   78 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~G-PF-----------iD~~h~~i~~g~~~-~t~eelF~~~i~~i~   78 (86)
                      +..+-+.+.+.+||+++..| .+           ...---.|..|+.. -++||.-++.++.+.
T Consensus        82 ~~~~~~~~~~~~Pd~vlv~GD~~~~la~alaA~~~~IPv~HveaG~rs~~~~eE~~r~~i~~la  145 (365)
T TIGR03568        82 IIGFSDAFERLKPDLVVVLGDRFEMLAAAIAAALLNIPIAHIHGGEVTEGAIDESIRHAITKLS  145 (365)
T ss_pred             HHHHHHHHHHhCCCEEEEeCCchHHHHHHHHHHHhCCcEEEEECCccCCCCchHHHHHHHHHHH
Confidence            35566667889999999999 32           11111235556441 157888888777653


No 76 
>cd07364 PCA_45_Dioxygenase_B Subunit B of the Class III extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of protocatechuate. Protocatechuate 4,5-dioxygenase (LigAB) catalyzes the oxidization and subsequent ring-opening of protocatechuate (or 3,4-dihydroxybenzoic acid, PCA), an intermediate in the breakdown of lignin and other compounds. Protocatechuate 4,5-dioxygenase is an aromatic ring opening dioxygenase belonging to the class III extradiol enzyme family, a group of enyzmes that cleaves aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon using a non-heme Fe(II). LigAB is composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. The B subunit (LigB) is the catalytic subunit of LigAB.
Probab=57.15  E-value=11  Score=28.70  Aligned_cols=34  Identities=18%  Similarity=0.206  Sum_probs=24.8

Q ss_pred             CchHHHHHHHHhhCCCCEEEeecc-----ccCCCCcccc
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGP-----LLDTSHPLLL   58 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GP-----FiD~~h~~i~   58 (86)
                      ++-+.++-+++++.+||++|++|+     |.+..-|.+.
T Consensus        34 ~~a~~~~~~~~~~~~pD~vVvi~~dH~~~f~~~~~P~f~   72 (277)
T cd07364          34 FKGYQPARDWIKKNKPDVAIIVYNDHASAFDLDIIPTFA   72 (277)
T ss_pred             HHHHHHHHHHHHHhCCCEEEEEcCchHHhhcccCCCceE
Confidence            345777788888899999999965     6565555543


No 77 
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain. The PPP (phosphoprotein phosphatase) family is one of two known protein phosphatase families specific for serine and threonine.  This family includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes.  Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes.  PPPs belong to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate
Probab=57.14  E-value=10  Score=26.44  Aligned_cols=31  Identities=23%  Similarity=0.267  Sum_probs=26.5

Q ss_pred             CCchHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           24 SYKPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      .|..|..+++.+...++|.+|++|=++|...
T Consensus         9 ~~~~l~~~l~~~~~~~~d~li~lGD~vdrg~   39 (225)
T cd00144           9 CLDDLLRLLEKIGFPPNDKLIFLGDYVDRGP   39 (225)
T ss_pred             CHHHHHHHHHHhCCCCCCEEEEECCEeCCCC
Confidence            4678888899888888999999999999653


No 78 
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain. CpdB is a bacterial periplasmic protein with an N-terminal metallophosphatase domain and a C-terminal 3'-nucleotidase domain.  This alignment model represents the N-terminal metallophosphatase domain, which has 2',3'-cyclic phosphodiesterase activity, hydrolyzing the 2',3'-cyclic phosphates of adenosine, guanosine, cytosine and uridine to yield nucleoside and phosphate.  CpdB also hydrolyzes the chromogenic substrates p-nitrophenyl phosphate (PNPP), bis(PNPP) and p-nitrophenyl phosphorylcholine (NPPC).  CpdB is thought to play a scavenging role during RNA hydrolysis by converting the non-transportable nucleotides produced by RNaseI to nucleosides which can easily enter a cell for use as a carbon source.  This family also includes YfkN, a Bacillus subtilis nucleotide phosphoesterase with two copies of each of the metallophosphatase and 3'-nucleotidase domains.  The N-terminal metallophos
Probab=57.05  E-value=18  Score=26.52  Aligned_cols=32  Identities=19%  Similarity=0.319  Sum_probs=27.6

Q ss_pred             CCCCchHHHHHHHHhhCCCCEEEe-eccccCCC
Q psy149           22 TLSYKPLEDLIALTVQQEPDVLIL-IGPLLDTS   53 (86)
Q Consensus        22 ~l~y~pL~~ll~~v~~~~PdvlIL-~GPFiD~~   53 (86)
                      .-.+..+..+++.+++..||+|++ .|=+++.+
T Consensus        26 ~gg~~~l~~~i~~~r~~~~~~l~ld~GD~~~gs   58 (277)
T cd07410          26 SGGLARVATLIKKARAENPNTLLIDNGDTIQGS   58 (277)
T ss_pred             ccCHHHHHHHHHHHHhcCCCeEEEeCCccCCcc
Confidence            367889999999999999999988 89888754


No 79 
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain. MPPE1 is a functionally uncharacterized metallophosphatase domain-containing protein. The MPPE1 gene is located on chromosome 18 and is a candidate susceptibility gene for Bipolar disorder.  MPPE1 belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to 
Probab=56.91  E-value=14  Score=25.26  Aligned_cols=28  Identities=21%  Similarity=0.353  Sum_probs=22.4

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      ....+.+.+++.+||.||+.|=++|...
T Consensus        26 ~~~~~~~~i~~~~pd~vv~~GDl~~~~~   53 (156)
T cd08165          26 MERSFQTSLWLLQPDVVFVLGDLFDEGK   53 (156)
T ss_pred             HHHHHHHHHHhcCCCEEEECCCCCCCCc
Confidence            4446667788899999999999988644


No 80 
>PRK03692 putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional
Probab=56.90  E-value=20  Score=26.84  Aligned_cols=33  Identities=9%  Similarity=0.219  Sum_probs=23.7

Q ss_pred             ceeEE-EEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEe
Q psy149            7 SLSMF-VSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus         7 ~l~i~-vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      +++|+ ..+|||..+      --.++++.|++.+||+|++
T Consensus       130 ~l~i~g~~~Gyf~~~------e~~~i~~~I~~s~~dil~V  163 (243)
T PRK03692        130 NVNIVGSQDGYFTPE------QRQALFERIHASGAKIVTV  163 (243)
T ss_pred             CCEEEEEeCCCCCHH------HHHHHHHHHHhcCCCEEEE
Confidence            35554 357888533      3467999999999998876


No 81 
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents.  The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosa
Probab=56.85  E-value=16  Score=25.67  Aligned_cols=30  Identities=27%  Similarity=0.439  Sum_probs=25.0

Q ss_pred             CchHHHHHHHHhhC--CCCEEEeeccccCCCC
Q psy149           25 YKPLEDLIALTVQQ--EPDVLILIGPLLDTSH   54 (86)
Q Consensus        25 y~pL~~ll~~v~~~--~PdvlIL~GPFiD~~h   54 (86)
                      .+-|+.+++.+++.  +||.+|+.|=+++...
T Consensus        24 ~~~l~~~~~~i~~~~~~~d~vi~~GDl~~~~~   55 (240)
T cd07402          24 AASLEAVLAHINALHPRPDLVLVTGDLTDDGS   55 (240)
T ss_pred             HHHHHHHHHHHHhcCCCCCEEEECccCCCCCC
Confidence            45688899999987  9999999999887643


No 82 
>PRK13367 protocatechuate 4,5-dioxygenase; Provisional
Probab=55.95  E-value=11  Score=30.90  Aligned_cols=19  Identities=32%  Similarity=0.373  Sum_probs=14.7

Q ss_pred             HHHHHHhhCCCCEEEeecc
Q psy149           30 DLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        30 ~ll~~v~~~~PdvlIL~GP   48 (86)
                      .+=+.+++.+|||+|++||
T Consensus        39 ~~r~~l~~~~PDvvVv~~n   57 (420)
T PRK13367         39 PLRRWLEEKKPDVLLYIFN   57 (420)
T ss_pred             HHHHHHHHhCCCEEEEEcc
Confidence            3444556689999999998


No 83 
>PRK13366 protocatechuate 4,5-dioxygenase subunit beta; Provisional
Probab=55.92  E-value=11  Score=28.87  Aligned_cols=34  Identities=21%  Similarity=0.239  Sum_probs=25.1

Q ss_pred             CchHHHHHHHHhhCCCCEEEeecc-----ccCCCCcccc
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGP-----LLDTSHPLLL   58 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GP-----FiD~~h~~i~   58 (86)
                      ++-+.++-+++++.+||++|++|+     |.+...|.+.
T Consensus        34 ~~a~~~i~~~i~~~~PDvvVii~~dH~~~f~~d~~P~f~   72 (284)
T PRK13366         34 FKGYEFSKQWEKEEKPDVIFLVYNDHATAFSLDIIPTFA   72 (284)
T ss_pred             HHHHHHHHHHHHHhCCCEEEEEcCCcHHhhcccCCCceE
Confidence            455677778888899999999965     5555555544


No 84 
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain. This family includes bacterial and archeal proteins homologous to PF1019, an uncharacterized Pyrococcus furiosus protein.  The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for pro
Probab=55.82  E-value=19  Score=24.61  Aligned_cols=29  Identities=31%  Similarity=0.410  Sum_probs=23.4

Q ss_pred             chHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      +-+..+.+.+.+.+||.||++|=++|...
T Consensus        28 ~~~~~l~~~~~~~~~d~lii~GDl~~~~~   56 (172)
T cd07391          28 DTLERLDRLIEEYGPERLIILGDLKHSFG   56 (172)
T ss_pred             HHHHHHHHHHHhcCCCEEEEeCccccccc
Confidence            45667777788899999999999987644


No 85 
>TIGR03729 acc_ester putative phosphoesterase. Members of this protein family belong to the larger family pfam00149 (calcineurin-like phosphoesterase), a family largely defined by small motifs of metal-chelating residues. The subfamily in this model shows a good but imperfect co-occurrence in species with domain TIGR03715 that defines a novel class of signal peptide typical of the accessory secretory system.
Probab=55.74  E-value=16  Score=26.24  Aligned_cols=25  Identities=28%  Similarity=0.344  Sum_probs=22.2

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      |..+++.+++.+||++|+.|=++|.
T Consensus        21 l~~~~~~~~~~~~d~vv~~GDl~~~   45 (239)
T TIGR03729        21 LETLAQYLKKQKIDHLHIAGDISND   45 (239)
T ss_pred             HHHHHHHHHhcCCCEEEECCccccc
Confidence            6788899999999999999998874


No 86 
>PRK10878 hypothetical protein; Provisional
Probab=55.71  E-value=0.9  Score=28.58  Aligned_cols=16  Identities=25%  Similarity=0.328  Sum_probs=11.0

Q ss_pred             EeeccccCCCCccccC
Q psy149           44 ILIGPLLDTSHPLLLN   59 (86)
Q Consensus        44 IL~GPFiD~~h~~i~~   59 (86)
                      +++|||+|........
T Consensus         6 lll~~F~~~~~~~l~~   21 (72)
T PRK10878          6 ISIMPFFEHEYDSLSD   21 (72)
T ss_pred             HHHHHHHHHHHhhCCH
Confidence            4678888888755443


No 87 
>cd02067 B12-binding B12 binding domain (B12-BD). This domain binds different cobalamid derivates, like B12 (adenosylcobamide) or methylcobalamin or methyl-Co(III) 5-hydroxybenzimidazolylcobamide, it is found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase. Cobalamin undergoes a conformational change on binding the protein; the dimethylbenzimidazole group, which is coordinated to the cobalt in the free cofactor, moves away from the corrin and is replaced by a histidine contributed by the protein. The sequence Asp-X-His-X-X-Gly, which contains this histidine ligand, is conserved in many cobalamin-binding proteins.
Probab=55.48  E-value=18  Score=23.14  Aligned_cols=21  Identities=19%  Similarity=0.401  Sum_probs=18.8

Q ss_pred             chHHHHHHHHhhCCCCEEEee
Q psy149           26 KPLEDLIALTVQQEPDVLILI   46 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~   46 (86)
                      .|..++++.+.+.+||++.+.
T Consensus        37 ~~~~~l~~~~~~~~pdvV~iS   57 (119)
T cd02067          37 VPPEEIVEAAKEEDADAIGLS   57 (119)
T ss_pred             CCHHHHHHHHHHcCCCEEEEe
Confidence            478999999999999999884


No 88 
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain. Nbla03831 (also known as LOC56985) is an uncharacterized Homo sapiens protein with a domain that belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.
Probab=55.29  E-value=11  Score=27.66  Aligned_cols=30  Identities=17%  Similarity=0.369  Sum_probs=25.2

Q ss_pred             CchHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      .+-|...++.+++.+||.+|..|=.++...
T Consensus        26 ~~~l~~~i~~i~~~~~d~vv~~GDlv~~~~   55 (267)
T cd07396          26 LEKLEEAVEEWNRESLDFVVQLGDIIDGDN   55 (267)
T ss_pred             HHHHHHHHHHHHcCCCCEEEECCCeecCCC
Confidence            467888899999999999999998876554


No 89 
>COG1423 ATP-dependent DNA ligase, homolog of eukaryotic ligase III [DNA replication, recombination, and repair]
Probab=54.95  E-value=17  Score=29.52  Aligned_cols=50  Identities=24%  Similarity=0.488  Sum_probs=35.1

Q ss_pred             CcCCCceeEEEEeC------------CCCCCCCCCCchHHHHHH-HHhhCCCCEEEeeccccCCCCcccc
Q psy149            2 TLTRRSLSMFVSAG------------PYTQSDTLSYKPLEDLIA-LTVQQEPDVLILIGPLLDTSHPLLL   58 (86)
Q Consensus         2 ~l~~~~l~i~vAaG------------PfT~~d~l~y~pL~~ll~-~v~~~~PdvlIL~GPFiD~~h~~i~   58 (86)
                      +|||-+++|+--.|            ||||.      .+.+|++ ..-+.-||. +|||-++-.+||-+.
T Consensus        95 KmnGYNVRV~k~~g~vyAiTRgG~ICPfTT~------r~~~l~~~eff~d~p~l-vlcgEmvG~enPYv~  157 (382)
T COG1423          95 KMNGYNVRVVKLGGEVYAITRGGLICPFTTE------RLRDLIDLEFFDDYPDL-VLCGEMVGPENPYVP  157 (382)
T ss_pred             eccCceEEEEEECCEEEEEecCceecCchhH------HHHhhcchhhHhhCCCc-EEEEEeccCCCCCCC
Confidence            56777777754433            99998      5555553 333456885 679999999999876


No 90 
>COG1922 WecG Teichoic acid biosynthesis proteins [Cell envelope biogenesis, outer membrane]
Probab=54.64  E-value=22  Score=27.21  Aligned_cols=32  Identities=22%  Similarity=0.457  Sum_probs=25.5

Q ss_pred             eeEEEEe-CCCCCCCCCCCchHHHHHHHHhhCCCCEEEe
Q psy149            8 LSMFVSA-GPYTQSDTLSYKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus         8 l~i~vAa-GPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      ++|+... |.|+..     +. +.+++.|+..+||+|+.
T Consensus       135 l~ivg~h~GYf~~~-----e~-~~i~~~I~~s~pdil~V  167 (253)
T COG1922         135 LKIVGSHDGYFDPE-----EE-EAIVERIAASGPDILLV  167 (253)
T ss_pred             ceEEEecCCCCChh-----hH-HHHHHHHHhcCCCEEEE
Confidence            6777776 888877     33 59999999999998753


No 91 
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=54.52  E-value=64  Score=21.71  Aligned_cols=55  Identities=22%  Similarity=0.260  Sum_probs=29.0

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCCCCccccCCC---cCCCHHHHHHHHHHHhhcccc
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGS---LAETFEDFYVKLIDSIVQPLE   82 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~---~~~t~eelF~~~i~~i~~~~~   82 (86)
                      +..+-+.+.+.+||++|++.===|..+..-.++.   ....+.+-|++.+..+++.++
T Consensus        48 ~~~~~~~l~~~~pd~vii~~G~ND~~~~~~~~~~~~~~~~~~~~~~~~~l~~lv~~~~  105 (200)
T cd01829          48 PEKLKELIAEEKPDVVVVFLGANDRQDIRDGDGYLKFGSPEWEEEYRQRIDELLNVAR  105 (200)
T ss_pred             HHHHHHHHhcCCCCEEEEEecCCCCccccCCCceeecCChhHHHHHHHHHHHHHHHHH
Confidence            3455566778999988888433333221110000   012345566666666666554


No 92 
>PRK13372 pcmA protocatechuate 4,5-dioxygenase; Provisional
Probab=54.14  E-value=12  Score=30.91  Aligned_cols=16  Identities=31%  Similarity=0.480  Sum_probs=13.6

Q ss_pred             HHHhhCCCCEEEeecc
Q psy149           33 ALTVQQEPDVLILIGP   48 (86)
Q Consensus        33 ~~v~~~~PdvlIL~GP   48 (86)
                      +.+.+.+|||+|++||
T Consensus       189 ~~l~~~~PDVvVi~~n  204 (444)
T PRK13372        189 EWAKEHLPDVIILVYN  204 (444)
T ss_pred             HHHHHhCCCEEEEEcc
Confidence            4566689999999998


No 93 
>cd07367 CarBb CarBb is the B subunit of the Class III Extradiol ring-cleavage dioxygenase, 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol. CarBb is the B subunit of 2-aminophenol 1,6-dioxygenase (CarB), which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol. It is a key enzyme in the carbazole degradation pathway isolated from bacterial strains with carbazole degradation ability. The enzyme is a heterotetramer composed of two A and two B subunits. CarB belongs to the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Although the enzyme was originally isolated as a meta-cleavage enzyme for 2'-aminobiphenyl-2,3-diol involved in carbazole degradation, it has also shown high specificity for 2,3-dihydroxybiphenyl.
Probab=53.94  E-value=13  Score=27.94  Aligned_cols=23  Identities=22%  Similarity=0.444  Sum_probs=17.6

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +-+.++-+.+.+.+||++|+++|
T Consensus        29 ~al~~~~~~l~~~~Pd~ivvis~   51 (268)
T cd07367          29 QGMAEIGRRVRESRPDVLVVISS   51 (268)
T ss_pred             HHHHHHHHHHHHcCCCEEEEEeC
Confidence            34555556666679999999999


No 94 
>PF13778 DUF4174:  Domain of unknown function (DUF4174)
Probab=53.86  E-value=62  Score=21.37  Aligned_cols=61  Identities=21%  Similarity=0.292  Sum_probs=39.4

Q ss_pred             cCCCceeEEEEeCCCCCC--CCCCCchHHHHHHHHhh-CCCCEEEeeccccCCCCccccCCCc------CCCHHHHHHHH
Q psy149            3 LTRRSLSMFVSAGPYTQS--DTLSYKPLEDLIALTVQ-QEPDVLILIGPLLDTSHPLLLNGSL------AETFEDFYVKL   73 (86)
Q Consensus         3 l~~~~l~i~vAaGPfT~~--d~l~y~pL~~ll~~v~~-~~PdvlIL~GPFiD~~h~~i~~g~~------~~t~eelF~~~   73 (86)
                      |..+.+.+++..|+=..+  ..++..-..+|-++..- .....+||+|          |+|..      +.+.+++|+.+
T Consensus        39 l~eRdi~v~~i~~~~~~~~~~~~~~~~~~~lr~~l~~~~~~f~~vLiG----------KDG~vK~r~~~p~~~~~lf~~I  108 (118)
T PF13778_consen   39 LDERDIVVIVITGDGARSPGKPLSPEDIQALRKRLRIPPGGFTVVLIG----------KDGGVKLRWPEPIDPEELFDTI  108 (118)
T ss_pred             cccCceEEEEEeCCccccccCcCCHHHHHHHHHHhCCCCCceEEEEEe----------CCCcEEEecCCCCCHHHHHHHH
Confidence            566778777777665544  45555555566655552 3345799999          55554      67889998743


No 95 
>PHA02239 putative protein phosphatase
Probab=53.06  E-value=16  Score=26.95  Aligned_cols=29  Identities=14%  Similarity=0.429  Sum_probs=24.1

Q ss_pred             CCchHHHHHHHHhhC--CCCEEEeeccccCC
Q psy149           24 SYKPLEDLIALTVQQ--EPDVLILIGPLLDT   52 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~--~PdvlIL~GPFiD~   52 (86)
                      .|+.|..+++++...  +.|.||++|=+||.
T Consensus        12 ~~~~l~~ll~~i~~~~~~~d~li~lGD~iDr   42 (235)
T PHA02239         12 EYQKLLTIMDKINNERKPEETIVFLGDYVDR   42 (235)
T ss_pred             CHHHHHHHHHHHhhcCCCCCEEEEecCcCCC
Confidence            467899999999764  35999999999994


No 96 
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain. PAE1087 is an uncharacterized Pyrobaculum aerophilum protein with a metallophosphatase domain.  The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordina
Probab=52.50  E-value=18  Score=24.02  Aligned_cols=29  Identities=21%  Similarity=0.343  Sum_probs=20.3

Q ss_pred             CCchHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           24 SYKPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      ++..+..  .++++.+||+||+.|=+.+...
T Consensus        10 ~~~~~~~--~~~~~~~~D~vv~~GDl~~~~~   38 (188)
T cd07392          10 DVEKLEA--IILKAEEADAVIVAGDITNFGG   38 (188)
T ss_pred             CHHHHHH--HHhhccCCCEEEECCCccCcCC
Confidence            3455554  5667788999999998876543


No 97 
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed
Probab=51.63  E-value=14  Score=28.05  Aligned_cols=30  Identities=27%  Similarity=0.475  Sum_probs=25.2

Q ss_pred             CCchHHHHHHHHh-hCCCCEEEeeccccCCC
Q psy149           24 SYKPLEDLIALTV-QQEPDVLILIGPLLDTS   53 (86)
Q Consensus        24 ~y~pL~~ll~~v~-~~~PdvlIL~GPFiD~~   53 (86)
                      +|+.|..+++++. +.++|.+|.+|=+||.-
T Consensus        12 ~~~~l~~ll~~~~~~~~~D~li~lGDlVdrG   42 (275)
T PRK00166         12 CYDELQRLLEKIDFDPAKDTLWLVGDLVNRG   42 (275)
T ss_pred             CHHHHHHHHHhcCCCCCCCEEEEeCCccCCC
Confidence            5789999999986 35789999999999943


No 98 
>PRK13608 diacylglycerol glucosyltransferase; Provisional
Probab=51.48  E-value=15  Score=28.31  Aligned_cols=22  Identities=32%  Similarity=0.625  Sum_probs=18.7

Q ss_pred             HHHHHHHhhCCCCEEEeecccc
Q psy149           29 EDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      ..+.+.+++.+||++|..+|+.
T Consensus        94 ~~l~~~l~~~kPDvVi~~~p~~  115 (391)
T PRK13608         94 NKLINLLIKEKPDLILLTFPTP  115 (391)
T ss_pred             HHHHHHHHHhCcCEEEECCcHH
Confidence            5677888889999999988874


No 99 
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain. Metallophosphatases (MPPs), also known as metallophosphoesterases, phosphodiesterases (PDEs), binuclear metallophosphoesterases, and dimetal-containing phosphoesterases (DMPs), represent a diverse superfamily of enzymes with a conserved domain containing an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. This superfamily includes: the phosphoprotein phosphatases (PPPs), Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets.  This domain is thought to allow for productive me
Probab=51.33  E-value=32  Score=20.57  Aligned_cols=23  Identities=26%  Similarity=0.606  Sum_probs=18.5

Q ss_pred             HHHhhCCCCEEEeeccccCCCCc
Q psy149           33 ALTVQQEPDVLILIGPLLDTSHP   55 (86)
Q Consensus        33 ~~v~~~~PdvlIL~GPFiD~~h~   55 (86)
                      ....+.+|+.||++|=++|...+
T Consensus        20 ~~~~~~~~~~vi~~GD~~~~~~~   42 (131)
T cd00838          20 ALAAAEKPDFVLVLGDLVGDGPD   42 (131)
T ss_pred             HHhcccCCCEEEECCcccCCCCC
Confidence            55666899999999999987664


No 100
>cd07373 2A5CPDO_A The alpha subunit of the Class III extradiol dioxygenase, 2-amino-5-chlorophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol. 2-amino-5-chlorophenol 1,6-dioxygenase (2A5CPDO) catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol, which is an intermediate during p-chloronitrobenzene degradation. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. The active enzyme is probably a heterotetramer, composed of two alpha and two beta subunits. The alpha and beta subunits share significant sequence similarity and may have evolved by gene duplication. This model describes the alpha subunit, which does not contain a potential metal binding site and may not possess catalytic activity.
Probab=51.20  E-value=22  Score=26.62  Aligned_cols=26  Identities=12%  Similarity=0.091  Sum_probs=19.4

Q ss_pred             chHHHHHHHHhhCCCCEEEeeccccC
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      +-|.++-+++.+.+||++|.+.|=--
T Consensus        29 ~a~~~lg~~l~~~~Pd~IvviS~Hw~   54 (271)
T cd07373          29 AATRQAGKALAASRPDVVLVYSTQWF   54 (271)
T ss_pred             HHHHHHHHHHHHhCCCEEEEECCCCc
Confidence            45566666776679999999988533


No 101
>PF14606 Lipase_GDSL_3:  GDSL-like Lipase/Acylhydrolase family; PDB: 3SKV_B.
Probab=51.05  E-value=33  Score=24.86  Aligned_cols=69  Identities=23%  Similarity=0.388  Sum_probs=36.4

Q ss_pred             eEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCE-EEeeccccCCCCccccCCCcCCCHHHHHHHHHHHhhccc
Q psy149            9 SMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDV-LILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDSIVQPL   81 (86)
Q Consensus         9 ~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~Pdv-lIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~i~~~~   81 (86)
                      -+++.|||= .+...-.+-+..|++.+++..|++ +|++-|+.-... .+.. ....++++. ++.+....+++
T Consensus        62 ~~~ld~~~N-~~~~~~~~~~~~fv~~iR~~hP~tPIllv~~~~~~~~-~~~~-~~~~~~~~~-~~~~r~~v~~l  131 (178)
T PF14606_consen   62 LIVLDCGPN-MSPEEFRERLDGFVKTIREAHPDTPILLVSPIPYPAG-YFDN-SRGETVEEF-REALREAVEQL  131 (178)
T ss_dssp             EEEEEESHH-CCTTTHHHHHHHHHHHHHTT-SSS-EEEEE----TTT-TS---TTS--HHHH-HHHHHHHHHHH
T ss_pred             EEEEEeecC-CCHHHHHHHHHHHHHHHHHhCCCCCEEEEecCCcccc-ccCc-hHHHHHHHH-HHHHHHHHHHH
Confidence            357788887 333444677899999999999995 455565664444 3332 233444332 44444444444


No 102
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis]
Probab=50.90  E-value=47  Score=25.40  Aligned_cols=29  Identities=21%  Similarity=0.660  Sum_probs=21.9

Q ss_pred             CCCchHHHHHHHHhhCCCCEEEeeccccCCCCc
Q psy149           23 LSYKPLEDLIALTVQQEPDVLILIGPLLDTSHP   55 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~   55 (86)
                      +++.|..+||+.+.+ ++++.=++|   |+.+|
T Consensus       108 fs~R~~reLl~~a~~-R~Ni~PIL~---DA~~P  136 (231)
T COG1889         108 FSPRPMRELLDVAEK-RPNIIPILE---DARKP  136 (231)
T ss_pred             ecchhHHHHHHHHHh-CCCceeeec---ccCCc
Confidence            567899999998876 888776665   55554


No 103
>PF05582 Peptidase_U57:  YabG peptidase U57;  InterPro: IPR008764 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported. This is a group of peptidases belong to MEROPS peptidase family U57 (clan U-). The type example is the YabG protein of Bacillus subtilis. This is a protease involved in the synthesis and maturation of the spore coat proteins SpoIVA and YrbA of B. subtilis [].
Probab=50.65  E-value=17  Score=28.51  Aligned_cols=17  Identities=29%  Similarity=0.667  Sum_probs=13.9

Q ss_pred             HHHHHhhCCCCEEEeec
Q psy149           31 LIALTVQQEPDVLILIG   47 (86)
Q Consensus        31 ll~~v~~~~PdvlIL~G   47 (86)
                      +.+.+.+.+||+|+|.|
T Consensus       146 i~~Ll~~~~PDIlViTG  162 (287)
T PF05582_consen  146 IYRLLEEYRPDILVITG  162 (287)
T ss_pred             HHHHHHHcCCCEEEEeC
Confidence            45566678999999998


No 104
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain. DCR2 phosphatase (Dosage-dependent Cell Cycle Regulator 2) functions together with DCR1 (Gid8) in a common pathway to accelerate initiation of DNA replication in Saccharomyces cerevisiae. Genetic analysis suggests that DCR1 functions upstream of DCR2.  DCR2 interacts with and dephosphorylates Sic1, an inhibitor of mitotic cyclin/cyclin-dependent kinase complexes, which may serve to trigger the initiation of cell division.  DCR2 belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAP
Probab=50.57  E-value=59  Score=22.48  Aligned_cols=30  Identities=20%  Similarity=0.400  Sum_probs=22.7

Q ss_pred             chHHHHHHHHhhCCCCEEEeeccccCCCCc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPLLDTSHP   55 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~   55 (86)
                      ..+..+.+.+++.+||.+|+.|=+++...+
T Consensus        28 ~~~~~~~~~~~~~~~d~vv~~GDl~~~~~~   57 (199)
T cd07383          28 KTVAFIERVLDAEKPDLVVLTGDLITGENT   57 (199)
T ss_pred             HHHHHHHHHHhhcCCCEEEECCccccCCCC
Confidence            345555566777999999999998886553


No 105
>PF01973 MAF_flag10:  Protein of unknown function DUF115;  InterPro: IPR002826 The prokaryotic proteins in this family have no known function.
Probab=50.24  E-value=25  Score=23.94  Aligned_cols=9  Identities=44%  Similarity=0.840  Sum_probs=7.1

Q ss_pred             eeEEEEeCC
Q psy149            8 LSMFVSAGP   16 (86)
Q Consensus         8 l~i~vAaGP   16 (86)
                      --+++||||
T Consensus        26 ~~~IvgaGP   34 (170)
T PF01973_consen   26 PAIIVGAGP   34 (170)
T ss_pred             eEEEEecCC
Confidence            347899999


No 106
>KOG0338|consensus
Probab=50.19  E-value=16  Score=31.48  Aligned_cols=51  Identities=22%  Similarity=0.406  Sum_probs=37.8

Q ss_pred             HHHhhCCCCEEEee-ccccCCCC--ccccCCCc--------CCCHHHHHHHHHHHhhccccC
Q psy149           33 ALTVQQEPDVLILI-GPLLDTSH--PLLLNGSL--------AETFEDFYVKLIDSIVQPLEK   83 (86)
Q Consensus        33 ~~v~~~~PdvlIL~-GPFiD~~h--~~i~~g~~--------~~t~eelF~~~i~~i~~~~~~   83 (86)
                      +.+...+||+||-. |=|||--|  |...-.++        +.-++|-|+..+..|++.|.+
T Consensus       296 E~~LRs~PDIVIATPGRlIDHlrNs~sf~ldsiEVLvlDEADRMLeegFademnEii~lcpk  357 (691)
T KOG0338|consen  296 EAVLRSRPDIVIATPGRLIDHLRNSPSFNLDSIEVLVLDEADRMLEEGFADEMNEIIRLCPK  357 (691)
T ss_pred             HHHHhhCCCEEEecchhHHHHhccCCCccccceeEEEechHHHHHHHHHHHHHHHHHHhccc
Confidence            45667899999875 88999765  32221112        678999999999999998864


No 107
>PF08261 Carcinustatin:  Carcinustatin peptide
Probab=49.78  E-value=6.8  Score=15.22  Aligned_cols=6  Identities=67%  Similarity=1.293  Sum_probs=4.1

Q ss_pred             eCCCCC
Q psy149           14 AGPYTQ   19 (86)
Q Consensus        14 aGPfT~   19 (86)
                      +|||..
T Consensus         1 agpy~f    6 (8)
T PF08261_consen    1 AGPYSF    6 (8)
T ss_pred             CCcccc
Confidence            588863


No 108
>PRK15118 universal stress global response regulator UspA; Provisional
Probab=49.67  E-value=22  Score=22.95  Aligned_cols=21  Identities=10%  Similarity=0.032  Sum_probs=18.8

Q ss_pred             CchHHHHHHHHhhCCCCEEEe
Q psy149           25 YKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      -.|-.++++++++.++|++|+
T Consensus        89 G~p~~~I~~~a~~~~~DLIV~  109 (144)
T PRK15118         89 GDLGQVLVDAIKKYDMDLVVC  109 (144)
T ss_pred             cCHHHHHHHHHHHhCCCEEEE
Confidence            368899999999999999887


No 109
>COG2039 Pcp Pyrrolidone-carboxylate peptidase (N-terminal pyroglutamyl peptidase) [Posttranslational modification, protein turnover, chaperones]
Probab=49.35  E-value=18  Score=27.24  Aligned_cols=23  Identities=26%  Similarity=0.635  Sum_probs=19.3

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +-.+.|.+.+.+.+||+++.+|=
T Consensus        47 ~s~~~l~~~i~~~qPd~vl~iG~   69 (207)
T COG2039          47 KSIDALVQAIAEVQPDLVLAIGQ   69 (207)
T ss_pred             HHHHHHHHHHHhhCCCeEEEecc
Confidence            45667788888999999999995


No 110
>KOG3861|consensus
Probab=49.13  E-value=19  Score=29.33  Aligned_cols=39  Identities=18%  Similarity=0.435  Sum_probs=27.4

Q ss_pred             CceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149            6 RSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus         6 ~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      ..++|+|-+||=+.-..-.|+-|+.+++    ..=+++||+|-
T Consensus        51 ~~Vk~~i~agP~~~Ft~~Efevlkkyve----~GGsl~vllGE   89 (438)
T KOG3861|consen   51 ARVKIFILAGPQDRFTEDEFEVLKKYVE----VGGSLVVLLGE   89 (438)
T ss_pred             cceeEEEecCcccccchhHHHHHHHHHh----cCCeEEEEecC
Confidence            4689999999965544445555544443    37899999994


No 111
>TIGR01551 major_capsid_P2 phage major capsid protein, P2 family. This model family represents the major capsid protein component of the heads (capsids) of bacteriophage P2 and related phage. This model represents one of several analogous families lacking detectable sequence similarity. The gene encoding this component is typically located in an operon encoding the small and large terminase subunits, the portal protein and the prohead or maturation protease.
Probab=48.85  E-value=25  Score=27.99  Aligned_cols=47  Identities=26%  Similarity=0.429  Sum_probs=32.8

Q ss_pred             EeCCCCC-CCCCCCchHHHHHHHHhh--------CCCCEEEeecc--ccCCCCccccC
Q psy149           13 SAGPYTQ-SDTLSYKPLEDLIALTVQ--------QEPDVLILIGP--LLDTSHPLLLN   59 (86)
Q Consensus        13 AaGPfT~-~d~l~y~pL~~ll~~v~~--------~~PdvlIL~GP--FiD~~h~~i~~   59 (86)
                      .+|+-+. ...=+|.-|+.++.-+.+        +.||+|+|+|=  .-|...|++..
T Consensus       179 ~~~~I~i~G~~gdy~NLDalv~d~~~~~I~~~~r~dpdLVvivG~dLla~~~~~l~n~  236 (327)
T TIGR01551       179 SSGKITIFGDNADYANLDALAFDLKQNQLDPRHRNDPDLVVLVGADLVSKETKLIQQK  236 (327)
T ss_pred             CCceEEEcCCCCCccCHHHHHHHHHHccCCHHHcCCCCEEEEEChhhhhhhhhhhhhc
Confidence            5566555 456788899888866644        78999999994  33455566655


No 112
>TIGR02855 spore_yabG sporulation peptidase YabG. Members of this family are the protein YabG, demonstrated for Bacillus subtilis to be an endopeptidase able to release N-terminal peptides from a number of sporulation proteins, including CotT, CotF, and SpoIVA. It appears to be expressed under control of sigma-K.
Probab=48.81  E-value=18  Score=28.30  Aligned_cols=18  Identities=28%  Similarity=0.708  Sum_probs=14.1

Q ss_pred             HHHHHHhhCCCCEEEeec
Q psy149           30 DLIALTVQQEPDVLILIG   47 (86)
Q Consensus        30 ~ll~~v~~~~PdvlIL~G   47 (86)
                      .+.+.+.+.+||+|++.|
T Consensus       144 ~i~~Ll~~~~PDIlViTG  161 (283)
T TIGR02855       144 KVLDLIEEVRPDILVITG  161 (283)
T ss_pred             HHHHHHHHhCCCEEEEeC
Confidence            345556678999999998


No 113
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain. ApaH (also known as symmetrically cleaving Ap4A hydrolase and bis(5'nucleosyl)-tetraphosphatase) is a bacterial member of the PPP (phosphoprotein phosphatase) family of serine/threonine phosphatases that hydrolyzes the nucleotide-signaling molecule diadenosine tetraphosphate (Ap(4)A) into two ADP and also hydrolyzes Ap(5)A, Gp(4)G, and other extending compounds.  Null mutations in apaH result in high intracellular levels of Ap(4)A which correlate with multiple phenotypes, including a decreased expression of catabolite-repressible genes, a reduction in the expression of flagellar operons, and an increased sensitivity to UV  and heat.  Ap4A hydrolase is important in responding to heat shock and oxidative stress via regulating the concentration of Ap4A in bacteria.  Ap4A hydrolase is also thought to play a role in siderophore production, but the mechanism by which ApaH interacts with siderophore pathwa
Probab=48.38  E-value=17  Score=27.45  Aligned_cols=30  Identities=27%  Similarity=0.422  Sum_probs=25.2

Q ss_pred             CCchHHHHHHHHhh-CCCCEEEeeccccCCC
Q psy149           24 SYKPLEDLIALTVQ-QEPDVLILIGPLLDTS   53 (86)
Q Consensus        24 ~y~pL~~ll~~v~~-~~PdvlIL~GPFiD~~   53 (86)
                      .|+.|..+++++.- .+.|.+|++|=+||.-
T Consensus        10 ~~~~L~~LL~~i~~~~~~D~Li~lGDlVdRG   40 (257)
T cd07422          10 CYDELQRLLEKINFDPAKDRLWLVGDLVNRG   40 (257)
T ss_pred             CHHHHHHHHHhcCCCCCCCEEEEecCcCCCC
Confidence            57899999999875 4689999999999943


No 114
>cd07362 HPCD_like Class III extradiol dioxygenases with similarity to homoprotocatechuate 2,3-dioxygenase, which catalyzes the key ring cleavage step in the metabolism of homoprotocatechuate. This subfamily of class III extradiol dioxygenases consists of two types of  proteins with known enzymatic activities; 3,4-dihydroxyphenylacetate (homoprotocatechuate) 2,3-dioxygenase (HPCD) and 2-amino-5-chlorophenol 1,6-dioxygenase. HPCD catalyzes the key ring cleavage step in the metabolism of homoprotocatechuate (hpca), a central intermediate in the bacterial degradation of aromatic compounds. The enzyme incorporates both atoms of molecular oxygen into hpca, resulting in aromatic ring-opening to yield the product  alpha-hydroxy-delta-carboxymethyl cis-muconic semialdehyde. 2-amino-5-chlorophenol 1,6-dioxygenase catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol, which is an intermediate during p-chloronitrobenzene degradation. The enzyme is probably a heterotetrame
Probab=48.23  E-value=22  Score=26.76  Aligned_cols=24  Identities=21%  Similarity=0.398  Sum_probs=20.7

Q ss_pred             CchHHHHHHHHhhCCCCEEEeecc
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      ++-|.++-+++.+.+||++|++.|
T Consensus        29 ~~a~~~l~~~l~~~~Pd~IvvvS~   52 (272)
T cd07362          29 IKGMKEIRKRIEELKPDVILVISC   52 (272)
T ss_pred             HHHHHHHHHHhhHcCCCEEEEECC
Confidence            467778888888889999999999


No 115
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain. DR1119 is an uncharacterized Deinococcus radiodurans protein with a metallophosphatase domain.  The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordinat
Probab=47.80  E-value=22  Score=25.61  Aligned_cols=26  Identities=12%  Similarity=0.077  Sum_probs=17.7

Q ss_pred             hHHHHHHHHhhC--CCCEEEeeccccCC
Q psy149           27 PLEDLIALTVQQ--EPDVLILIGPLLDT   52 (86)
Q Consensus        27 pL~~ll~~v~~~--~PdvlIL~GPFiD~   52 (86)
                      .+.++.+.++..  +||+||+.|=+.+.
T Consensus        27 ~~~~i~~~~~~~~~~~D~viiaGDl~~~   54 (232)
T cd07393          27 HTEKIKENWDNVVAPEDIVLIPGDISWA   54 (232)
T ss_pred             HHHHHHHHHHhcCCCCCEEEEcCCCccC
Confidence            344444444443  99999999998753


No 116
>KOG2852|consensus
Probab=47.49  E-value=11  Score=30.41  Aligned_cols=13  Identities=46%  Similarity=0.767  Sum_probs=11.1

Q ss_pred             eeEEEEeCCCCCC
Q psy149            8 LSMFVSAGPYTQS   20 (86)
Q Consensus         8 l~i~vAaGPfT~~   20 (86)
                      -+|++|+||||..
T Consensus       198 ~~ivvsaGPWTsk  210 (380)
T KOG2852|consen  198 HKIVVSAGPWTSK  210 (380)
T ss_pred             eEEEEecCCCchh
Confidence            4789999999965


No 117
>cd07372 2A5CPDO_B The beta subunit of the Class III extradiol dioxygenase, 2-amino-5-chlorophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol. 2-amino-5-chlorophenol 1,6-dioxygenase (2A5CPDO), catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol, which is an intermediate during p-chloronitrobenzene degradation. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. The active 2A5CPDO enzyme is probably a heterotetramer, composed of two alpha and two beta subunits. The alpha and beta subunits share significant sequence similarity and may have evolved by gene duplication. This model describes the beta subunit, which contains a putative metal binding site with two conserved histidines; these residues are equivalent to two out of three Fe(II) bindin
Probab=47.48  E-value=23  Score=27.17  Aligned_cols=24  Identities=25%  Similarity=0.273  Sum_probs=20.6

Q ss_pred             chHHHHHHHHhhCCCCEEEeeccc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      +-+.++-++|++.+||++|++.|=
T Consensus        37 ~a~~~~~~~i~~~~Pd~IVViSpH   60 (294)
T cd07372          37 WAYERARESIEALKPDVLLVHSPH   60 (294)
T ss_pred             HHHHHHHHHHHHcCCCEEEEECCC
Confidence            567778888899999999999884


No 118
>PF02684 LpxB:  Lipid-A-disaccharide synthetase;  InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (2.4.1.- from EC) and related proteins into distinct sequence based families has been described []. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'. These enzymes belong to the glycosyltransferase family 19 GT19 from CAZY. Lipid-A-disaccharide synthetase 2.4.1.182 from EC is involved with acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase 2.3.1.129 from EC and tetraacyldisaccharide 4'-kinase 2.7.1.130 from EC in the biosynthesis of the phosphorylated glycolipid, lipid A, in the outer membrane of Escherichia coli and other bacteria. These enzymes catalyse the first disaccharide step in the synthesis of lipid-A-disaccharide.; GO: 0008915 lipid-A-disaccharide synthase activity, 0009245 lipid A biosynthetic process
Probab=47.31  E-value=21  Score=28.46  Aligned_cols=19  Identities=37%  Similarity=0.695  Sum_probs=15.7

Q ss_pred             HHHHHHHHhhCCCCEEEee
Q psy149           28 LEDLIALTVQQEPDVLILI   46 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~   46 (86)
                      ..++.+.+.+.+||++|++
T Consensus        71 ~~~~~~~~~~~~pd~vIlI   89 (373)
T PF02684_consen   71 FRKLVERIKEEKPDVVILI   89 (373)
T ss_pred             HHHHHHHHHHcCCCEEEEe
Confidence            4567778889999999984


No 119
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical). Alternate names include diadenosine-tetraphosphatase and Ap4A hydrolase.
Probab=46.89  E-value=19  Score=27.78  Aligned_cols=30  Identities=27%  Similarity=0.380  Sum_probs=25.3

Q ss_pred             CCchHHHHHHHHhh-CCCCEEEeeccccCCC
Q psy149           24 SYKPLEDLIALTVQ-QEPDVLILIGPLLDTS   53 (86)
Q Consensus        24 ~y~pL~~ll~~v~~-~~PdvlIL~GPFiD~~   53 (86)
                      .|+.|..+++++.- ...|.++++|=+||.-
T Consensus        12 c~daL~~LL~~i~f~~~~D~l~~lGDlVdRG   42 (279)
T TIGR00668        12 CYDELQALLERVEFDPGQDTLWLTGDLVARG   42 (279)
T ss_pred             CHHHHHHHHHHhCcCCCCCEEEEeCCccCCC
Confidence            57899999999973 4679999999999954


No 120
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain. This family includes bacterial proteins related to Tt1561 (also known as Aq1956 in Aquifex aeolicus), an uncharacterized Thermus thermophilus protein.  The conserved domain present in members of this family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets,
Probab=46.67  E-value=24  Score=26.08  Aligned_cols=42  Identities=26%  Similarity=0.456  Sum_probs=31.5

Q ss_pred             ceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCC
Q psy149            7 SLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTS   53 (86)
Q Consensus         7 ~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~   53 (86)
                      +.+|.+.|---     =+++.|..+++.+++.+||++|.+|=+.+..
T Consensus         4 ~~kIl~iSDiH-----gn~~~le~l~~~~~~~~~D~vv~~GDl~~~g   45 (224)
T cd07388           4 VRYVLATSNPK-----GDLEALEKLVGLAPETGADAIVLIGNLLPKA   45 (224)
T ss_pred             eeEEEEEEecC-----CCHHHHHHHHHHHhhcCCCEEEECCCCCCCC
Confidence            44555554332     2568899999998889999999999888754


No 121
>KOG3818|consensus
Probab=46.49  E-value=13  Score=31.22  Aligned_cols=30  Identities=17%  Similarity=0.318  Sum_probs=25.3

Q ss_pred             CCchHHHHHHHHhhCCCCEEEeeccccCCC
Q psy149           24 SYKPLEDLIALTVQQEPDVLILIGPLLDTS   53 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~   53 (86)
                      -++.|..+++.-+...|-.+||||+|-.+.
T Consensus       298 vm~aL~kifqgy~~~pP~~iIlcG~FtS~p  327 (525)
T KOG3818|consen  298 VMEALRKIFQGYKDAPPTAIILCGSFTSSP  327 (525)
T ss_pred             HHHHHHHHHhhccCCCCeEEEEeccccccc
Confidence            356788888888889999999999998664


No 122
>cd07361 MEMO_like Memo (mediator of ErbB2-driven cell motility) is co-precipitated with the C terminus of ErbB2, a protein involved in cell motility. This subfamily is composed of Memo (mediator of ErbB2-driven cell motility) and similar proteins. Memo is a protein that is co-precipitated with the C terminus of ErbB2, a protein involved in cell motility. It is required for the ErbB2-driven cell mobility and is found in protein complexes with cofilin, ErbB2 and PLCgamma1. However, Memo is not homologous to any known signaling proteins, and its function in ErbB2 signaling is not known. Structural studies show that Memo binds directly to a specific ErbB2-derived phosphopeptide. Memo is homologous to class III nonheme iron-dependent extradiol dioxygenases, however, no metal binding or enzymatic activity can be detected for Memo. This subfamily also contains a few members containing a C-terminal AMMECR1-like domain. The AMMECR1 protein was proposed to be a regulatory factor that is potentia
Probab=46.04  E-value=17  Score=26.93  Aligned_cols=13  Identities=23%  Similarity=0.715  Sum_probs=11.6

Q ss_pred             hhCCCCEEEeecc
Q psy149           36 VQQEPDVLILIGP   48 (86)
Q Consensus        36 ~~~~PdvlIL~GP   48 (86)
                      .+.+||++|++||
T Consensus        61 ~~~~p~~vvilgP   73 (266)
T cd07361          61 DPGKPKRVVILGP   73 (266)
T ss_pred             ccCCCCEEEEECC
Confidence            3689999999999


No 123
>cd07370 HPCD The Class III extradiol dioxygenase, homoprotocatechuate 2,3-dioxygenase, catalyzes the key ring cleavage step in the metabolism of homoprotocatechuate. 3,4-dihydroxyphenylacetate (homoprotocatechuate) 2,3-dioxygenase (HPCD) catalyzes the key ring cleavage step in the metabolism of homoprotocatechuate (hpca), a central intermediate in the bacterial degradation of aromatic compounds. The enzyme incorporates both atoms of molecular oxygen into hpca, resulting in aromatic ring-opening to yield alpha-hydroxy-delta-carboxymethyl cis-muconic semialdehyde. HPCD is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.
Probab=45.99  E-value=12  Score=28.04  Aligned_cols=25  Identities=8%  Similarity=0.128  Sum_probs=16.7

Q ss_pred             chHHHHHHHHhhCCCCEEEeecccc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      +-|.++-+.+.+.+||++|+++|=-
T Consensus        32 ~~~~~~~~~l~~~~Pd~ivviS~H~   56 (280)
T cd07370          32 DGLKEIGRRARELGVDTIVVFDTHW   56 (280)
T ss_pred             HHHHHHHHHhhHcCCCEEEEECCCc
Confidence            3444444445456999999998744


No 124
>cd01830 XynE_like SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=45.84  E-value=80  Score=21.72  Aligned_cols=54  Identities=11%  Similarity=0.056  Sum_probs=28.2

Q ss_pred             HHHHHHHHhhC-CCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHHHHhhcccc
Q psy149           28 LEDLIALTVQQ-EPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDSIVQPLE   82 (86)
Q Consensus        28 L~~ll~~v~~~-~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~i~~~~~   82 (86)
                      +..|-..+... +||+|++++=-=|.....-..+.-..+.+++ ++-+..+++.++
T Consensus        62 l~r~~~~v~~~~~p~~vii~~G~ND~~~~~~~~~~~~~~~~~~-~~~l~~ii~~~~  116 (204)
T cd01830          62 LARFDRDVLSQPGVRTVIILEGVNDIGASGTDFAAAPVTAEEL-IAGYRQLIRRAH  116 (204)
T ss_pred             HHHHHHHHhcCCCCCEEEEecccccccccccccccCCCCHHHH-HHHHHHHHHHHH
Confidence            33343334444 6999888887777765332211112344443 445555555554


No 125
>PF00149 Metallophos:  Calcineurin-like phosphoesterase;  InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11. The most conserved regions in this domain centre around the metal chelating residues.; GO: 0016787 hydrolase activity; PDB: 2IAE_C 3DW8_F 3FGA_C 2IE4_C 2NYM_C 2NYL_C 3K7V_C 2NPP_C 2IE3_C 3K7W_C ....
Probab=45.83  E-value=46  Score=19.94  Aligned_cols=29  Identities=28%  Similarity=0.651  Sum_probs=23.3

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCCCCcc
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDTSHPL   56 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~~h~~   56 (86)
                      ...+.+...+.+||.+|..|=++|.....
T Consensus        20 ~~~~~~~~~~~~~d~ii~~GD~~~~~~~~   48 (200)
T PF00149_consen   20 FRKLDEIAAENKPDFIIFLGDLVDGGNPS   48 (200)
T ss_dssp             HHHHHHHHHHTTTSEEEEESTSSSSSSHH
T ss_pred             HHHHHHHhccCCCCEEEeecccccccccc
Confidence            35666777789999999999998877643


No 126
>PRK03881 hypothetical protein; Provisional
Probab=45.79  E-value=23  Score=28.68  Aligned_cols=23  Identities=30%  Similarity=0.668  Sum_probs=16.6

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +-+.++-+.+...+||++|++||
T Consensus        32 ~a~~~~~~~l~~~~Pd~IVVisp   54 (467)
T PRK03881         32 DALRELARRIAEKKPDTIIIISP   54 (467)
T ss_pred             HHHHHHHHHHHHhCCCEEEEECC
Confidence            34455555555569999999999


No 127
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain. Cdc1 (also known as XlCdc1 in Xenopus laevis) is an endoplasmic reticulum-localized transmembrane lipid phosphatase with a metallophosphatase domain facing the ER lumen.  In budding yeast, the gene encoding CDC1 is essential while nonlethal mutations cause defects in Golgi inheritance and actin polarization.  Cdc1 mutant cells accumulate an unidentified phospholipid, suggesting that Cdc1 is a lipid phosphatase.  Cdc1 mutant cells also have highly elevated intracellular calcium levels suggesting a possible role for Cdc1 in calcium regulation.  The 5' flanking region of Cdc1 is a regulatory region with conserved binding site motifs for AP1, AP2, Sp1, NF-1 and CREB.  DNA polymerase delta consists of at least four subunits - Pol3, Cdc1, Cdc27, and Cdm1.  This group also contains Saccharomyces cerevisiae TED1 (Trafficking of Emp24p/Erv25p-dependent cargo disrupted 1), which acts together wit
Probab=45.16  E-value=33  Score=23.85  Aligned_cols=28  Identities=21%  Similarity=0.412  Sum_probs=21.4

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCCCCc
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDTSHP   55 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~~h~   55 (86)
                      ++.+-..+++.+||.||++|=++|...+
T Consensus        34 ~~~~~~~i~~~~pd~vi~lGDl~d~~~~   61 (171)
T cd07384          34 RRAFKTALQRLKPDVVLFLGDLFDGGRI   61 (171)
T ss_pred             HHHHHHHHHhcCCCEEEEeccccCCcEe
Confidence            4445555667999999999999987553


No 128
>PF10996 Beta-Casp:  Beta-Casp domain;  InterPro: IPR022712  The beta-CASP domain is found C-terminal to the beta-lactamase domain in pre-mRNA 3'-end-processing endonuclease. The active site of this enzyme is located at the interface of these two domains []. ; PDB: 2YCB_B 2XR1_B 2I7T_A 2I7V_A 2I7X_A 3A4Y_A 3IE2_D 3IE1_B 3IE0_D 2DKF_D ....
Probab=44.91  E-value=39  Score=21.49  Aligned_cols=35  Identities=11%  Similarity=0.176  Sum_probs=27.5

Q ss_pred             eEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149            9 SMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus         9 ~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      .|++|+     +-++++-+-.+++++...++=+.+|++|.
T Consensus        82 ~Vvias-----~gml~~G~s~~~l~~~~~d~~n~Ii~~gy  116 (126)
T PF10996_consen   82 KVVIAS-----SGMLEGGRSRHYLKRLASDPRNTIIFTGY  116 (126)
T ss_dssp             EEEEES-----STTSSSSHHHHHHHHHTTSTTSEEEESSS
T ss_pred             eEEEeC-----CCCCCCCHHHHHHHHHcCCCCCeEEEecC
Confidence            566654     44577779999999998888889999986


No 129
>PF12850 Metallophos_2:  Calcineurin-like phosphoesterase superfamily domain;  InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [].; PDB: 2GJU_A 1Z2W_A 1Z2X_B 3PSO_B 3PSN_B 1W24_A 2R17_B 3QFN_B 3QFO_A 3QFM_A ....
Probab=44.71  E-value=24  Score=22.60  Aligned_cols=26  Identities=31%  Similarity=0.724  Sum_probs=20.5

Q ss_pred             CCchHHHHHHHHhhCCCCEEEeeccccC
Q psy149           24 SYKPLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      +...+.++++++  .+||.+|.+|=++|
T Consensus        12 ~~~~~~~~~~~~--~~~d~vi~~GDi~~   37 (156)
T PF12850_consen   12 NLDALEAVLEYI--NEPDFVIILGDIFD   37 (156)
T ss_dssp             THHHHHHHHHHH--TTESEEEEES-SCS
T ss_pred             ChhHHHHHHHHh--cCCCEEEECCCchh
Confidence            445678899988  56999999998887


No 130
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain. This family includes bacterial, eukaryotic, and archeal proteins orthologous to the Shewanella cold-active protein-tyrosine phosphatase, CAPTPase.  CAPTPase is an uncharacterized protein that belongs to the Shelph (Shewanella-like phosphatase) family of PPP (phosphoprotein phosphatases).  The PPP family is one of two known protein phosphatase families specific for serine and threonine.  In addition to Shelps, the PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes.  Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes.  PPPs belong to the metal
Probab=44.62  E-value=21  Score=25.60  Aligned_cols=30  Identities=10%  Similarity=0.258  Sum_probs=24.7

Q ss_pred             CCchHHHHHHHHh--------hCCCCEEEeeccccCCC
Q psy149           24 SYKPLEDLIALTV--------QQEPDVLILIGPLLDTS   53 (86)
Q Consensus        24 ~y~pL~~ll~~v~--------~~~PdvlIL~GPFiD~~   53 (86)
                      +|+.|..+++.+.        +.+.|.||++|=++|.-
T Consensus         9 ~~~~l~~ll~~~~~~~~~~~~~~~~d~lv~lGD~vdrG   46 (208)
T cd07425           9 DLDAFREILKGAGVIDSNDHWIGGSTHLVQLGDIFDRG   46 (208)
T ss_pred             CHHHHHHHHHHCCCCCccccccCCCcEEEEECCCcCCC
Confidence            5778899998876        45789999999999964


No 131
>PRK09982 universal stress protein UspD; Provisional
Probab=44.24  E-value=69  Score=20.86  Aligned_cols=20  Identities=20%  Similarity=0.359  Sum_probs=18.2

Q ss_pred             chHHHHHHHHhhCCCCEEEe
Q psy149           26 KPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL   45 (86)
                      +|-..+++++.+.++|++|+
T Consensus        90 ~p~~~I~~~A~~~~aDLIVm  109 (142)
T PRK09982         90 EMPETLLEIMQKEQCDLLVC  109 (142)
T ss_pred             CHHHHHHHHHHHcCCCEEEE
Confidence            69999999999999999776


No 132
>cd07369 PydA_Rs_like PydA is a Class III Extradiol ring-cleavage dioxygenase required for the degradation of 3-hydroxy-4-pyridone (HP). This subfamily is composed of Rhizobium sp. PydA and similar proteins. PydA is required for the degradation of 3-hydroxy-4-pyridone (HP), an intermediate in the Leucaena toxin mimosine degradation pathway. It is a member of the class III extradiol dioxygenase family, a group of enzymes that use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.
Probab=43.78  E-value=22  Score=27.92  Aligned_cols=23  Identities=22%  Similarity=0.138  Sum_probs=18.7

Q ss_pred             CchHHHHHHHHhhCCCCEEEeec
Q psy149           25 YKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      ++.+.++-+.+++.+||++|++|
T Consensus        32 ~~a~~~l~~~v~~~~PD~iVV~~   54 (329)
T cd07369          32 EEATLKLGRTLTAARPDVIIAFL   54 (329)
T ss_pred             HHHHHHHHHHHHHhCCCEEEEEc
Confidence            35677778888889999999983


No 133
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane]
Probab=43.68  E-value=36  Score=26.35  Aligned_cols=37  Identities=16%  Similarity=0.272  Sum_probs=30.9

Q ss_pred             CCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           18 TQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        18 T~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      ++..++|.+--+.+.+.+++.|||++|=+-.+-+.+-
T Consensus        29 ~~~~~~Ditd~~~v~~~i~~~~PDvVIn~AAyt~vD~   65 (281)
T COG1091          29 TDRAELDITDPDAVLEVIRETRPDVVINAAAYTAVDK   65 (281)
T ss_pred             ccCccccccChHHHHHHHHhhCCCEEEECcccccccc
Confidence            3455688888888899999999999999999888765


No 134
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RL J Bacteriol 1993 Mar;175(6):1841-3
Probab=43.53  E-value=30  Score=25.21  Aligned_cols=21  Identities=19%  Similarity=0.290  Sum_probs=16.6

Q ss_pred             HHHHHHhhCCCCEEEeecccc
Q psy149           30 DLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        30 ~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      .+.+.+++.+||+++..+++.
T Consensus        81 ~l~~~i~~~~pDvVi~~~~~~  101 (348)
T TIGR01133        81 QARRILKKFKPDAVIGFGGYV  101 (348)
T ss_pred             HHHHHHHhcCCCEEEEcCCcc
Confidence            455667889999999987763


No 135
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain. PrpA and PrpB are bacterial type I serine/threonine and tyrosine phosphatases thought to modulate the expression of proteins that protect the cell upon accumulation of misfolded proteins in the periplasm.  The PPP (phosphoprotein phosphatase) family, to which PrpA and PrpB belong, is one of two known protein phosphatase families specific for serine and threonine.  This family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes.  Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes.  PPPs belong to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all 
Probab=43.28  E-value=23  Score=24.98  Aligned_cols=30  Identities=27%  Similarity=0.379  Sum_probs=24.2

Q ss_pred             CCchHHHHHHHHhh-CCCCEEEeeccccCCC
Q psy149           24 SYKPLEDLIALTVQ-QEPDVLILIGPLLDTS   53 (86)
Q Consensus        24 ~y~pL~~ll~~v~~-~~PdvlIL~GPFiD~~   53 (86)
                      +|+.|..+++.+.. .++|.+|.+|=++|..
T Consensus        12 ~~~~l~~~l~~~~~~~~~d~~~~~GD~v~~g   42 (207)
T cd07424          12 HYSLLQKALDAVGFDPARDRLISVGDLIDRG   42 (207)
T ss_pred             CHHHHHHHHHHcCCCCCCCEEEEeCCcccCC
Confidence            45788888888764 4799999999999854


No 136
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent. The annotation of Botryococcus braunii as lactate dehydrogenase appears top be in error. This was initially annotated as MDH by Swiss-Prot and then changed. The rationale for either of these annotations is not traceable.
Probab=43.11  E-value=30  Score=26.33  Aligned_cols=36  Identities=14%  Similarity=0.397  Sum_probs=23.9

Q ss_pred             EEEEeC-CCCCCCC------CCCchHHHHHHHHhhCCCCEEEe
Q psy149           10 MFVSAG-PYTQSDT------LSYKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        10 i~vAaG-PfT~~d~------l~y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      |++++| |.....+      -+-+-+.+.++.+.+..||..|+
T Consensus        73 VIitag~p~~~~~sR~~l~~~N~~iv~~i~~~I~~~~p~~~iI  115 (305)
T TIGR01763        73 VVITAGLPRKPGMSREDLLSMNAGIVREVTGRIMEHSPNPIIV  115 (305)
T ss_pred             EEEcCCCCCCcCCCHHHHHHHHHHHHHHHHHHHHHHCCCeEEE
Confidence            455556 5544323      45677888889999888995544


No 137
>PRK13195 pyrrolidone-carboxylate peptidase; Provisional
Probab=43.05  E-value=27  Score=26.13  Aligned_cols=27  Identities=19%  Similarity=0.322  Sum_probs=19.0

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      ...+.+.+.+.+||++|.+|=.=-.++
T Consensus        50 ~~~l~~~i~~~~Pd~Vi~~G~a~gr~~   76 (222)
T PRK13195         50 IAAAQQAIAEIEPALVIMLGEYPGRSM   76 (222)
T ss_pred             HHHHHHHHHHHCCCEEEEeCccCCcCc
Confidence            345556667789999999996644443


No 138
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain. A functionally uncharacterized subgroup related to the metallophosphatase domain of Saccharomyces cerevisiae Cdc1, S. cerevisiae Ted1 and human MPPE1. Cdc1 is an endoplasmic reticulum-localized transmembrane lipid phosphatase and is a subunit of DNA polymerase delta. TED1 (trafficking of Emp24p/Erv25p-dependent cargo disrupted 1), acts together with Emp24p and Erv25p in cargo exit from the ER.  The MPPE1 gene is a candidate susceptibility gene for Bipolar disorder.  Proteins in this uncharacterized subgroup belong to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like R
Probab=43.00  E-value=31  Score=25.20  Aligned_cols=24  Identities=25%  Similarity=0.459  Sum_probs=19.6

Q ss_pred             HHHHHhhCCCCEEEeeccccCCCC
Q psy149           31 LIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        31 ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      +...++..+||++|++|=++|...
T Consensus        34 ~~~a~~~l~PD~Vi~lGDL~D~G~   57 (195)
T cd08166          34 YHLALNFVQPDIVIFLGDLMDEGS   57 (195)
T ss_pred             HHHHHhccCCCEEEEeccccCCCC
Confidence            445566789999999999999865


No 139
>PRK10116 universal stress protein UspC; Provisional
Probab=42.87  E-value=33  Score=21.88  Aligned_cols=20  Identities=15%  Similarity=0.265  Sum_probs=18.4

Q ss_pred             chHHHHHHHHhhCCCCEEEe
Q psy149           26 KPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .|-..+++++++.++|++|+
T Consensus        89 ~~~~~I~~~a~~~~~DLiV~  108 (142)
T PRK10116         89 ELSEHILEVCRKHHFDLVIC  108 (142)
T ss_pred             CHHHHHHHHHHHhCCCEEEE
Confidence            58899999999999999998


No 140
>KOG1257|consensus
Probab=42.60  E-value=25  Score=30.11  Aligned_cols=21  Identities=29%  Similarity=0.344  Sum_probs=18.8

Q ss_pred             CchHHHHHHHHhhCCCCEEEe
Q psy149           25 YKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      -+|..+|++.|++.||++||=
T Consensus       375 ~~~~~~L~e~V~~vKPtvLiG  395 (582)
T KOG1257|consen  375 HEEIKDLEEAVKEVKPTVLIG  395 (582)
T ss_pred             ChHHHHHHHHHHhcCCcEEEe
Confidence            468999999999999999884


No 141
>PF06925 MGDG_synth:  Monogalactosyldiacylglycerol (MGDG) synthase;  InterPro: IPR009695 This entry represents a conserved region of approximately 180 residues found towirds the N terminus of a number of plant and bacterial diacylglycerol glucosyltransferases, such as monogalactosyldiacylglycerol synthase [].; GO: 0016758 transferase activity, transferring hexosyl groups, 0009247 glycolipid biosynthetic process
Probab=42.23  E-value=32  Score=23.41  Aligned_cols=22  Identities=32%  Similarity=0.519  Sum_probs=17.6

Q ss_pred             HHHHHHHHhhCCCCEEEeeccc
Q psy149           28 LEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      ...|.+.+++.+||++|-.=||
T Consensus        78 ~~~l~~~l~~~~PD~IIsThp~   99 (169)
T PF06925_consen   78 ARRLIRLLREFQPDLIISTHPF   99 (169)
T ss_pred             HHHHHHHHhhcCCCEEEECCcc
Confidence            3467788889999999977666


No 142
>PRK13193 pyrrolidone-carboxylate peptidase; Provisional
Probab=42.20  E-value=26  Score=25.75  Aligned_cols=32  Identities=25%  Similarity=0.389  Sum_probs=22.3

Q ss_pred             CCCchHHHHHHH-HhhCCCCEEEeeccccCCCC
Q psy149           23 LSYKPLEDLIAL-TVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        23 l~y~pL~~ll~~-v~~~~PdvlIL~GPFiD~~h   54 (86)
                      .+|+...+.+.. +.+.+||++|.+|=.--.+.
T Consensus        43 v~~~~~~~~l~~~~~~~~Pd~vl~~G~a~~r~~   75 (209)
T PRK13193         43 VEYEKIEDLIVTKIREMKPILTLGIGVAPGRAK   75 (209)
T ss_pred             CcHHHHHHHHHHHHHHHCCCEEEEecccCCcCc
Confidence            346677777764 45579999999996644443


No 143
>COG1408 Predicted phosphohydrolases [General function prediction only]
Probab=41.94  E-value=37  Score=25.97  Aligned_cols=27  Identities=22%  Similarity=0.422  Sum_probs=24.2

Q ss_pred             chHHHHHHHHhhCCCCEEEeeccccCC
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      +...+++..+.+..||++++.|=++|.
T Consensus        60 ~~~~~~~~~i~~~~~DlivltGD~~~~   86 (284)
T COG1408          60 EEKLALLIAIANELPDLIVLTGDYVDG   86 (284)
T ss_pred             HHHHHHHHHHHhcCCCEEEEEeeeecC
Confidence            566788888999999999999999996


No 144
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain. Dbr1 is an RNA lariat debranching enzyme that hydrolyzes 2'-5' phosphodiester bonds at the branch points of excised intron lariats.  This alignment model represents the N-terminal metallophosphatase domain of Dbr1.  This domain belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal s
Probab=41.79  E-value=64  Score=24.32  Aligned_cols=48  Identities=10%  Similarity=0.372  Sum_probs=33.9

Q ss_pred             CCceeEEEEeCCCCCCCCCC----------CchHHHHHHHHhh-CCCCEEEeeccccCCCCc
Q psy149            5 RRSLSMFVSAGPYTQSDTLS----------YKPLEDLIALTVQ-QEPDVLILIGPLLDTSHP   55 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~d~l~----------y~pL~~ll~~v~~-~~PdvlIL~GPFiD~~h~   55 (86)
                      +.+..++|.||=|+...+.+          |.-+.++.++... .+..+.++   ||+.+|+
T Consensus        26 ~~~~D~lI~~GDf~~~~~~~d~~~~~~p~k~~~~~~f~~~~~g~~~~p~~t~---fi~GNHE   84 (262)
T cd00844          26 GTKVDLLICCGDFQAVRNEADLKCMAVPPKYRKMGDFYKYYSGEKKAPILTI---FIGGNHE   84 (262)
T ss_pred             CCCCcEEEEcCCCCCcCCcchhhhhccchhhhhhhhHHHHhcCCccCCeeEE---EECCCCC
Confidence            46788999999998654433          4567888888886 33555554   6777775


No 145
>COG1880 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon subunit [Energy production and conversion]
Probab=41.41  E-value=42  Score=24.52  Aligned_cols=42  Identities=14%  Similarity=0.215  Sum_probs=31.6

Q ss_pred             EEEeCCCCCCC-----CCCCchHHHHHHHHhh---------CCCCEEEeeccccCC
Q psy149           11 FVSAGPYTQSD-----TLSYKPLEDLIALTVQ---------QEPDVLILIGPLLDT   52 (86)
Q Consensus        11 ~vAaGPfT~~d-----~l~y~pL~~ll~~v~~---------~~PdvlIL~GPFiD~   52 (86)
                      +||.|++-...     .-.|--|.++-++...         -.+|+||++|=.-+.
T Consensus        66 ivaTa~~~~~~~~~~i~~~~~~lh~it~~l~Dp~w~G~dg~g~yDlviflG~~~yy  121 (170)
T COG1880          66 IVATASSMGNLIGRGIGSEYINLHAITQYLTDPNWPGFDGNGNYDLVIFLGSIYYY  121 (170)
T ss_pred             eEecchhhcchhhcccccchhHHHHHHHHhcCCCCCCcCCCCCcceEEEEeccHHH
Confidence            56777776532     2457789999999988         889999999965544


No 146
>PF00582 Usp:  Universal stress protein family;  InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA [] reveals an alpha/beta fold similar to that of the Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0577 protein, which binds ATP [], though UspA lacks ATP-binding activity.; GO: 0006950 response to stress; PDB: 3DLO_C 3QTB_A 2PFS_A 3TNJ_A 1JMV_D 3FH0_B 3FDX_B 3AB7_A 3AB8_A 2GM3_F ....
Probab=41.40  E-value=43  Score=20.11  Aligned_cols=21  Identities=10%  Similarity=0.354  Sum_probs=18.5

Q ss_pred             chHHHHHHHHhhCCCCEEEee
Q psy149           26 KPLEDLIALTVQQEPDVLILI   46 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~   46 (86)
                      .+-..+++.+++.++|.+|+=
T Consensus        89 ~~~~~i~~~~~~~~~dliv~G  109 (140)
T PF00582_consen   89 DVADAIIEFAEEHNADLIVMG  109 (140)
T ss_dssp             SHHHHHHHHHHHTTCSEEEEE
T ss_pred             ccchhhhhccccccceeEEEe
Confidence            378999999999999999883


No 147
>PF05036 SPOR:  Sporulation related domain;  InterPro: IPR007730 This 70 residue domain is composed of two 35 residue repeats that are found in bacterial proteins involved in sporulation and cell division, such as FtsN, CwlM and RlpA. This repeat might be involved in binding peptidoglycan. FtsN is an essential cell division protein with a simple bitopic topology: a short N-terminal cytoplasmic segment fused to a large carboxy periplasmic domain through a single transmembrane domain. The repeats lie at the periplasmic C terminus, which has an RNP-like fold []. FtsN localises to the septum ring complex. The CwlM protein is a cell wall hydrolase, where the C-terminal region, including the repeats, determines substrate specificity []. RlpA is a rare lipoprotein A protein that may be important for cell division. Its N-terminal cysteine may be attached to thioglyceride and N-fatty acyl residues [].; PDB: 1X60_A 1UTA_A.
Probab=41.37  E-value=49  Score=18.74  Aligned_cols=28  Identities=21%  Similarity=0.466  Sum_probs=14.1

Q ss_pred             EEeCCCCCCCCCCCchHHHHHHHHh-hCCCCEEE
Q psy149           12 VSAGPYTQSDTLSYKPLEDLIALTV-QQEPDVLI   44 (86)
Q Consensus        12 vAaGPfT~~d~l~y~pL~~ll~~v~-~~~PdvlI   44 (86)
                      |-.|||.+.     +--.+.++.++ ...++..|
T Consensus        46 V~~G~f~~~-----~~A~~~~~~l~~~~~~~~~v   74 (76)
T PF05036_consen   46 VRVGPFSSR-----EEAEAALRKLKKAAGPDAFV   74 (76)
T ss_dssp             EEECCECTC-----CHHHHHHHHHHHHHTS--EE
T ss_pred             EEECCCCCH-----HHHHHHHHHHhHhhCCCCEE
Confidence            334777655     34455666665 45555443


No 148
>COG0803 LraI ABC-type metal ion transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism]
Probab=41.11  E-value=44  Score=25.38  Aligned_cols=54  Identities=24%  Similarity=0.374  Sum_probs=41.5

Q ss_pred             CCchHHHHHHHHhhCCCCEEEeeccccCCCCcc--------ccCCCc----CCCHHHHHHHHHHHh
Q psy149           24 SYKPLEDLIALTVQQEPDVLILIGPLLDTSHPL--------LLNGSL----AETFEDFYVKLIDSI   77 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~--------i~~g~~----~~t~eelF~~~i~~i   77 (86)
                      +|.|+.++++.|...+.+|..|++|=.|...=.        +++.++    ...+|+.+.+.+.+.
T Consensus        38 t~~~~~d~~~~I~gd~~~V~~iv~~g~dpH~yepsp~di~~i~~ADliv~nG~~le~w~~k~~~~~  103 (303)
T COG0803          38 TFPPIADVVKNIAGDKVDVVSLVPPGADPHSYEPTPSDIAKLRKADLIVYNGLGLEPWLEKLLESA  103 (303)
T ss_pred             ecHHHHHHHHHhcCCceeEEEecCCCCCCcCCCCCHHHHHHHHhCCEEEEcCCChHHHHHHHHHhc
Confidence            588999999999999999999999998887722        334443    667888556666543


No 149
>PF03167 UDG:  Uracil DNA glycosylase superfamily;  InterPro: IPR005122 This entry represents various uracil-DNA glycosylases and related DNA glycosylases (3.2.2 from EC), such as uracil-DNA glycosylase [], thermophilic uracil-DNA glycosylase [], G:T/U mismatch-specific DNA glycosylase (Mug) [], and single-strand selective monofunctional uracil-DNA glycosylase (SMUG1) []. These proteins have a 3-layer alpha/beta/alpha structure. Uracil-DNA glycosylases are DNA repair enzymes that excise uracil residues from DNA by cleaving the N-glycosylic bond, initiating the base excision repair pathway. Uracil in DNA can arise either through the deamination of cytosine to form mutagenic U:G mispairs, or through the incorporation of dUMP by DNA polymerase to form U:A pairs []. These aberrant uracil residues are genotoxic []. The sequence of uracil-DNA glycosylase is extremely well conserved [] in bacteria and eukaryotes as well as in herpes viruses. More distantly related uracil-DNA glycosylases are also found in poxviruses []. In eukaryotic cells, UNG activity is found in both the nucleus and the mitochondria. Human UNG1 protein is transported to both the mitochondria and the nucleus []. The N-terminal 77 amino acids of UNG1 seem to be required for mitochondrial localization, but the presence of a mitochondrial transit peptide has not been directly demonstrated. The most N-terminal conserved region contains an aspartic acid residue which has been proposed, based on X-ray structures [] to act as a general base in the catalytic mechanism. ; PDB: 1UI0_A 1UI1_A 2C2P_A 2C2Q_A 1MTL_B 1MWI_A 1MUG_A 1MWJ_A 1OKB_B 1OE6_A ....
Probab=40.81  E-value=52  Score=20.93  Aligned_cols=22  Identities=18%  Similarity=0.114  Sum_probs=17.1

Q ss_pred             HHHHHHHHhhCCCCEEEeeccc
Q psy149           28 LEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      ...|.+.+...+|.++|++|=.
T Consensus        75 ~~~l~~~l~~~~p~iii~lG~~   96 (152)
T PF03167_consen   75 EPFLEEELEIIKPKIIICLGKE   96 (152)
T ss_dssp             HHHHHHHHHHHSSSEEEEESHH
T ss_pred             hhhHHHHHHhcCCCEEEEEchH
Confidence            4467777777889999999943


No 150
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain. This domain shows similarity with B12 (adenosylcobamide) binding domains found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase, but it lacks the signature motif Asp-X-His-X-X-Gly, which contains the histidine that acts as a cobalt ligand. The function of this domain remains unclear.
Probab=40.71  E-value=23  Score=22.89  Aligned_cols=29  Identities=17%  Similarity=0.229  Sum_probs=20.8

Q ss_pred             CchHHHHHHHHhhCCCCEEEe-eccccCCC
Q psy149           25 YKPLEDLIALTVQQEPDVLIL-IGPLLDTS   53 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL-~GPFiD~~   53 (86)
                      +....++++.+++..||+.|. -||.....
T Consensus        52 ~~~~~~~~~~ik~~~p~~~iv~GG~~~t~~   81 (127)
T cd02068          52 IYEALELAKIAKEVLPNVIVVVGGPHATFF   81 (127)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEECCcchhhC
Confidence            346788999999999985555 45665543


No 151
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain. This family includes the bacterial enzyme UshA, and related enzymes including SoxB, CpdB, YhcR, and CD73.  All members have a similar domain architecture which includes an N-terminal metallophosphatase domain and a C-terminal nucleotidase domain.  The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich 
Probab=40.70  E-value=34  Score=24.34  Aligned_cols=32  Identities=22%  Similarity=0.176  Sum_probs=25.2

Q ss_pred             CCCchHHHHHHHHhhCCCC-EEEeeccccCCCC
Q psy149           23 LSYKPLEDLIALTVQQEPD-VLILIGPLLDTSH   54 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~~Pd-vlIL~GPFiD~~h   54 (86)
                      -.+..+..+++.+++..|| +++..|=+++..-
T Consensus        20 ~g~~~l~~~v~~~~~~~~~~l~v~~GD~~~~~~   52 (252)
T cd00845          20 GGAARLATLIKEERAENENTLLLDAGDNFDGSP   52 (252)
T ss_pred             CCHHHHHHHHHHHHhcCCCeEEEeCCccCCCcc
Confidence            4667889999999999999 5566788877544


No 152
>cd04501 SGNH_hydrolase_like_4 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=40.64  E-value=93  Score=20.64  Aligned_cols=15  Identities=27%  Similarity=0.598  Sum_probs=10.1

Q ss_pred             HHHhhCCCCEEEeec
Q psy149           33 ALTVQQEPDVLILIG   47 (86)
Q Consensus        33 ~~v~~~~PdvlIL~G   47 (86)
                      +.+...+||++++..
T Consensus        53 ~~~~~~~~d~v~i~~   67 (183)
T cd04501          53 EDVIALKPAVVIIMG   67 (183)
T ss_pred             HHHHhcCCCEEEEEe
Confidence            334568999777654


No 153
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain. UshA is a bacterial periplasmic enzyme with UDP-sugar hydrolase and dinucleoside-polyphosphate hydrolase activities associated with its N-terminal metallophosphatase domain, and 5'-nucleotidase activity associated with its C-terminal domain.  UshA has been studied in Escherichia coli where it is expressed from the ushA gene as an immature precursor and proteolytically cleaved to form a mature product upon export to the periplasm.  UshA hydrolyzes many different nucleotides and nucleotide derivitives and has been shown to degrade external UDP-glucose to uridine, glucose 1-phosphate and phosphate for utilization by the cell.  The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs
Probab=40.49  E-value=61  Score=24.23  Aligned_cols=42  Identities=14%  Similarity=0.345  Sum_probs=24.9

Q ss_pred             CCceeEEEEeCCCCCC-------CCCCCc-h---HHHHHHHHhhCCCCEEEee
Q psy149            5 RRSLSMFVSAGPYTQS-------DTLSYK-P---LEDLIALTVQQEPDVLILI   46 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~-------d~l~y~-p---L~~ll~~v~~~~PdvlIL~   46 (86)
                      |-.+-|+=.+.|.+..       +.+.|. |   +...++.+++.++|++|++
T Consensus       128 G~kIgviG~t~~~~~~~~~~~~~~~~~f~d~~~~~~~~v~~lk~~~~D~VI~l  180 (285)
T cd07405         128 GLKIAVIGLTTDDTAKIGNPAYFEGIEFRPPIHEAKEVVPELKQEKPDIVIAA  180 (285)
T ss_pred             CEEEEEEEecccccccccCcCCcCCcEEcCHHHHHHHHHHHHHHcCCCEEEEE
Confidence            3344445556666543       245443 3   3445666676799999997


No 154
>PF03721 UDPG_MGDP_dh_N:  UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain;  InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]. The enzymes have a wide range of functions. In plants UDP-glucose dehydrogenase, 1.1.1.22 from EC, is an important enzyme in the synthesis of hemicellulose and pectin [], which are the components of newly formed cell walls; while in zebrafish UDP-glucose dehydrogenase is required for cardiac valve formation []. In Xanthomonas campestris, a plant pathogen, UDP-glucose dehydrogenase is required for virulence [].  GDP-mannose dehydrogenase, 1.1.1.132 from EC, catalyses the formation of GDP-mannuronic acid, which is the monomeric unit from which the exopolysaccharide alginate is formed. Alginate is secreted by a number of bacteria, which include Pseudomonas aeruginosa and Azotobacter vinelandii. In P. aeruginosa, alginate is believed to play an important role in the bacteria's resistance to antibiotics and the host immune response [], while in A. vinelandii it is essential for the encystment process []. This entry represents the N-terminal NAD(+)-binding domain. Structural studies indicate that this domain forms an alpha-beta structure containing the six-stranded parallel beta sheet characteristic of the dinucleotide binding Rossman fold [, ].; GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, 0051287 NAD binding, 0055114 oxidation-reduction process; PDB: 3OJO_A 3OJL_A 1MV8_B 1MUU_A 1MFZ_C 3GG2_D 1DLJ_A 1DLI_A 3G79_B 2Y0E_D ....
Probab=40.28  E-value=37  Score=24.01  Aligned_cols=36  Identities=14%  Similarity=0.343  Sum_probs=25.7

Q ss_pred             EEEEeC-CCCCCCCCCCchHHHHHHHHhh-CCCC-EEEe
Q psy149           10 MFVSAG-PYTQSDTLSYKPLEDLIALTVQ-QEPD-VLIL   45 (86)
Q Consensus        10 i~vAaG-PfT~~d~l~y~pL~~ll~~v~~-~~Pd-vlIL   45 (86)
                      ++|+-+ |+..+...|++++.+.++.+.+ .+++ ++|+
T Consensus        80 ~~I~VpTP~~~~~~~Dls~v~~a~~~i~~~l~~~~lvV~  118 (185)
T PF03721_consen   80 VFICVPTPSDEDGSPDLSYVESAIESIAPVLRPGDLVVI  118 (185)
T ss_dssp             EEE----EBETTTSBETHHHHHHHHHHHHHHCSCEEEEE
T ss_pred             EEEecCCCccccCCccHHHHHHHHHHHHHHHhhcceEEE
Confidence            456666 8888888899999999999987 5554 4444


No 155
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed
Probab=40.19  E-value=30  Score=29.71  Aligned_cols=19  Identities=16%  Similarity=0.296  Sum_probs=15.4

Q ss_pred             hHHHHHHHHhhCCCCEEEe
Q psy149           27 PLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL   45 (86)
                      -++++.+++.+++||++|+
T Consensus       298 ~~~~l~~~i~~~kPD~vIl  316 (608)
T PRK01021        298 RYRKLYKTILKTNPRTVIC  316 (608)
T ss_pred             HHHHHHHHHHhcCCCEEEE
Confidence            3456677888899999999


No 156
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=39.98  E-value=43  Score=23.83  Aligned_cols=34  Identities=12%  Similarity=0.293  Sum_probs=18.3

Q ss_pred             CCCCCCCCCCC-------chHHHHHHHHhhCCCCEEEeecc
Q psy149           15 GPYTQSDTLSY-------KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        15 GPfT~~d~l~y-------~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      -||....+..|       ......+++..+..+..+++.||
T Consensus        11 ~pF~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~G~   51 (269)
T TIGR03015        11 KPFQLLPDPDFFYPSKGHKRAMAYLEYGLSQREGFILITGE   51 (269)
T ss_pred             CCCCCCCCHHHhCCCHHHHHHHHHHHHHHhcCCCEEEEEcC
Confidence            47776555433       22333333333455667888887


No 157
>PRK15005 universal stress protein F; Provisional
Probab=39.77  E-value=40  Score=21.47  Aligned_cols=22  Identities=18%  Similarity=0.496  Sum_probs=18.6

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      .|-..+++++.+.++|++|+ |-
T Consensus        94 ~p~~~I~~~a~~~~~DLIV~-Gs  115 (144)
T PRK15005         94 SPKDRILELAKKIPADMIII-AS  115 (144)
T ss_pred             CHHHHHHHHHHHcCCCEEEE-eC
Confidence            58889999999999998776 63


No 158
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family. This model describes a subfamily of the B12 binding domain (pfam02607, pfam02310) proteins. Members of the seed alignment include corrinoid proteins specific to four different, mutally non-homologous enzymes of the genus Methanosarcina. Three of the four cognate enzymes (trimethylamine, dimethylamine, and monomethylamine methyltransferases) all have the unusual, ribosomally incorporated amino acid pyrrolysine at the active site. All act in systems in which a methyl group is transferred to the corrinoid protein to create methylcobalamin, from which the methyl group is later transferred elsewhere.
Probab=39.73  E-value=32  Score=24.55  Aligned_cols=20  Identities=15%  Similarity=0.353  Sum_probs=18.6

Q ss_pred             chHHHHHHHHhhCCCCEEEe
Q psy149           26 KPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .|..+|++.+.+.+||++-+
T Consensus       122 vp~e~~v~~~~~~~pd~v~l  141 (197)
T TIGR02370       122 VPIDTVVEKVKKEKPLMLTG  141 (197)
T ss_pred             CCHHHHHHHHHHcCCCEEEE
Confidence            49999999999999999887


No 159
>TIGR02298 HpaD_Fe 3,4-dihydroxyphenylacetate 2,3-dioxygenase. This enzyme catalyzes the ring-opening step in the degradation of 4-hydroxyphenylacetate.
Probab=39.69  E-value=30  Score=26.26  Aligned_cols=28  Identities=4%  Similarity=0.031  Sum_probs=20.6

Q ss_pred             CchHHHHHHHHhhCCCCEEEeeccccCC
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      ++-|.++-+++.+.+||++|++.|=--.
T Consensus        33 ~~al~~l~~~l~~~~Pd~IVViS~H~~~   60 (282)
T TIGR02298        33 IDGHKEISRRAKEMGVDTIVVFDTHWLV   60 (282)
T ss_pred             HHHHHHHHHHHHHcCCCEEEEECCCCCc
Confidence            4556666677777899999999885433


No 160
>COG2875 CobM Precorrin-4 methylase [Coenzyme metabolism]
Probab=39.59  E-value=34  Score=26.46  Aligned_cols=29  Identities=28%  Similarity=0.439  Sum_probs=24.6

Q ss_pred             chHHHHHHHHhh--CCCCEEEeeccccCCCC
Q psy149           26 KPLEDLIALTVQ--QEPDVLILIGPLLDTSH   54 (86)
Q Consensus        26 ~pL~~ll~~v~~--~~PdvlIL~GPFiD~~h   54 (86)
                      -.|.|+.+++++  ..=..+|++|++++.+.
T Consensus       205 GTL~dIa~kv~~~~i~rTAlIiVG~~l~~~~  235 (254)
T COG2875         205 GTLEDIAEKVKEAGIRRTALIIVGDVLDPEG  235 (254)
T ss_pred             eeHHHHHHHHHhcCceeEEEEEEccccCcCc
Confidence            369999999998  55569999999999765


No 161
>PF13941 MutL:  MutL protein
Probab=39.27  E-value=26  Score=28.91  Aligned_cols=24  Identities=25%  Similarity=0.480  Sum_probs=19.7

Q ss_pred             CchHHHHHHHHhhCCCCEEEeecc
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      |+.-.+=++.+.+.+||+++|.|=
T Consensus       110 ~~l~~~~l~~i~~~~PDiILLaGG  133 (457)
T PF13941_consen  110 YELTEEDLEEIREIRPDIILLAGG  133 (457)
T ss_pred             cCCCHHHHHHHhccCCCEEEEeCC
Confidence            355567788899999999999994


No 162
>KOG1432|consensus
Probab=38.99  E-value=62  Score=26.41  Aligned_cols=24  Identities=13%  Similarity=0.433  Sum_probs=20.5

Q ss_pred             HHHHHHHhh-CCCCEEEeeccccCC
Q psy149           29 EDLIALTVQ-QEPDVLILIGPLLDT   52 (86)
Q Consensus        29 ~~ll~~v~~-~~PdvlIL~GPFiD~   52 (86)
                      ..|++++.+ ++||.|++.|=-|+.
T Consensus        89 t~F~~rvL~sE~PDlVVfTGD~i~g  113 (379)
T KOG1432|consen   89 TNFVSRVLASEKPDLVVFTGDNIFG  113 (379)
T ss_pred             HHHHHHHHhccCCCEEEEeCCcccc
Confidence            468888876 999999999988877


No 163
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain. YvnB (BSU35040) is an uncharacterized Bacillus subtilis protein with a metallophosphatase domain.  This family includes bacterial and eukaryotic proteins similar to YvnB.  YvnB belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for 
Probab=38.83  E-value=47  Score=23.64  Aligned_cols=27  Identities=7%  Similarity=0.191  Sum_probs=21.0

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      ++.+++.+++.+||.+|..|=++|...
T Consensus        24 ~~~i~~~~~~~~~d~iv~~GDl~~~~~   50 (214)
T cd07399          24 TDWIVDNAEALNIAFVLHLGDIVDDGD   50 (214)
T ss_pred             HHHHHHHHHHcCCCEEEECCCccCCCC
Confidence            355666667788999999999987554


No 164
>KOG2442|consensus
Probab=38.81  E-value=28  Score=29.55  Aligned_cols=23  Identities=22%  Similarity=0.400  Sum_probs=19.6

Q ss_pred             CCcCCCceeEEEEeCCCCCCCCC
Q psy149            1 MTLTRRSLSMFVSAGPYTQSDTL   23 (86)
Q Consensus         1 ~~l~~~~l~i~vAaGPfT~~d~l   23 (86)
                      |+-||.++-+.||.||.++.+.+
T Consensus       386 ~t~~geSVMieVA~G~~s~~Eki  408 (541)
T KOG2442|consen  386 ITKNGESVMIEVARGPSSTEEKI  408 (541)
T ss_pred             hccCCceEEEEEecCCCCCCCCc
Confidence            35688999999999998888765


No 165
>PLN02533 probable purple acid phosphatase
Probab=38.59  E-value=67  Score=25.77  Aligned_cols=45  Identities=18%  Similarity=0.254  Sum_probs=30.2

Q ss_pred             HHHHHHHhhCCCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHHHHhhccc
Q psy149           29 EDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDSIVQPL   81 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~i~~~~   81 (86)
                      ...++.+++.+||.+|+.|=+++.++        .+..-|-|.+.+.++...+
T Consensus       155 ~~tl~~i~~~~pD~vl~~GDl~y~~~--------~~~~wd~f~~~i~~l~s~~  199 (427)
T PLN02533        155 KSTLEHVSKWDYDVFILPGDLSYANF--------YQPLWDTFGRLVQPLASQR  199 (427)
T ss_pred             HHHHHHHHhcCCCEEEEcCccccccc--------hHHHHHHHHHHhhhHhhcC
Confidence            46788899999999999998887643        1222234556666665443


No 166
>PF02350 Epimerase_2:  UDP-N-acetylglucosamine 2-epimerase;  InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5.1.3.14 from EC catalyses the production of UDP-ManNAc from UDP-GlcNAc. Some of the enzymes is this family are bifunctional. In microorganisms the epimerase is involved in in the synthesis of the capsule precursor UDP-ManNAcA [, ]. The protein from rat liver displays both epimerase and kinase activity [].; GO: 0008761 UDP-N-acetylglucosamine 2-epimerase activity, 0006047 UDP-N-acetylglucosamine metabolic process, 0009103 lipopolysaccharide biosynthetic process; PDB: 1V4V_B 3BEO_B 3DZC_B 3OT5_B 1O6C_B 1VGV_D 1F6D_C.
Probab=38.38  E-value=31  Score=26.65  Aligned_cols=51  Identities=16%  Similarity=0.346  Sum_probs=30.1

Q ss_pred             HHHHHHHHhhCCCCEEEeecc------------ccCCCCccccCC----CcC-CCHHHHHHHHHHHhh
Q psy149           28 LEDLIALTVQQEPDVLILIGP------------LLDTSHPLLLNG----SLA-ETFEDFYVKLIDSIV   78 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GP------------FiD~~h~~i~~g----~~~-~t~eelF~~~i~~i~   78 (86)
                      +..|-+.+.+.+||+||+.|=            +...---.|..|    +.. -..||..|..|+++.
T Consensus        56 ~~~~~~~~~~~~Pd~Vlv~GD~~~~la~alaA~~~~ipv~HieaGlRs~d~~~g~~de~~R~~i~~la  123 (346)
T PF02350_consen   56 IIELADVLEREKPDAVLVLGDRNEALAAALAAFYLNIPVAHIEAGLRSGDRTEGMPDEINRHAIDKLA  123 (346)
T ss_dssp             HHHHHHHHHHHT-SEEEEETTSHHHHHHHHHHHHTT-EEEEES-----S-TTSSTTHHHHHHHHHHH-
T ss_pred             HHHHHHHHHhcCCCEEEEEcCCchHHHHHHHHHHhCCCEEEecCCCCccccCCCCchhhhhhhhhhhh
Confidence            345556677799999999982            111111234556    665 478999999888764


No 167
>PF03464 eRF1_2:  eRF1 domain 2;  InterPro: IPR005141  This domain is found in the release factor eRF1 which terminates protein biosynthesis by recognizing stop codons at the A site of the ribosome and stimulating peptidyl-tRNA bond hydrolysis at the peptidyl transferase centre. The crystal structure of human eRF1 is known []. The overall shape and dimensions of eRF1 resemble a tRNA molecule with domains 1, 2, and 3 of eRF1 corresponding to the anticodon loop, aminoacyl acceptor stem, and T stem of a tRNA molecule, respectively. The position of the essential GGQ motif at an exposed tip of domain 2 suggests that the Gln residue coordinates a water molecule to mediate the hydrolytic activity at the peptidyl transferase centre. A conserved groove on domain 1, 80 A from the GGQ motif, is proposed to form the codon recognition site []. This domain is also found in other proteins which may also be involved in translation termination ; PDB: 3AGK_A 2VGN_A 2VGM_A 3J16_A 3IZQ 3IR9_A 3OBW_A 3MCA_B 2QI2_A 3E1Y_D ....
Probab=38.22  E-value=35  Score=22.73  Aligned_cols=14  Identities=21%  Similarity=0.385  Sum_probs=11.3

Q ss_pred             hhCCCCEEEeeccc
Q psy149           36 VQQEPDVLILIGPL   49 (86)
Q Consensus        36 ~~~~PdvlIL~GPF   49 (86)
                      +..+.+.+|+.||-
T Consensus        70 ~~~~~~~iIiaGPG   83 (133)
T PF03464_consen   70 NFDDVKCIIIAGPG   83 (133)
T ss_dssp             HTTTCSEEEEEEST
T ss_pred             ccccccEEEEECCH
Confidence            34589999999993


No 168
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism]
Probab=38.19  E-value=41  Score=27.44  Aligned_cols=43  Identities=21%  Similarity=0.546  Sum_probs=36.6

Q ss_pred             eCCCCCCCCCCCchHHHHHHHHhhCCCCEEEee----ccccCCCCcc
Q psy149           14 AGPYTQSDTLSYKPLEDLIALTVQQEPDVLILI----GPLLDTSHPL   56 (86)
Q Consensus        14 aGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~----GPFiD~~h~~   56 (86)
                      |==|....+|.-+-..+.++.|++..|++++.+    |-||...-|.
T Consensus       174 S~GY~~RpS~~I~eI~~~i~~vk~inpn~ivFVDNCYGEFvE~~EPt  220 (416)
T COG4100         174 SKGYAWRPSLSIAEIEEMITFVKEINPNVIVFVDNCYGEFVEEKEPT  220 (416)
T ss_pred             ccCcCCCCcccHHHHHHHHHHHHhcCCCEEEEEeccchhhhhccCcc
Confidence            334888889999999999999999999999975    8888877653


No 169
>cd01145 TroA_c Periplasmic binding protein TroA_c.  These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=37.85  E-value=69  Score=22.63  Aligned_cols=52  Identities=23%  Similarity=0.293  Sum_probs=37.2

Q ss_pred             CchHHHHHHHHhhCCCCEEEeeccccCCCC--------ccccCCCc----CCCHHHHHHHHHHH
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGPLLDTSH--------PLLLNGSL----AETFEDFYVKLIDS   76 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h--------~~i~~g~~----~~t~eelF~~~i~~   76 (86)
                      +.||.++++.|...+.+|-.|+.|=.|..+        ..+++.++    ...||....+++..
T Consensus         9 ~~pl~~iv~~I~gd~~~V~~l~p~g~dpH~ye~tp~d~~~l~~Adliv~~G~~~E~~~~k~~~~   72 (203)
T cd01145           9 FPDLKDLVREVAGDAVIVSALTPPGVDPHQYQLKPSDIAKMRKADLVVTSGHELEGFEPKLAEL   72 (203)
T ss_pred             ChHHHHHHHHHcCCcEEEEEecCCCCCcccccCCHHHHHHHhcCCEEEEcCCCHHHHHHHHHHh
Confidence            468999999999999999999999888666        12444443    45677655555554


No 170
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional
Probab=37.85  E-value=28  Score=25.05  Aligned_cols=30  Identities=27%  Similarity=0.354  Sum_probs=25.0

Q ss_pred             CCCchHHHHHHHHh-hCCCCEEEeeccccCC
Q psy149           23 LSYKPLEDLIALTV-QQEPDVLILIGPLLDT   52 (86)
Q Consensus        23 l~y~pL~~ll~~v~-~~~PdvlIL~GPFiD~   52 (86)
                      =+|+.|..+++.+. ..+.|.+|.+|=+||.
T Consensus        25 g~~~~l~~~l~~~~~~~~~d~l~~lGD~vdr   55 (218)
T PRK09968         25 GEYQLLQSRLHQLSFCPETDLLISVGDNIDR   55 (218)
T ss_pred             CCHHHHHHHHHhcCCCCCCCEEEECCCCcCC
Confidence            35788999998886 4578999999999994


No 171
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase. This domain binds methylcobalamin, which it uses as an intermediate methyl carrier from methyltetrahydrofolate (CH3H4folate) to homocysteine (Hcy).
Probab=37.61  E-value=36  Score=24.82  Aligned_cols=21  Identities=19%  Similarity=0.483  Sum_probs=19.2

Q ss_pred             CchHHHHHHHHhhCCCCEEEe
Q psy149           25 YKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      --|..+|++.+.+.+||+|-|
T Consensus       125 ~vp~e~~v~~~~~~~~~~V~l  145 (213)
T cd02069         125 MVPIEKILEAAKEHKADIIGL  145 (213)
T ss_pred             CCCHHHHHHHHHHcCCCEEEE
Confidence            359999999999999999988


No 172
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=37.54  E-value=61  Score=23.57  Aligned_cols=32  Identities=22%  Similarity=0.290  Sum_probs=22.2

Q ss_pred             EeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           13 SAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        13 AaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +.-.|... .-+   +...++++++.+||++++.+-
T Consensus       170 ~~~~~~~~-~~d---~~~~v~~l~~~~pd~v~~~~~  201 (312)
T cd06346         170 NVVAHEEG-KSS---YSSEVAAAAAGGPDALVVIGY  201 (312)
T ss_pred             EEEeeCCC-CCC---HHHHHHHHHhcCCCEEEEecc
Confidence            44455443 333   457889999999999998764


No 173
>PF07355 GRDB:  Glycine/sarcosine/betaine reductase selenoprotein B (GRDB);  InterPro: IPR022787  This entry represents selenoprotein B of glycine reductase, sarcosine reductase, betaine reductase, D-proline reductase, and perhaps others. All members are expected to contain an internal UGA codon, encoding selenocysteine, which may be misinterpreted as a stop codon. ; GO: 0030699 glycine reductase activity, 0050485 oxidoreductase activity, acting on X-H and Y-H to form an X-Y bond, with a disulfide as acceptor, 0055114 oxidation-reduction process, 0030700 glycine reductase complex
Probab=37.48  E-value=41  Score=27.03  Aligned_cols=46  Identities=17%  Similarity=0.419  Sum_probs=34.2

Q ss_pred             ceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149            7 SLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus         7 ~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      .+.-.|-||.=....|.+ +-+..+++.+++.+||++| +||=+++-.
T Consensus        49 eIv~TiiCGDnyf~en~e-ea~~~i~~mv~~~~pD~vi-aGPaFnagr   94 (349)
T PF07355_consen   49 EIVATIICGDNYFNENKE-EALKKILEMVKKLKPDVVI-AGPAFNAGR   94 (349)
T ss_pred             EEEEEEEECcchhhhCHH-HHHHHHHHHHHhcCCCEEE-EcCCcCCch
Confidence            344466788755555543 4778889999999999875 899988765


No 174
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane]
Probab=37.35  E-value=34  Score=27.78  Aligned_cols=18  Identities=44%  Similarity=0.818  Sum_probs=15.4

Q ss_pred             HHHHHHHhhCCCCEEEee
Q psy149           29 EDLIALTVQQEPDVLILI   46 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~   46 (86)
                      .++++++.++|||++|++
T Consensus        75 ~~~~~~i~~~kpD~~i~I   92 (381)
T COG0763          75 RELVRYILANKPDVLILI   92 (381)
T ss_pred             HHHHHHHHhcCCCEEEEe
Confidence            567888889999999984


No 175
>PRK02261 methylaspartate mutase subunit S; Provisional
Probab=37.26  E-value=39  Score=22.96  Aligned_cols=20  Identities=15%  Similarity=0.506  Sum_probs=17.6

Q ss_pred             chHHHHHHHHhhCCCCEEEe
Q psy149           26 KPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .|..++++.+.+.+||+|-+
T Consensus        41 vp~e~i~~~a~~~~~d~V~l   60 (137)
T PRK02261         41 TSQEEFIDAAIETDADAILV   60 (137)
T ss_pred             CCHHHHHHHHHHcCCCEEEE
Confidence            48899999999999998877


No 176
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism]
Probab=37.16  E-value=66  Score=24.50  Aligned_cols=41  Identities=24%  Similarity=0.224  Sum_probs=26.0

Q ss_pred             CceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccC
Q psy149            6 RSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus         6 ~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      ..++ ++..-+|.+.+.-    +..++.++++.+||++++.|..-|
T Consensus       175 ~G~~-~~~~~~~~~~~~~----~~~~v~~i~~~~~d~v~~~~~~~~  215 (366)
T COG0683         175 LGGE-VVVEEVYAPGDTD----FSALVAKIKAAGPDAVLVGGYGPD  215 (366)
T ss_pred             CCCe-EEEEEeeCCCCCC----hHHHHHHHHhcCCCEEEECCCCcc
Confidence            3455 4444555554322    888999999999995555444433


No 177
>cd07371 2A5CPDO_AB The alpha and beta subunits of the Class III extradiol dioxygenase, 2-amino-5-chlorophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol. This subfamily contains both alpha and beta subunits of 2-amino-5-chlorophenol 1,6-dioxygenase (2A5CPDO), which catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol, an intermediate during p-chloronitrobenzene degradation. 2A5CPDO is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. The active enzyme is probably a heterotetramer, composed of two alpha and two beta subunits. Alpha and beta subunits share significant sequence similarity and may have evolved by gene duplication.
Probab=37.16  E-value=43  Score=25.03  Aligned_cols=23  Identities=22%  Similarity=0.231  Sum_probs=17.4

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +-|.++-+++.+.+||++|++.|
T Consensus        26 ~al~~l~~~l~~~~Pd~IvviS~   48 (268)
T cd07371          26 WAYERAGASLAASRPDVVLVYST   48 (268)
T ss_pred             HHHHHHHHHHHHcCCCEEEEECC
Confidence            45555566666679999999999


No 178
>PRK15456 universal stress protein UspG; Provisional
Probab=37.01  E-value=45  Score=21.47  Aligned_cols=22  Identities=18%  Similarity=0.389  Sum_probs=18.8

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +|-.++++++.+.++|++|+ |-
T Consensus        92 ~~~~~I~~~a~~~~~DLIVm-G~  113 (142)
T PRK15456         92 SVRDEVNELAEELGADVVVI-GS  113 (142)
T ss_pred             ChHHHHHHHHhhcCCCEEEE-cC
Confidence            58889999999999999887 54


No 179
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain. PA3087 is an uncharacterized protein from Pseudomonas aeruginosa with a metallophosphatase domain that belongs to the phosphoprotein phosphatase (PPP) family.  The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes.  Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes.  PPPs belong to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of 
Probab=36.89  E-value=31  Score=24.89  Aligned_cols=30  Identities=20%  Similarity=0.248  Sum_probs=22.6

Q ss_pred             CCchHHHHHHHHhhC--------CCCEEEeeccccCCC
Q psy149           24 SYKPLEDLIALTVQQ--------EPDVLILIGPLLDTS   53 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~--------~PdvlIL~GPFiD~~   53 (86)
                      .|+.|..+++++...        +.|.+|++|=+||.-
T Consensus        10 ~~~~L~~lL~~i~~~~~~~~~~~~~d~lvflGD~IDRG   47 (222)
T cd07413          10 HAEKLVVLLHKLGYQELSGVYRHPERQVVFLGDLIDRG   47 (222)
T ss_pred             CHHHHHHHHHHcCCCccccccCCCCCEEEEeCcccCCC
Confidence            357788888887543        467999999998864


No 180
>TIGR03011 sulf_tusB_dsrH sulfur relay protein TusB/DsrH. The three proteins TusB, TusC, and TusD form a heterohexamer responsible for a sulfur relay reaction. In large numbers of proteobacterial species, this complex acts on a Cys-derived persulfide moiety, delivered by the cysteine desulfurase IscS to TusA, then to TusBCD. The activated sulfur group is then transferred to TusE (DsrC), then by MnmA (TrmU) for modification of an anticodon nucleotide in tRNAs for Glu, Lys, and Gln. The sulfur relay complex TusBCD is also found, under the designation DsrEFH, in phototrophic and chemotrophic sulfur bacteria, such as Chromatium vinosum. In these organisms, it seems the primary purpose is related to sulfur flux, such as oxidation from sulfide to molecular sulfur to sulfate.
Probab=36.60  E-value=39  Score=20.96  Aligned_cols=29  Identities=24%  Similarity=0.389  Sum_probs=20.2

Q ss_pred             EEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           11 FVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        11 ~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      ++...||.++      -+.+.++.+...  |.|+|+|
T Consensus         2 i~~~sP~~~~------~~~~~l~~~~~~--d~vll~~   30 (94)
T TIGR03011         2 TVKKSPFEDN------DLELCLRLLGPG--DAILLLQ   30 (94)
T ss_pred             cccCCCCccc------hHHHHHHhcCCC--CeEEEeh
Confidence            3557889766      588888887653  3677774


No 181
>PF10035 DUF2179:  Uncharacterized protein conserved in bacteria (DUF2179);  InterPro: IPR019264  This entry, found mostly in hypothetical bacterial proteins, has no known function. ; PDB: 3HLU_B.
Probab=36.59  E-value=70  Score=17.98  Aligned_cols=41  Identities=17%  Similarity=0.410  Sum_probs=25.7

Q ss_pred             eeEEEEeCCCCCCC------CCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149            8 LSMFVSAGPYTQSD------TLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus         8 l~i~vAaGPfT~~d------~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      .+++=|.|=|+..+      -++..-+..+.+.+++..|++.|-+-.
T Consensus         3 vT~~~~~G~ys~~~~~~l~~v~~r~e~~~l~~~I~~~Dp~AFi~v~~   49 (55)
T PF10035_consen    3 VTILEGEGGYSGEEKTVLYTVVSRRELPKLKKIIKEIDPKAFISVSD   49 (55)
T ss_dssp             -EEEE-EESSSSS--EEEEEEEECCHHHHHHHHHHCC-TT-EEEE--
T ss_pred             EeEEEEEEeecCCCeEEEEEEEeHHHHHHHHHHHHHhCCCEEEEEEc
Confidence            44555666665444      256678999999999999999987643


No 182
>TIGR00040 yfcE phosphoesterase, MJ0936 family. Members of this largely uncharacterized family share a motif approximating DXH(X25)GDXXD(X25)GNHD as found in several phosphoesterases, including the nucleases SbcD and Mre11, and a family of uncharacterized archaeal putative phosphoesterases described by TIGR00024. In this family, the His residue in GNHD portion of the motif is not conserved. The member MJ0936, one of two from Methanococcus jannaschii, was shown (PubMed:15128743) to act on model phosphodiesterase substrates; a divalent cation was required.
Probab=36.59  E-value=44  Score=22.24  Aligned_cols=27  Identities=22%  Similarity=0.242  Sum_probs=21.2

Q ss_pred             CCchHHHHHHHHhhC-CCCEEEeecccc
Q psy149           24 SYKPLEDLIALTVQQ-EPDVLILIGPLL   50 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~-~PdvlIL~GPFi   50 (86)
                      ++..+..+++.++.. +||.+|.+|=++
T Consensus        12 ~~~~~~~~~~~~~~~~~~d~ii~~GD~~   39 (158)
T TIGR00040        12 PLRATELPVELFNLESNVDLVIHAGDLT   39 (158)
T ss_pred             CcchhHhHHHHHhhccCCCEEEEcCCCC
Confidence            345667777777776 899999999876


No 183
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain. CpdB is a bacterial periplasmic protein with an N-terminal metallophosphatase domain and a C-terminal 3'-nucleotidase domain.  This alignment model represents the N-terminal metallophosphatase domain, which has 2',3'-cyclic phosphodiesterase activity, hydrolyzing the 2',3'-cyclic phosphates of adenosine, guanosine, cytosine and uridine to yield nucleoside and phosphate.  CpdB also hydrolyzes the chromogenic substrates p-nitrophenyl phosphate (PNPP), bis(PNPP) and p-nitrophenyl phosphorylcholine (NPPC).  CpdB is thought to play a scavenging role during RNA hydrolysis by converting the non-transportable nucleotides produced by RNaseI to nucleosides which can easily enter a cell for use as a carbon source.  This family also includes YfkN, a Bacillus subtilis nucleotide phosphoesterase with two copies of each of the metallophosphatase and 3'-nucleotidase domains.  The N-terminal metallophos
Probab=36.57  E-value=62  Score=23.67  Aligned_cols=43  Identities=9%  Similarity=0.179  Sum_probs=24.7

Q ss_pred             CCceeEEEEeCCCCCCC-------CCCCch----HHHHHHHHhhCCCCEEEeec
Q psy149            5 RRSLSMFVSAGPYTQSD-------TLSYKP----LEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~d-------~l~y~p----L~~ll~~v~~~~PdvlIL~G   47 (86)
                      |..+-|+=.+.|++..-       .+.|..    +...++.+++.++|++|++.
T Consensus       138 g~kVgviG~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~v~~lr~~~~D~IIvl~  191 (277)
T cd07410         138 GVKVGIIGLTTPQIPNWEKPNLIGGLKFTDPVETAKKYVPKLRAEGADVVVVLA  191 (277)
T ss_pred             CCEEEEEecCCcccccccCcccCCCcEEcCHHHHHHHHHHHHHHcCCCEEEEEe
Confidence            33444444456665431       333433    44556667767899999973


No 184
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism]
Probab=36.52  E-value=38  Score=25.28  Aligned_cols=19  Identities=26%  Similarity=0.524  Sum_probs=17.0

Q ss_pred             HHHHHHHhhCCCCEEEeec
Q psy149           29 EDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~G   47 (86)
                      .++++.+.+.+||+++|-|
T Consensus        69 ~~l~~~l~~~~~dlvvLAG   87 (200)
T COG0299          69 RALVEALDEYGPDLVVLAG   87 (200)
T ss_pred             HHHHHHHHhcCCCEEEEcc
Confidence            5788999999999999976


No 185
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E. Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E. This group contains proteins similar to the aspartyl dipeptidases Salmonella typhimurium peptidase E and Xenopus laevis peptidase E. In bacteria peptidase E is believed to play a role in degrading peptides generated by intracellular protein breakdown or imported into the cell as nutrient sources. Peptidase E uniquely hydrolyses only Asp-X dipeptides (where X is any amino acid), and one tripeptide Asp-Gly-Gly.  Peptidase E is believed to be a serine peptidase having a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad typical of GATase1 domains by having a Ser in place of the reactive Cys at the nucleophile elbow. Xenopus PepE  is developmentally regulated in response to thyroid hormone and, it is thought to play a role in apoptosis during tail reabsorption.
Probab=36.47  E-value=64  Score=23.04  Aligned_cols=37  Identities=16%  Similarity=0.308  Sum_probs=28.4

Q ss_pred             eEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEe
Q psy149            9 SMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus         9 ~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      ++++.+|.....++.+.+.|.+++....+.++.++++
T Consensus         1 ~l~~igg~~~~~~~~~~~~l~~~l~~~~~~~~~i~~I   37 (212)
T cd03146           1 KLLLTSGGGLGYLAHALPAIDDLLLSLTKARPKVLFV   37 (212)
T ss_pred             CEEEEeCCcccccccchHHHHHHHHHhccCCCeEEEE
Confidence            4677788877655667789999988887777888776


No 186
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain. PrpE (protein phosphatase E) is a bacterial member of the PPP (phosphoprotein phosphatase) family of serine/threonine phosphatases and a key signal transduction pathway component controlling the expression of spore germination receptors GerA and GerK in Bacillus subtilis. PrpE is closely related to ApaH (also known symmetrical Ap(4)A hydrolase and bis(5'nucleosyl)-tetraphosphatase).  PrpE has specificity for phosphotyrosine only, unlike the serine/threonine phosphatases to which it is related. The Bacilli members of this family are single domain proteins while the other members have N- and C-terminal domains in addition to this phosphatase domain.  The PPP (phosphoprotein phosphatase) family, to which PrpE belongs, is one of two known protein phosphatase families specific for serine and threonine.  The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpA/Prp
Probab=36.43  E-value=34  Score=24.64  Aligned_cols=29  Identities=28%  Similarity=0.453  Sum_probs=23.2

Q ss_pred             CCchHHHHHHHHhh----------CCCCEEEeeccccCC
Q psy149           24 SYKPLEDLIALTVQ----------QEPDVLILIGPLLDT   52 (86)
Q Consensus        24 ~y~pL~~ll~~v~~----------~~PdvlIL~GPFiD~   52 (86)
                      +|+.|..+++++.-          .+.|.+|++|=+||.
T Consensus        12 ~~~~L~~ll~~~~~~~~~~~~~~~~~~d~lv~lGDlIDr   50 (234)
T cd07423          12 CYDELEELLEKLGYRIKRVGTVTHPEGRRAVFVGDLVDR   50 (234)
T ss_pred             CHHHHHHHHHHcCCccccCccccCCCCCEEEEECCccCC
Confidence            57899999999832          146899999999994


No 187
>cd00293 USP_Like Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.
Probab=36.18  E-value=50  Score=19.64  Aligned_cols=19  Identities=16%  Similarity=0.485  Sum_probs=15.7

Q ss_pred             hHHHHHHHHhhCCCCEEEe
Q psy149           27 PLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL   45 (86)
                      +..++.+.+++.++|+||+
T Consensus        81 ~~~~i~~~~~~~~~dlvvi   99 (130)
T cd00293          81 PAEAILEAAEELGADLIVM   99 (130)
T ss_pred             CHHHHHHHHHHcCCCEEEE
Confidence            4688888888888988876


No 188
>PF04016 DUF364:  Domain of unknown function (DUF364);  InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function.; PDB: 3L5O_B 3NPG_A.
Probab=36.10  E-value=40  Score=23.16  Aligned_cols=27  Identities=30%  Similarity=0.501  Sum_probs=20.5

Q ss_pred             CCCCchHHHHHHHHhhCCCCEEEeecccc
Q psy149           22 TLSYKPLEDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        22 ~l~y~pL~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      .+--.-+.++|++++  +...+||+||=.
T Consensus        72 TlvN~Ti~~iL~~~~--~~~~vil~GpS~   98 (147)
T PF04016_consen   72 TLVNGTIDDILELAR--NAREVILYGPSA   98 (147)
T ss_dssp             HCCTTTHHHHHHHTT--TSSEEEEESCCG
T ss_pred             eeecCCHHHHHHhCc--cCCeEEEEecCc
Confidence            344466889999988  467889999966


No 189
>PF01470 Peptidase_C15:  Pyroglutamyl peptidase This is family C15 in the peptidase classification. ;  InterPro: IPR000816 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to MEROPS peptidase family C15 (pyroglutamyl peptidase I, clan CF). The type example being pyroglutamyl peptidase I of Bacillus amyloliquefaciens.  Pyroglutamyl/pyrrolidone carboxyl peptidase (Pcp or PYRase) is an exopeptidase that hydrolytically removes the pGlu from pGlu-peptides or pGlu-proteins [, ]. PYRase has been found in prokaryotes and eukaryotes where at least two different classes have been characterised: the first containing bacterial and animal type I PYRases, and the second containing animal type II and serum PYRases. Type I and bacterial PYRases are soluble enzymes, while type II PYRases are membrane-bound. The primary application of PYRase has been its utilisation for protein or peptide sequencing, and bacterial diagnosis []. The conserved residues Cys-144 and His-168 have been identified by inhibition and mutagenesis studies [, ].; GO: 0006508 proteolysis; PDB: 1A2Z_A 1IU8_A 3RNZ_A 3RO0_D 1AUG_D 2EBJ_A 3LAC_A 1X12_B 1Z8X_B 1X10_C ....
Probab=35.92  E-value=27  Score=25.24  Aligned_cols=27  Identities=22%  Similarity=0.352  Sum_probs=16.4

Q ss_pred             CCchHHHHHHH-HhhCCCCEEEeecccc
Q psy149           24 SYKPLEDLIAL-TVQQEPDVLILIGPLL   50 (86)
Q Consensus        24 ~y~pL~~ll~~-v~~~~PdvlIL~GPFi   50 (86)
                      +|+-..+.+.. +.+.+||++|.+|=-=
T Consensus        44 ~~~~~~~~l~~~l~~~~PdlVIhlGva~   71 (202)
T PF01470_consen   44 SYEKAFEALEELLEEHQPDLVIHLGVAG   71 (202)
T ss_dssp             SHHHHHHHHHHHHHHH--SEEEEEEE-T
T ss_pred             chHhHHHHHHHHHHhcCCcEEEEEeecC
Confidence            35566666654 5557999999999543


No 190
>PRK13196 pyrrolidone-carboxylate peptidase; Provisional
Probab=35.92  E-value=42  Score=24.61  Aligned_cols=26  Identities=12%  Similarity=0.241  Sum_probs=19.0

Q ss_pred             CCchHHHHHHHHh-hCCCCEEEeeccc
Q psy149           24 SYKPLEDLIALTV-QQEPDVLILIGPL   49 (86)
Q Consensus        24 ~y~pL~~ll~~v~-~~~PdvlIL~GPF   49 (86)
                      +|+...+.+..+. +.+||++|.+|=.
T Consensus        45 ~~~~~~~~l~~~~~~~~Pd~vi~~G~a   71 (211)
T PRK13196         45 EPRAAMAALSRLLDELQPSAVLLTGLA   71 (211)
T ss_pred             ChhHHHHHHHHHHHHhCCCEEEEeccc
Confidence            4666666665555 5799999999963


No 191
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed
Probab=35.85  E-value=39  Score=27.74  Aligned_cols=39  Identities=18%  Similarity=0.356  Sum_probs=23.8

Q ss_pred             eEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCCccccC
Q psy149            9 SMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLN   59 (86)
Q Consensus         9 ~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~   59 (86)
                      .++||+||.|+.      .|.+-+....-.+      .+=|-|+.-|.|..
T Consensus       129 ~viiatG~~~s~------~l~~~l~~~~g~~------~~~f~~~~~p~v~~  167 (436)
T PRK05335        129 ITIIATGPLTSD------ALAEAIKALTGED------YLYFFDAAAPIVDK  167 (436)
T ss_pred             CEEEeCCCCchH------HHHHHHHHhcCCc------cceecCCCCceecC
Confidence            689999998765      6666666552111      23455555555543


No 192
>PF00072 Response_reg:  Response regulator receiver domain;  InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. Bipartite response regulator proteins are involved in a two-component signal transduction system in bacteria, and certain eukaryotes like protozoa, that functions to detect and respond to environmental changes []. These systems have been detected during host invasion, drug resistance, motility, phosphate uptake, osmoregulation, and nitrogen fixation, amongst others []. The two-component system consists of a histidine protein kinase environmental sensor that phosphorylates the receiver domain of a response regulator protein; phosphorylation induces a conformational change in the response regulator, which activates the effector domain, triggering the cellular response []. The domains of the two-component proteins are highly modular, but the core structures and activities are maintained. The response regulators act as phosphorylation-activated switches to affect a cellular response, usually by transcriptional regulation. Most of these proteins consist of two domains, an N-terminal response regulator receiver domain, and a variable C-terminal effector domain with DNA-binding activity. This entry represents the response regulator receiver domain, which belongs to the CheY family, and receives the signal from the sensor partner in the two-component system.; GO: 0000156 two-component response regulator activity, 0000160 two-component signal transduction system (phosphorelay), 0006355 regulation of transcription, DNA-dependent; PDB: 2QR3_A 2QXY_A 1I3C_A 1JLK_A 2PKX_A 2PL1_A 3H1F_A 3H1E_A 3GWG_A 3H1G_A ....
Probab=35.82  E-value=40  Score=20.10  Aligned_cols=19  Identities=26%  Similarity=0.541  Sum_probs=16.1

Q ss_pred             hHHHHHHHHhhCCCCEEEe
Q psy149           27 PLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL   45 (86)
                      -..++++.+.+.+||++|+
T Consensus        31 ~~~~~~~~~~~~~~d~iii   49 (112)
T PF00072_consen   31 SGEEALELLKKHPPDLIII   49 (112)
T ss_dssp             SHHHHHHHHHHSTESEEEE
T ss_pred             CHHHHHHHhcccCceEEEE
Confidence            3578889999999999987


No 193
>PRK13194 pyrrolidone-carboxylate peptidase; Provisional
Probab=35.74  E-value=39  Score=24.84  Aligned_cols=27  Identities=22%  Similarity=0.375  Sum_probs=20.3

Q ss_pred             CCCchHHHHHHHH-hhCCCCEEEeeccc
Q psy149           23 LSYKPLEDLIALT-VQQEPDVLILIGPL   49 (86)
Q Consensus        23 l~y~pL~~ll~~v-~~~~PdvlIL~GPF   49 (86)
                      .+|+...+.+..+ .+.+||++|.+|=.
T Consensus        43 V~~~~~~~~l~~~l~~~~Pd~vlhlG~a   70 (208)
T PRK13194         43 VSFKRAREELEKVLDEIKPDITINLGLA   70 (208)
T ss_pred             CchHhHHHHHHHHHHHhCCCEEEEeecc
Confidence            3577777777665 45699999999954


No 194
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional
Probab=35.58  E-value=41  Score=24.66  Aligned_cols=48  Identities=13%  Similarity=0.221  Sum_probs=30.8

Q ss_pred             CCceeEEEEeCCCCCCC-C------CCCchHHHHHHHHhhC--CCCEEEeeccccCC
Q psy149            5 RRSLSMFVSAGPYTQSD-T------LSYKPLEDLIALTVQQ--EPDVLILIGPLLDT   52 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~d-~------l~y~pL~~ll~~v~~~--~PdvlIL~GPFiD~   52 (86)
                      .++++++..|=.--..+ +      -.++-|...++.+++.  +||.||+.|=++|.
T Consensus        12 ~~~~~i~~iSD~Hl~~~~~~~~~~~~~~~~l~~~i~~i~~~~~~~D~vvitGDl~~~   68 (275)
T PRK11148         12 EARVRILQITDTHLFADEHETLLGVNTWESYQAVLEAIRAQQHEFDLIVATGDLAQD   68 (275)
T ss_pred             CCCEEEEEEcCcccCCCCCCceeccCHHHHHHHHHHHHHhhCCCCCEEEECCCCCCC
Confidence            35667766654442111 1      1234577778888764  69999999998874


No 195
>KOG1342|consensus
Probab=35.44  E-value=27  Score=28.79  Aligned_cols=26  Identities=19%  Similarity=0.505  Sum_probs=22.1

Q ss_pred             ccCCCcCCCHHHHHHHHHHHhhcccc
Q psy149           57 LLNGSLAETFEDFYVKLIDSIVQPLE   82 (86)
Q Consensus        57 i~~g~~~~t~eelF~~~i~~i~~~~~   82 (86)
                      +++|--+++|+.+|+.+|.++++..+
T Consensus       227 L~dGidD~sy~~if~pIi~~v~e~f~  252 (425)
T KOG1342|consen  227 LKDGIDDESYESIFKPIISKVMERFQ  252 (425)
T ss_pred             hhccCCcHHHHHHHHHHHHHHHHHhC
Confidence            45666699999999999999998765


No 196
>PF04392 ABC_sub_bind:  ABC transporter substrate binding protein;  InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. This family contains many hypothetical proteins and some ABC transporter substrate binding proteins.; PDB: 3LFT_A 3LKV_A.
Probab=35.36  E-value=29  Score=25.58  Aligned_cols=24  Identities=29%  Similarity=0.468  Sum_probs=19.9

Q ss_pred             CCchHHHHHHHHhhCCCCEEEeec
Q psy149           24 SYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      +.+-+..+++++.+.+||++|.+|
T Consensus        44 d~~~~~~~~~~l~~~~~DlIi~~g   67 (294)
T PF04392_consen   44 DPEKLRQIARKLKAQKPDLIIAIG   67 (294)
T ss_dssp             -HHHHHHHHHHHCCTS-SEEEEES
T ss_pred             CHHHHHHHHHHHhcCCCCEEEEeC
Confidence            567889999999999999999998


No 197
>PF07297 DPM2:  Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2);  InterPro: IPR009914 This family consists of several eukaryotic dolichol phosphate-mannose biosynthesis regulatory (DPM2) proteins. Biosynthesis of glycosylphosphatidylinositol and N-glycan precursor is dependent upon a mannosyl donor, dolichol phosphate-mannose (DPM). DPM2, an 84 amino acid membrane protein expressed in the endoplasmic reticulum (ER), makes a complex with DPM1 that is essential for the ER localisation and stable expression of DPM1. Moreover, DPM2 enhances binding of dolichol phosphate, a substrate of DPM synthase. Biosynthesis of DPM in mammalian cells is regulated by DPM2 [].; GO: 0009059 macromolecule biosynthetic process, 0030176 integral to endoplasmic reticulum membrane
Probab=35.33  E-value=16  Score=23.37  Aligned_cols=13  Identities=38%  Similarity=0.856  Sum_probs=9.9

Q ss_pred             eeccccCCCCccc
Q psy149           45 LIGPLLDTSHPLL   57 (86)
Q Consensus        45 L~GPFiD~~h~~i   57 (86)
                      ++=||+|.+|+.-
T Consensus        26 lllPFvd~d~~i~   38 (78)
T PF07297_consen   26 LLLPFVDEDHPIH   38 (78)
T ss_pred             HHhcccCCCchHH
Confidence            3459999999753


No 198
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. This model represents LpxH, UDP-2,3-diacylglucosamine hydrolase, and essential enzyme in E. coli that catalyzes the fourth step in lipid A biosynthesis. Note that Pseudomonas aeruginosa has both a member of this family that shares this function and a more distant homolog, designated LpxH2, that does not. Many species that produce lipid A lack an lpxH gene in this family; some of those species have an lpxH2 gene instead, although for which the function is unknown.
Probab=35.21  E-value=41  Score=24.14  Aligned_cols=25  Identities=16%  Similarity=0.421  Sum_probs=19.5

Q ss_pred             HHHHHHHHhh--CCCCEEEeeccccCC
Q psy149           28 LEDLIALTVQ--QEPDVLILIGPLLDT   52 (86)
Q Consensus        28 L~~ll~~v~~--~~PdvlIL~GPFiD~   52 (86)
                      ...+++.+++  .+||+||++|=++|.
T Consensus        17 ~~~~l~~l~~~~~~~d~lii~GDi~d~   43 (231)
T TIGR01854        17 TALFLDFLREEARKADALYILGDLFEA   43 (231)
T ss_pred             HHHHHHHHHhhhccCCEEEEcCceecc
Confidence            3456666665  389999999999985


No 199
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain. CG11883 is an uncharacterized Drosophila melanogaster UshA-like protein with two domains, an N-terminal metallophosphatase domain and  a C-terminal nucleotidase domain.  The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at th
Probab=35.04  E-value=59  Score=23.78  Aligned_cols=34  Identities=15%  Similarity=0.252  Sum_probs=27.7

Q ss_pred             CCCCCCchHHHHHHHHhhCCCC-EEEeeccccCCC
Q psy149           20 SDTLSYKPLEDLIALTVQQEPD-VLILIGPLLDTS   53 (86)
Q Consensus        20 ~d~l~y~pL~~ll~~v~~~~Pd-vlIL~GPFiD~~   53 (86)
                      .+.-.+..+..+++.++++.|| +++..|=+++.+
T Consensus        18 ~~~gG~~rl~~~i~~~r~~~~~~l~l~~GD~~~g~   52 (257)
T cd07406          18 GPVGGAARFATLRKQLRKENPNTLVLFSGDVLSPS   52 (257)
T ss_pred             CCcCCHHHHHHHHHHHHhcCCCEEEEECCCccCCc
Confidence            3345789999999999998899 788888888764


No 200
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins. A family of small methanogenic corrinoid proteins that bind methyl-Co(III) 5-hydroxybenzimidazolylcobamide as a cofactor. They play a role on the methanogenesis from trimethylamine, dimethylamine or monomethylamine, which is initiated by a series of corrinoid-dependent methyltransferases.
Probab=35.01  E-value=43  Score=23.76  Aligned_cols=21  Identities=29%  Similarity=0.513  Sum_probs=18.9

Q ss_pred             CchHHHHHHHHhhCCCCEEEe
Q psy149           25 YKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      -.|..+|++.+.+.+||++-|
T Consensus       119 ~~p~~~l~~~~~~~~~d~v~l  139 (201)
T cd02070         119 DVPPEEFVEAVKEHKPDILGL  139 (201)
T ss_pred             CCCHHHHHHHHHHcCCCEEEE
Confidence            359999999999999999887


No 201
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA). Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA). GABA is the major inhibitory neurotransmitter in the mammalian CNS and, like glutamate and other transmitters, acts via both ligand gated ion channels (GABAa receptors) and G-protein coupled receptors (GABAb). GABAa receptors are members of the ionotropic receptor superfamily which includes alpha-adrenergic and glycine receptors. The GABAb receptor is a member of a receptor superfamily which includes the mGlu receptors. The GABAb receptor is coupled to G alpha_i proteins, and activation causes a decrease in calcium, an increase in potassium membrane conductance, and inhibition of cAMP formation. The response is thus inhibitory and leads to hyperpolarization and decreased neurotransmitter release, for example.
Probab=34.90  E-value=83  Score=23.10  Aligned_cols=40  Identities=8%  Similarity=0.051  Sum_probs=25.8

Q ss_pred             EEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCC
Q psy149           12 VSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTS   53 (86)
Q Consensus        12 vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~   53 (86)
                      ++.-+|....  +=+-+...+.++++.+||++|++++.-|..
T Consensus       167 ~~~~~~~~~~--~~~d~~~~l~~i~~~~~dvvi~~~~~~~~~  206 (350)
T cd06366         167 SYRAAFPPSA--NDDDITDALKKLKEKDSRVIVVHFSPDLAR  206 (350)
T ss_pred             EEEeccCCCC--ChhHHHHHHHHHhcCCCeEEEEECChHHHH
Confidence            3444565431  113456668888888899999998865544


No 202
>TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II.
Probab=34.87  E-value=85  Score=23.44  Aligned_cols=39  Identities=13%  Similarity=0.148  Sum_probs=28.3

Q ss_pred             EEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           10 MFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        10 i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      |+++.|-=........+-+.++++++.+....++++-||
T Consensus       184 i~i~p~a~~~~K~Wp~e~~~~l~~~l~~~~~~ivl~g~p  222 (344)
T TIGR02201       184 IVIQPTSRWFFKCWDNDRFSALIDALHARGYEVVLTSGP  222 (344)
T ss_pred             EEEeCCCCccccCCCHHHHHHHHHHHHhCCCeEEEecCC
Confidence            555544333556788888999999998777778877777


No 203
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed
Probab=34.68  E-value=47  Score=24.70  Aligned_cols=18  Identities=33%  Similarity=0.403  Sum_probs=14.0

Q ss_pred             HHHHHHhhCCCCEEEeec
Q psy149           30 DLIALTVQQEPDVLILIG   47 (86)
Q Consensus        30 ~ll~~v~~~~PdvlIL~G   47 (86)
                      .+.+.+++.|||+++.+|
T Consensus        76 ~~~~~l~~~kPdivi~~~   93 (380)
T PRK00025         76 RLKRRLLAEPPDVFIGID   93 (380)
T ss_pred             HHHHHHHHcCCCEEEEeC
Confidence            344555679999999998


No 204
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase  family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to produce an activated form of ManNAc residues (UDP-ManNAc) for use in the biosynthesis of a variety of cell surface polysaccharides; The mammalian enzyme is bifunctional, catalyzing both the inversion of stereochemistry at C-2 and the hydrolysis of the UDP-sugar linkage to generate free ManNAc. It also catalyzes the phosphorylation of ManNAc to generate ManNAc 6-phosphate, a precursor to salic acids. In mammals, sialic acids are found at the termini of oligosaccharides in a large variety of cell surface glycoconjugates and are key mediators of cell-cell recognition events. Mutations in human members of this family have been associated with Sialuria, a rare disease caused by the disorders of sialic acid metabolism. This family belongs to the GT-B st
Probab=34.64  E-value=50  Score=24.23  Aligned_cols=23  Identities=26%  Similarity=0.546  Sum_probs=18.8

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccc
Q psy149           27 PLEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      -+..+.+.+++.+||+++..|.+
T Consensus        76 ~~~~l~~~l~~~~pDvV~~~g~~   98 (363)
T cd03786          76 LLIGLEAVLLEEKPDLVLVLGDT   98 (363)
T ss_pred             HHHHHHHHHHHhCCCEEEEeCCc
Confidence            35677778888999999999865


No 205
>smart00865 Tubulin_C Tubulin/FtsZ family, C-terminal domain. This domain is found in the tubulin alpha, beta and gamma chains, as well as the bacterial FtsZ family of proteins. These proteins are GTPases and are involved in polymer formation. Tubulin is the major component of microtubules, while FtsZ is the polymer-forming protein of bacterial cell division, it is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ can polymerise into tubes, sheets, and rings in vitro and is ubiquitous in bacteria and archaea. This is the C-terminal domain.
Probab=34.54  E-value=1.1e+02  Score=18.72  Aligned_cols=38  Identities=24%  Similarity=0.576  Sum_probs=28.1

Q ss_pred             EEEEeCCCCCCCCCCCchHHHHHHHHhhCCC-CEEEeeccccCC
Q psy149           10 MFVSAGPYTQSDTLSYKPLEDLIALTVQQEP-DVLILIGPLLDT   52 (86)
Q Consensus        10 i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~P-dvlIL~GPFiD~   52 (86)
                      +.+++++     ++++....+.++++++..- +.-+-.||-.+.
T Consensus        57 ~~l~~~~-----~~~~~ev~~~~~~i~~~~~~~~~v~w~~~~~~   95 (120)
T smart00865       57 VNITGGP-----DLTLKEVNEAMERIREKADPDAFIIWGPVIDE   95 (120)
T ss_pred             EEEEcCC-----CCCHHHHHHHHHHHHHhcCCCceEEEccccCC
Confidence            4677776     6888888899999887543 666778885554


No 206
>TIGR03445 mycothiol_MshB 1D-myo-inosityl-2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase. Members of this protein family are 1D-myo-inosityl-2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase, the MshB protein of mycothiol biosynthesis in Mycobacterium tuberculosis and related species.
Probab=34.53  E-value=59  Score=24.81  Aligned_cols=23  Identities=22%  Similarity=0.382  Sum_probs=18.9

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccc
Q psy149           27 PLEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      -...|.+.+++.+||+||-..|-
T Consensus       111 ~~~~l~~~Ir~~~PdvViT~~p~  133 (284)
T TIGR03445       111 AAGALVAVIREVRPHVVVTYDPN  133 (284)
T ss_pred             HHHHHHHHHHHhCCcEEEecCCC
Confidence            45677788888999999988776


No 207
>PF07555 NAGidase:  beta-N-acetylglucosaminidase ;  InterPro: IPR011496 This family consists of both eukaryotic and prokaryotic hyaluronidases. Human Q9HAR0 from SWISSPROT is expressed during meningioma []. Clostridium perfringens, P26831 from SWISSPROT, is involved in pathogenesis and is likely to act on connectivity tissue during gas gangrene []. It catalyses the random hydrolysis of 1->4-linkages between N-acetyl-beta-D-glucosamine and D-glucuronate residues in hyaluronate.; PDB: 2WB5_B 2V5C_B 2VUR_A 2V5D_A 2YDS_A 2CBI_A 2XPK_A 2CBJ_B 2J62_A 2X0Y_A ....
Probab=34.46  E-value=1e+02  Score=23.95  Aligned_cols=41  Identities=22%  Similarity=0.236  Sum_probs=30.2

Q ss_pred             chHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHHHH
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDS   76 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~   76 (86)
                      +-|.+|++.+++.+.+.+.-+-|+.|...          +.++=++.++.+
T Consensus        56 ~~l~~L~~~a~~~~V~Fv~aisPg~~~~~----------s~~~d~~~L~~K   96 (306)
T PF07555_consen   56 AELKELADAAKANGVDFVYAISPGLDICY----------SSEEDFEALKAK   96 (306)
T ss_dssp             HHHHHHHHHHHHTT-EEEEEEBGTTT--T----------SHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCEEEEEECccccccc----------CcHHHHHHHHHH
Confidence            56899999999999999999999998763          355555555555


No 208
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional
Probab=34.24  E-value=37  Score=24.84  Aligned_cols=29  Identities=21%  Similarity=0.345  Sum_probs=22.3

Q ss_pred             CCchHHHHHHHHhhC---------CCCEEEeeccccCC
Q psy149           24 SYKPLEDLIALTVQQ---------EPDVLILIGPLLDT   52 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~---------~PdvlIL~GPFiD~   52 (86)
                      .|+.|.++++++.-.         +-|.||++|=+||.
T Consensus        12 ~~~~L~~lL~~~~~~~~~~~~~~~~~d~li~lGDliDR   49 (245)
T PRK13625         12 CYQEFQALTEKLGYNWSSGLPVHPDQRKLAFVGDLTDR   49 (245)
T ss_pred             CHHHHHHHHHHcCCCcccCcccCCCCCEEEEECcccCC
Confidence            467888999887532         34799999999994


No 209
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase. This model represents an orthologous set of proteins present in relatively few bacteria but very tightly conserved where it occurs. It is closely related to gidA (glucose-inhibited division protein A), which appears to be present in all complete eubacterial genomes so far and in Saccharomyces cerevisiae. It was designated gid but is now recognized as a tRNA:m(5)U-54 methyltransferase and is now designated trmFO.
Probab=34.23  E-value=72  Score=26.07  Aligned_cols=37  Identities=19%  Similarity=0.322  Sum_probs=26.3

Q ss_pred             eEEEEeCCCCCCCCCCCchHHHHHHHHhh-CCCCEEEeec---cccCCCC
Q psy149            9 SMFVSAGPYTQSDTLSYKPLEDLIALTVQ-QEPDVLILIG---PLLDTSH   54 (86)
Q Consensus         9 ~i~vAaGPfT~~d~l~y~pL~~ll~~v~~-~~PdvlIL~G---PFiD~~h   54 (86)
                      .||||+||.+..         +|-+.+.+ ....++-+-+   |-||.+.
T Consensus       128 ~VViATG~~~s~---------~La~~L~~~~g~~~~~~~da~~p~i~~~s  168 (433)
T TIGR00137       128 ITVIATGPLTSP---------ALSEDLKELTGMDYLYFYDAAAPIVEGDS  168 (433)
T ss_pred             eEEEeCCCCccH---------HHHHHHHHhhCCceEEEecCcCcEEecCC
Confidence            689999997753         45566666 3677777777   7777663


No 210
>cd01833 XynB_like SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=34.23  E-value=1.2e+02  Score=19.55  Aligned_cols=22  Identities=32%  Similarity=0.481  Sum_probs=17.2

Q ss_pred             chHHHHHHHHhhCCCCEEEeec
Q psy149           26 KPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      +-+..+++.+++..|++.|++.
T Consensus        64 ~~~~~~i~~i~~~~p~~~ii~~   85 (157)
T cd01833          64 DRLRALIDQMRAANPDVKIIVA   85 (157)
T ss_pred             HHHHHHHHHHHHhCCCeEEEEE
Confidence            6788899999988898765543


No 211
>cd01020 TroA_b Metal binding protein TroA_b.  These proteins are predicted to function as initial receptors in ABC transport of metal ions.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=34.22  E-value=70  Score=23.54  Aligned_cols=53  Identities=11%  Similarity=0.155  Sum_probs=38.5

Q ss_pred             CchHHHHHHHHhhCCCCEEEeec-cccCCCCcc--------ccCCCc----CCCHHHHHHHHHHHh
Q psy149           25 YKPLEDLIALTVQQEPDVLILIG-PLLDTSHPL--------LLNGSL----AETFEDFYVKLIDSI   77 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~G-PFiD~~h~~--------i~~g~~----~~t~eelF~~~i~~i   77 (86)
                      +.||.+|++.|...+.+|-.|+. |=.|..+=.        |++.++    ...||..+.+.+.+.
T Consensus         9 ~~pl~~~v~~I~gd~v~V~~l~p~~g~dpH~y~~~p~d~~~l~~ADliv~~G~~lE~~~~k~~~~~   74 (264)
T cd01020           9 TNFWGSVAEAVGGDHVEVTSIITNPDVDPHDFEPTPTDAAKVSTADIVVYNGGGYDPWMTKLLADT   74 (264)
T ss_pred             ccHHHHHHHHHcCCceEEEEecCCCCCCcccCCCCHHHHHHHhhCCEEEEeCCCchHHHHHHHHhc
Confidence            46999999999999999999999 999977621        334443    345666556665543


No 212
>PF00551 Formyl_trans_N:  Formyl transferase;  InterPro: IPR002376 A number of formyl transferases belong to this group. Methionyl-tRNA formyltransferase transfers a formyl group onto the amino terminus of the acyl moiety of the methionyl aminoacyl-tRNA. The formyl group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by promoting its recognition by IF2 and by impairing its binding to EFTU-GTP. Formyltetrahydrofolate dehydrogenase produces formate from formyl- tetrahydrofolate. This is the N-terminal domain of these enzymes and is found upstream of the C-terminal domain (IPR005793 from INTERPRO). The trifunctional glycinamide ribonucleotide synthetase-aminoimidazole ribonucleotide synthetase-glycinamide ribonucleotide transformylase catalyses the second, third and fifth steps in de novo purine biosynthesis. The glycinamide ribonucleotide transformylase belongs to this group.; GO: 0016742 hydroxymethyl-, formyl- and related transferase activity, 0009058 biosynthetic process; PDB: 3P9X_B 3OBI_A 3R8X_A 3KCQ_C 3RFO_D 3AV3_A 3N0V_D 3LOU_A 3O1L_A 4DS3_A ....
Probab=33.79  E-value=48  Score=23.06  Aligned_cols=24  Identities=29%  Similarity=0.643  Sum_probs=16.5

Q ss_pred             HHHHHHHhhCCCCEEEeec--cccCC
Q psy149           29 EDLIALTVQQEPDVLILIG--PLLDT   52 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~G--PFiD~   52 (86)
                      .++++.+++.+||++++.|  -++..
T Consensus        69 ~~~~~~l~~~~~Dl~v~~~~~~il~~   94 (181)
T PF00551_consen   69 EELLELLESLNPDLIVVAGYGRILPK   94 (181)
T ss_dssp             HHHHHHHHHTT-SEEEESS-SS---H
T ss_pred             hHHHHHHHhhccceeehhhhHHHhhh
Confidence            5688899999999999976  55543


No 213
>PF13472 Lipase_GDSL_2:  GDSL-like Lipase/Acylhydrolase family; PDB: 1ES9_A 1WAB_A 3DT9_A 1BWQ_A 1FXW_A 3DT6_A 1BWR_A 3DT8_A 1BWP_A 2WAA_A ....
Probab=33.76  E-value=23  Score=22.39  Aligned_cols=44  Identities=16%  Similarity=0.211  Sum_probs=24.9

Q ss_pred             HhhCCCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHHHHhhccccC
Q psy149           35 TVQQEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDSIVQPLEK   83 (86)
Q Consensus        35 v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~i~~~~~~   83 (86)
                      +...+||++|+..=-=|..++     +...+.-+-|+..+..+++.+++
T Consensus        57 ~~~~~~d~vvi~~G~ND~~~~-----~~~~~~~~~~~~~l~~~i~~~~~  100 (179)
T PF13472_consen   57 FKDPKPDLVVISFGTNDVLNG-----DENDTSPEQYEQNLRRIIEQLRP  100 (179)
T ss_dssp             HCGTTCSEEEEE--HHHHCTC-----TTCHHHHHHHHHHHHHHHHHHHT
T ss_pred             hccCCCCEEEEEccccccccc-----ccccccHHHHHHHHHHHHHhhcc
Confidence            367999988887666676662     12233333455556666665543


No 214
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology.  The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
Probab=33.47  E-value=55  Score=23.79  Aligned_cols=21  Identities=19%  Similarity=0.332  Sum_probs=16.6

Q ss_pred             HHHHHHhhCCCCEEEeecccc
Q psy149           30 DLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        30 ~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      .+.+.+++.+||+++..+++.
T Consensus        80 ~~~~~i~~~~pDvI~~~~~~~  100 (350)
T cd03785          80 QARKILKKFKPDVVVGFGGYV  100 (350)
T ss_pred             HHHHHHHhcCCCEEEECCCCc
Confidence            355667889999999988765


No 215
>TIGR00642 mmCoA_mut_beta methylmalonyl-CoA mutase, heterodimeric type, beta chain. The adenosylcobalamin-binding, catalytic chain of methylmalonyl-CoA mutase may form homodimers, as in mitochondrion and E. coli, or heterodimers with a shorter, homologous chain that does not bind adenosylcobalamin. This model describes this non-catalytic beta chain, as found in the enzyme from Propionibacterium freudenreichii, for which the 3-dimensional structure has been solved.
Probab=32.78  E-value=51  Score=28.18  Aligned_cols=36  Identities=8%  Similarity=-0.032  Sum_probs=27.4

Q ss_pred             EEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           12 VSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        12 vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      .+||=|...++..|+-..+.++...+..+++++|||
T Consensus       519 f~~gG~~~~~~~~~~~~~~~~~a~~~sga~i~viCs  554 (619)
T TIGR00642       519 WHIAGIDTIQVEGGTTAEIVVEAFKKAGAQVAVLCS  554 (619)
T ss_pred             HhcCceeeccCCCCCCHHHHHHHHHhcCCCEEEEeC
Confidence            456777777777777777888888888888888876


No 216
>cd01832 SGNH_hydrolase_like_1 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
Probab=32.68  E-value=1.3e+02  Score=19.77  Aligned_cols=22  Identities=18%  Similarity=0.289  Sum_probs=12.4

Q ss_pred             HHHHHhhCCCCEEEeeccccCC
Q psy149           31 LIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        31 ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      .++.+...+||++|++-=-=|.
T Consensus        59 ~~~~~~~~~~d~vii~~G~ND~   80 (185)
T cd01832          59 QLPAALALRPDLVTLLAGGNDI   80 (185)
T ss_pred             HHHHHHhcCCCEEEEecccccc
Confidence            3444445799977665433343


No 217
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain. CD73 is a mammalian ecto-5'-nucleotidase expressed in endothelial cells and lymphocytes that catalyzes the conversion of 5'-AMP to adenosine in the final step of a pathway that generates adenosine from ATP.  This pathway also includes a CD39 nucleoside triphosphate dephosphorylase that mediates the dephosphorylation of ATP to ADP and then to 5'-AMP.  These enzymes all have an N-terminal metallophosphatase domain and a C-terminal 5'nucleotidase domain.  The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  MPPs are functionally diverse, but all share a conserved domain with an active si
Probab=32.67  E-value=1e+02  Score=22.82  Aligned_cols=42  Identities=10%  Similarity=0.109  Sum_probs=23.8

Q ss_pred             CCceeEEEEeCCCCCC-----CCCCCc-h---HHHHHHHHhhCCCCEEEee
Q psy149            5 RRSLSMFVSAGPYTQS-----DTLSYK-P---LEDLIALTVQQEPDVLILI   46 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~-----d~l~y~-p---L~~ll~~v~~~~PdvlIL~   46 (86)
                      |..+-++=.+.|++..     ..+.|. |   +.+.++++++.++|++|++
T Consensus       139 G~kIgviG~~~~~~~~~~~~~~~~~~~d~~~~~~~~v~~lr~~~~D~II~l  189 (281)
T cd07409         139 GEKIGIIGYTTPDTTELSSPGGKVKFLDEIEAAQKEADKLKAQGVNKIIAL  189 (281)
T ss_pred             CEEEEEEEEecCcccccccCCCceEECCHHHHHHHHHHHHHhcCCCEEEEE
Confidence            3334445455555533     234443 3   3445566666789999996


No 218
>TIGR01917 gly_red_sel_B glycine reductase, selenoprotein B. Glycine reductase is a complex with two selenoprotein subunits, A and B. This model represents the glycine reductase selenoprotein B. Closely related to it, but excluded from this model, are selenoprotein B subunits of betaine reductase and sarcosine reductase. All contain selenocysteine incorporated during translation at a specific UGA codon.
Probab=32.61  E-value=54  Score=27.13  Aligned_cols=42  Identities=19%  Similarity=0.412  Sum_probs=31.8

Q ss_pred             EEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           11 FVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        11 ~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      .|-||.=....|.+ +-...+++.+++.+||++| .||=+++..
T Consensus        49 TiiCGDnYf~en~e-ea~~~i~~mv~k~~pDv~i-aGPaFNagr   90 (431)
T TIGR01917        49 TVVCGDSFFGENLE-EAKAKVLEMIKGANPDIFI-AGPAFNAGR   90 (431)
T ss_pred             EEEECchhhhhCHH-HHHHHHHHHHHhcCCCEEE-EcCccCCcc
Confidence            56688755555543 4568889999999999875 799998865


No 219
>PRK14820 NADH dehydrogenase subunit B; Provisional
Probab=32.43  E-value=1.3e+02  Score=22.04  Aligned_cols=36  Identities=17%  Similarity=0.329  Sum_probs=27.2

Q ss_pred             CCceeEEEEeCCCCCCCCCCCchHHHHHHHHhh--CCCCEEEeec
Q psy149            5 RRSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQ--QEPDVLILIG   47 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~--~~PdvlIL~G   47 (86)
                      .+..-|++-.||-|...       ...++++.+  -+|..||-+|
T Consensus        71 PR~aDillVeG~VT~~m-------~~~l~~~~e~~p~pk~VIAvG  108 (180)
T PRK14820         71 PRQADMLMVMGTIAKKM-------APVLKQVYLQMAEPRWVVAVG  108 (180)
T ss_pred             CccceEEEEEecCCccc-------HHHHHHHHHhcCCCCeEEEEe
Confidence            46677999999998875       566666665  6777888774


No 220
>PF07521 RMMBL:  RNA-metabolising metallo-beta-lactamase;  InterPro: IPR011108 The metallo-beta-lactamase fold contains five sequence motifs. The first four motifs are found in IPR001279 from INTERPRO and are common to all metallo-beta-lactamases. The fifth motif appears to be specific to function. This entry represents the fifth motif from metallo-beta-lactamases involved in RNA metabolism [].; PDB: 3ZQ4_D 2I7T_A 2I7V_A 2YCB_B 3BK1_A 3T3N_A 3BK2_A 3T3O_A 3AF5_A 3AF6_A ....
Probab=32.34  E-value=59  Score=17.82  Aligned_cols=18  Identities=33%  Similarity=0.613  Sum_probs=12.2

Q ss_pred             HHHHHHHhhCCCCEEEee
Q psy149           29 EDLIALTVQQEPDVLILI   46 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~   46 (86)
                      .+|++.++..+|..+|++
T Consensus        21 ~~L~~~i~~~~p~~vilV   38 (43)
T PF07521_consen   21 EELLEFIEQLNPRKVILV   38 (43)
T ss_dssp             HHHHHHHHHHCSSEEEEE
T ss_pred             HHHHHHHHhcCCCEEEEe
Confidence            455666666688888875


No 221
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism]
Probab=32.25  E-value=26  Score=27.07  Aligned_cols=31  Identities=23%  Similarity=0.394  Sum_probs=20.0

Q ss_pred             CceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEe
Q psy149            6 RSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus         6 ~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .+-+|+.+.|||+..+|.      .|   ..+.+.|+||-
T Consensus       172 p~~~Iia~~GPfs~~~n~------al---l~q~~id~vIt  202 (257)
T COG2099         172 PPARIIAMRGPFSEEDNK------AL---LEQYRIDVVVT  202 (257)
T ss_pred             ChhhEEEecCCcChHHHH------HH---HHHhCCCEEEE
Confidence            345788899999987653      22   23346666664


No 222
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR.  Glutamate mediates the majority of excitatory synaptic transmission in the central nervous system via two broad classes of ionotropic receptors, characterized by their response to glutamate agonists: N-methyl-d -aspartate (NMDA) and non-NMDA receptors. NMDA receptors
Probab=32.00  E-value=55  Score=23.64  Aligned_cols=24  Identities=13%  Similarity=0.009  Sum_probs=19.3

Q ss_pred             hHHHHHHHHhhCCCCEEEeecccc
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      -+...++++++.+||++|+.+.--
T Consensus       168 d~~~~l~~i~~~~~d~Vi~~~~~~  191 (324)
T cd06368         168 MYRPLLKEIKREKERRIILDCSPE  191 (324)
T ss_pred             HHHHHHHHHhhccCceEEEECCHH
Confidence            356778899999999999988643


No 223
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type. E. coli NadR has also been found to regulate the import of its substrate, nicotinamide ribonucleotide, but it is not known if the other members of this model share that activity.
Probab=31.94  E-value=1.7e+02  Score=22.45  Aligned_cols=47  Identities=13%  Similarity=0.140  Sum_probs=30.9

Q ss_pred             HHHHHHhhCCCCEEEeeccccCCCCccccCCCcCCCHHH---HHHHHHHHhhcc
Q psy149           30 DLIALTVQQEPDVLILIGPLLDTSHPLLLNGSLAETFED---FYVKLIDSIVQP   80 (86)
Q Consensus        30 ~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t~ee---lF~~~i~~i~~~   80 (86)
                      .+.+.+++.+.|.++|+.|-++    -+++|.-+.++++   -|.+.+...+++
T Consensus       259 ~~~~~~~~~~ydl~~l~~p~~~----~~~D~~R~~~~~~~R~~~~~ll~~~l~~  308 (325)
T TIGR01526       259 FLDSDIAEYPFDLTLLLKPNTE----WVDDGLRSLGSQKQRQEFQQLLKKLLDE  308 (325)
T ss_pred             HHHHHHHhcCCCEEEECCCCCC----CccCCcccCchHHHHHHHHHHHHHHHHH
Confidence            4667777789999999999876    4566665666644   344444444443


No 224
>cd05781 DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of Sulfurisphaera ohwakuensis DNA polymerase B3 and similar archaeal family-B DNA polymerases. The 3'-5' exonuclease domain of archaeal proteins with similarity to Sulfurisphaera ohwakuensis DNA polymerase B3. B3 is a family-B DNA polymerase. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. B3 exhibits both polymerase and 3'-5' exonuclease activities. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and are involved in metal binding and catalysis. The exonuclease domain of family B polymerases also contains a beta hairpin structure that plays an important role in active site switching in the event of nucleotide misincorporation. Archaeal proteins that are involved in DNA replicatio
Probab=31.86  E-value=50  Score=23.34  Aligned_cols=23  Identities=13%  Similarity=0.391  Sum_probs=20.0

Q ss_pred             CCCCchHHHHHHHHhhCCCCEEE
Q psy149           22 TLSYKPLEDLIALTVQQEPDVLI   44 (86)
Q Consensus        22 ~l~y~pL~~ll~~v~~~~PdvlI   44 (86)
                      .-..+=|..|++.+.+.+||+++
T Consensus        46 ~~E~~lL~~F~~~i~~~dPd~i~   68 (188)
T cd05781          46 LDDRKIIREFVKYVKEYDPDIIV   68 (188)
T ss_pred             CCHHHHHHHHHHHHHHcCCCEEE
Confidence            45677899999999999999886


No 225
>TIGR01918 various_sel_PB selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family. This model represents selenoprotein B of glycine reductase, sarcosine reductase, betaine reductase, D-proline reductase, and perhaps others. This model is built in fragment mode to assist in recognizing fragmentary translations. All members are expected to contain an internal TGA codon, encoding selenocysteine, which may be misinterpreted as a stop codon.
Probab=31.83  E-value=57  Score=27.01  Aligned_cols=43  Identities=21%  Similarity=0.460  Sum_probs=32.2

Q ss_pred             EEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           10 MFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        10 i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      =.|-||.=....|.+ +-...+++.+++.+||++| .||=+++..
T Consensus        48 aTiiCGDnYf~en~e-ea~~~i~~mv~k~~pDv~i-aGPaFNagr   90 (431)
T TIGR01918        48 HTVVCGDSFFGENLE-EAVARVLEMLKDKEPDIFI-AGPAFNAGR   90 (431)
T ss_pred             EEEEECchhhhhCHH-HHHHHHHHHHHhcCCCEEE-EcCccCCcc
Confidence            356688755555543 4568889999999999875 799998865


No 226
>PF13477 Glyco_trans_4_2:  Glycosyl transferase 4-like
Probab=31.69  E-value=79  Score=19.86  Aligned_cols=26  Identities=27%  Similarity=0.399  Sum_probs=19.0

Q ss_pred             CCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           23 LSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +.|-...++.+.+++++||++...++
T Consensus        58 ~~~~~~~~l~k~ik~~~~DvIh~h~~   83 (139)
T PF13477_consen   58 LNYIKYFRLRKIIKKEKPDVIHCHTP   83 (139)
T ss_pred             HHHHHHHHHHHHhccCCCCEEEEecC
Confidence            33334557778888999999987765


No 227
>cd05785 DNA_polB_like2_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases. A subfamily of the 3'-5' exonuclease domain of family-B DNA polymerases. This subfamily is composed of uncharacterized bacterial family-B DNA polymerases. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are involved in metal binding and catalysis. The exonuclease domain of family-B DNA polymerases has a fundamental role in proofreading activity. It contains a beta hairpin structure that plays an important role in active site switching in the event of a nucleotide misincorporation. Family-B DNA polymerases are predominantly involved in DNA replication and DNA repair.
Probab=31.66  E-value=46  Score=23.98  Aligned_cols=21  Identities=33%  Similarity=0.615  Sum_probs=17.0

Q ss_pred             CCchHHHHHHHHhhCCCCEEE
Q psy149           24 SYKPLEDLIALTVQQEPDVLI   44 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlI   44 (86)
                      .-+-|..|++.+.+..||+++
T Consensus        58 E~~lL~~f~~~i~~~dPdii~   78 (207)
T cd05785          58 EKELLEELVAIIRERDPDVIE   78 (207)
T ss_pred             HHHHHHHHHHHHHHhCCCEEe
Confidence            345688899999999999764


No 228
>PHA02538 N capsid protein; Provisional
Probab=31.57  E-value=55  Score=26.27  Aligned_cols=46  Identities=22%  Similarity=0.473  Sum_probs=30.6

Q ss_pred             eCCCCC-CCCCCCchHHHHHHHHhh--------CCCCEEEeecc--ccCCCCccccC
Q psy149           14 AGPYTQ-SDTLSYKPLEDLIALTVQ--------QEPDVLILIGP--LLDTSHPLLLN   59 (86)
Q Consensus        14 aGPfT~-~d~l~y~pL~~ll~~v~~--------~~PdvlIL~GP--FiD~~h~~i~~   59 (86)
                      +|+=+- ..+=+|.-|+.++.-+.+        +.||+|+|+|=  .-|...|++..
T Consensus       191 ~~~I~i~G~~gdy~NLDalv~d~~~~lI~~~~r~dpdLVvivG~dLla~~~~~l~n~  247 (348)
T PHA02538        191 SGKIRVFGKGGDYANLDALVMDLTNNLIDPWHQDDPDLVVIVGRDLLADKYFPIVNK  247 (348)
T ss_pred             CccEEEeCCCCCccCHHHHHHHHHHccCCHHHcCCCCEEEEEChhhhhhhhhhhhhc
Confidence            444444 446688888888765544        78999999994  33455566655


No 229
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase. Epimerase activity was also demonstrated in a bifunctional rat enzyme, for which the N-terminal domain appears to be orthologous. The set of proteins found above the suggested cutoff includes E. coli WecB in one of two deeply branched clusters and the rat UDP-N-acetylglucosamine 2-epimerase domain in the other.
Probab=31.32  E-value=61  Score=24.21  Aligned_cols=22  Identities=32%  Similarity=0.646  Sum_probs=18.2

Q ss_pred             HHHHHHHHhhCCCCEEEeeccc
Q psy149           28 LEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      +..|-+.+++.+||+++..|++
T Consensus        75 ~~~l~~~l~~~~pDiv~~~gd~   96 (365)
T TIGR00236        75 LEGLEELLLEEKPDIVLVQGDT   96 (365)
T ss_pred             HHHHHHHHHHcCCCEEEEeCCc
Confidence            4567777888999999999974


No 230
>cd05776 DNA_polB_alpha_exo inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha, a family-B DNA polymerase. The 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha.  DNA polymerase alpha is a family-B DNA polymerase with a catalytic subunit that contains a DnaQ-like 3'-5' exonuclease domain. It is one of the three DNA-dependent type B DNA polymerases (delta and epsilon are the other two) that have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase alpha is almost exclusively required for the initiation of DNA replication and the priming of Okazaki fragments during elongation. It associates with DNA primase and is the only enzyme able to start DNA synthesis de novo. The catalytic subunit contains both polymerase and 3'-5' exonuclease domains, but only exhibits polymerase activity. The 3'-5' exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, without the four conserved acidic residues that are 
Probab=31.26  E-value=48  Score=24.18  Aligned_cols=19  Identities=32%  Similarity=0.441  Sum_probs=16.8

Q ss_pred             chHHHHHHHHhhCCCCEEE
Q psy149           26 KPLEDLIALTVQQEPDVLI   44 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlI   44 (86)
                      +=|..|++++.+..||+++
T Consensus        84 ~LL~~f~~~i~~~DPDiiv  102 (234)
T cd05776          84 ALLNFFLAKLQKIDPDVLV  102 (234)
T ss_pred             HHHHHHHHHHhhcCCCEEE
Confidence            4588999999999999987


No 231
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=31.18  E-value=53  Score=22.96  Aligned_cols=66  Identities=14%  Similarity=0.209  Sum_probs=43.0

Q ss_pred             CCCCCCCCCchHHHHHHHHhhCCCC-EEEeeccccCCCCc-ccc------------------CCCcCCCHHHHHHHHHHH
Q psy149           17 YTQSDTLSYKPLEDLIALTVQQEPD-VLILIGPLLDTSHP-LLL------------------NGSLAETFEDFYVKLIDS   76 (86)
Q Consensus        17 fT~~d~l~y~pL~~ll~~v~~~~Pd-vlIL~GPFiD~~h~-~i~------------------~g~~~~t~eelF~~~i~~   76 (86)
                      |..++--+|+.+...++.+.+..|+ .+||+|==.|..+. .+.                  +.......+++|+.++..
T Consensus        86 fD~t~~~Sf~~~~~w~~~i~~~~~~~piilVGNK~DL~~~~~v~~~~~~~~a~~~~~~~~e~SAk~g~~V~~~F~~l~~~  165 (189)
T cd04121          86 YDITNRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVATEQAQAYAERNGMTFFEVSPLCNFNITESFTELARI  165 (189)
T ss_pred             EECcCHHHHHHHHHHHHHHHHhCCCCCEEEEEECccchhccCCCHHHHHHHHHHcCCEEEEecCCCCCCHHHHHHHHHHH
Confidence            3445556678888888888776666 47888877776542 111                  001155689999988888


Q ss_pred             hhcccc
Q psy149           77 IVQPLE   82 (86)
Q Consensus        77 i~~~~~   82 (86)
                      ++++.+
T Consensus       166 i~~~~~  171 (189)
T cd04121         166 VLMRHG  171 (189)
T ss_pred             HHHhcC
Confidence            876654


No 232
>COG1284 Uncharacterized conserved protein [Function unknown]
Probab=30.63  E-value=74  Score=24.57  Aligned_cols=43  Identities=21%  Similarity=0.393  Sum_probs=37.2

Q ss_pred             CCceeEEEEeCCCCCCC------CCCCchHHHHHHHHhhCCCCEEEeec
Q psy149            5 RRSLSMFVSAGPYTQSD------TLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~d------~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      ++.+++.-|.|=||.++      ...+..+.+|.+-+++..||..|-+-
T Consensus       227 ~~g~T~l~g~GgYt~~~k~vl~~Vv~~~e~~~lk~iv~~iDp~Afi~i~  275 (289)
T COG1284         227 GRGVTYLDGEGGYTGEEKKVLYVVVTRLELPKLKEIVKEIDPNAFISIS  275 (289)
T ss_pred             CCceEEEeceecCCCCceEEEEEEecHHHHHHHHHHHHHhCCCcEEEEe
Confidence            56889999999999998      46888999999999999999887653


No 233
>cd01823 SEST_like SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
Probab=30.63  E-value=1.2e+02  Score=21.52  Aligned_cols=26  Identities=19%  Similarity=0.482  Sum_probs=19.7

Q ss_pred             chHHHHHHHHhhCCCCE-EEeec-cccC
Q psy149           26 KPLEDLIALTVQQEPDV-LILIG-PLLD   51 (86)
Q Consensus        26 ~pL~~ll~~v~~~~Pdv-lIL~G-PFiD   51 (86)
                      +-+.++++++++..|++ ++++| |.+.
T Consensus       131 ~~l~~~l~~i~~~~p~a~I~~~gyp~~~  158 (259)
T cd01823         131 ARLKAVLDRIRERAPNARVVVVGYPRLF  158 (259)
T ss_pred             HHHHHHHHHHHhhCCCcEEEEecccccc
Confidence            46778888899888987 77888 4443


No 234
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional
Probab=30.56  E-value=52  Score=23.32  Aligned_cols=21  Identities=19%  Similarity=0.344  Sum_probs=14.9

Q ss_pred             chHHHHHHHHhhCCCCEEEee
Q psy149           26 KPLEDLIALTVQQEPDVLILI   46 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~   46 (86)
                      +-..++++.+.+.+||++||=
T Consensus        34 ~~~~~~~~~~~~~~pDlvLlD   54 (207)
T PRK15411         34 ETVDDLAIACDSLRPSVVFIN   54 (207)
T ss_pred             CCHHHHHHHHhccCCCEEEEe
Confidence            456677777777788877664


No 235
>cd02065 B12-binding_like B12 binding domain (B12-BD). Most of the members bind different cobalamid derivates, like B12 (adenosylcobamide) or methylcobalamin or methyl-Co(III) 5-hydroxybenzimidazolylcobamide. This domain is found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase. Cobalamin undergoes a conformational change on binding the protein; the dimethylbenzimidazole group, which is coordinated to the cobalt in the free cofactor, moves away from the corrin and is replaced by a histidine contributed by the protein. The sequence Asp-X-His-X-X-Gly, which contains this histidine ligand, is conserved in many cobalamin-binding proteins. Not all members of this family contain the conserved binding motif.
Probab=30.14  E-value=65  Score=20.11  Aligned_cols=21  Identities=24%  Similarity=0.438  Sum_probs=17.6

Q ss_pred             chHHHHHHHHhhCCCCEEEee
Q psy149           26 KPLEDLIALTVQQEPDVLILI   46 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~   46 (86)
                      .|..++++.+.+.+||++-+.
T Consensus        37 ~~~~~~~~~i~~~~pdiV~iS   57 (125)
T cd02065          37 VPPEEIVEAAKEEDADVVGLS   57 (125)
T ss_pred             CCHHHHHHHHHHcCCCEEEEe
Confidence            477888999999999988874


No 236
>CHL00175 minD septum-site determining protein; Validated
Probab=30.14  E-value=1e+02  Score=22.45  Aligned_cols=31  Identities=13%  Similarity=0.192  Sum_probs=22.1

Q ss_pred             CCCCchHHHHHHHHhhCCCCEEEe-eccccCC
Q psy149           22 TLSYKPLEDLIALTVQQEPDVLIL-IGPLLDT   52 (86)
Q Consensus        22 ~l~y~pL~~ll~~v~~~~PdvlIL-~GPFiD~   52 (86)
                      .+.-+-|.++++.+.+.+.|++|+ ++|.++.
T Consensus       109 ~~~~~~l~~~l~~l~~~~yD~VIiDtpp~~~~  140 (281)
T CHL00175        109 NVTRKNMNMLVDSLKNRGYDYILIDCPAGIDV  140 (281)
T ss_pred             cCCHHHHHHHHHHHHhCCCCEEEEeCCCCCCH
Confidence            344445888888887657897777 8887754


No 237
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea . Na+/H+ exchange proteins eject protons from cells, effectively eliminating excess acid from actively metabolising cells. Na+ /H+ exchange activity is also crucial for the regulation of cell volume, and for the reabsorption of NaCl across renal, intestinal, and other epithelia. These antiports exchange Na+ for H+ in an electroneutral manner, and this activity is carried out by a family of Na+ /H+ exchangers, or NHEs, which are known to be present in both prokaryotic and eukaryotic cells.  These exchangers are highly-regulated (glyco)phosphoproteins, which, based on their primary structure, appear to contain 10-12 membrane-spanning regions (M) at the N-terminus and a large cytoplasmic region at the C-terminus. The transmembrane regions M3-M12 share identity wit h other members of the family. The M6 and M7 regions are highly conserved. Thus, this is thought to be the regio
Probab=30.13  E-value=72  Score=19.59  Aligned_cols=20  Identities=10%  Similarity=0.350  Sum_probs=17.6

Q ss_pred             chHHHHHHHHhhCCCCEEEe
Q psy149           26 KPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL   45 (86)
                      +|..++++.+.+.+.|++|+
T Consensus        81 ~~~~~I~~~a~~~~~dlIV~  100 (132)
T cd01988          81 DIASGILRTAKERQADLIIM  100 (132)
T ss_pred             CHHHHHHHHHHhcCCCEEEE
Confidence            48899999999999998877


No 238
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only]
Probab=30.10  E-value=49  Score=26.16  Aligned_cols=24  Identities=29%  Similarity=0.567  Sum_probs=19.0

Q ss_pred             hHHHHHHHHhhCCCCEEEeecccc
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      .-.+-++.+.+.+|+++|.=||--
T Consensus       189 ~~~~~l~~i~e~~P~v~ii~GPpt  212 (304)
T COG2248         189 INDEALEFILEKRPDVLIIGGPPT  212 (304)
T ss_pred             CccHHHHHHHhcCCCEEEecCCch
Confidence            445667777778999999999965


No 239
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors, non-NMDA ionotropic receptors which respond to the neurotransmitter glutamate.  While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. Kainate receptors have five subunits, GluR5, GluR6, GluR7, KA1, and KA2, which are structurally similar to AMPA and NMDA subunits of ionotropic glutamate receptors. KA1 and KA2 subunits can only form functional receptors with one of the GluR5-7 subunits. Moreover, GluR5-7 can also form functional homomeri
Probab=29.85  E-value=62  Score=23.59  Aligned_cols=21  Identities=10%  Similarity=0.079  Sum_probs=17.5

Q ss_pred             HHHHHHHHhhCCCCEEEeecc
Q psy149           28 LEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +...|.++++.+||++|+.+.
T Consensus       170 ~~~~l~~i~~~~~d~vv~~~~  190 (327)
T cd06382         170 YRPLLKEIKNSGDNRIIIDCS  190 (327)
T ss_pred             HHHHHHHHHhcCceEEEEECC
Confidence            457788999999999998775


No 240
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor. Ligand-binding domain of the T1R taste receptor. The T1R is a member of the family C receptors within the G-protein coupled receptor superfamily, which also includes the metabotropic glutamate receptors, GABAb receptors, the calcium-sensing receptor (CaSR), the V2R pheromone receptors, and a small group of uncharacterized orphan receptors.
Probab=29.73  E-value=55  Score=25.12  Aligned_cols=25  Identities=8%  Similarity=0.209  Sum_probs=20.3

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      .+...+.+++..+||++|+.+.-=+
T Consensus       222 d~~~~l~~i~~~~~dvIil~~~~~~  246 (410)
T cd06363         222 DYQQILKQINQTKVNVIVVFASRQP  246 (410)
T ss_pred             HHHHHHHHHhcCCCeEEEEEcChHH
Confidence            4667888999999999999886544


No 241
>PF01624 MutS_I:  MutS domain I C-terminus.;  InterPro: IPR007695 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication []. MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base []. MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch []. MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level []. Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.  MutS is a modular protein with a complex structure [], and is composed of:   N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.   The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair. Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein [].This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions []. Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts [].  This entry represents the N-terminal domain of proteins in the MutS family of DNA mismatch repair proteins, as well as closely related proteins. The N-terminal domain of MutS is responsible for mismatch recognition and forms a 6-stranded mixed beta-sheet surrounded by three alpha-helices, which is similar to the structure of tRNA endonuclease. Yeast MSH3 [], bacterial proteins involved in DNA mismatch repair, and the predicted protein product of the Rep-3 gene of mouse share extensive sequence similarity. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein.; GO: 0005524 ATP binding, 0030983 mismatched DNA binding, 0006298 mismatch repair; PDB: 1FW6_A 1EWQ_A 1EWR_B 1NNE_B 3THY_B 3THZ_B 3THW_B 3THX_B 2WTU_A 1OH7_A ....
Probab=29.39  E-value=58  Score=20.97  Aligned_cols=21  Identities=24%  Similarity=0.417  Sum_probs=17.1

Q ss_pred             chHHHHHHHHhhCCCCEEEee
Q psy149           26 KPLEDLIALTVQQEPDVLILI   46 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~   46 (86)
                      +|+......+++..||.|+|+
T Consensus         1 Tp~~~~y~~lk~k~~d~i~lf   21 (113)
T PF01624_consen    1 TPFEQQYWELKEKYPDTIVLF   21 (113)
T ss_dssp             -HHHHHHHHHHCTSTTSEEEE
T ss_pred             ChHHHHHHHHHhhCCCeEEEE
Confidence            478888888999999988875


No 242
>PF12683 DUF3798:  Protein of unknown function (DUF3798);  InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria. They are typically between 247 and 417 amino acids in length. Most of the proteins in this entry have an N-terminal lipoprotein attachment site. These proteins have distant similarity to periplasmic ligand binding families suggesting that this family has a similar role.; PDB: 3QI7_A.
Probab=29.34  E-value=25  Score=27.43  Aligned_cols=45  Identities=9%  Similarity=0.191  Sum_probs=26.4

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCcCCCHHHHHH
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYV   71 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~   71 (86)
                      -..+-+++|++.|||++.+.|+--+----.-+..++....+++.+
T Consensus        74 Gt~~af~kIkekRpDIl~ia~~~~EDp~~i~~~aDi~~~~D~~~~  118 (275)
T PF12683_consen   74 GTAEAFRKIKEKRPDILLIAGEPHEDPEVISSAADIVVNPDEISR  118 (275)
T ss_dssp             --HHHHHHHHHH-TTSEEEESS--S-HHHHHHHSSEEEE--HHHH
T ss_pred             chHHHHHHHHhcCCCeEEEcCCCcCCHHHHhhccCeEeccchhhc
Confidence            456788999999999999999865532222334556666666665


No 243
>COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]
Probab=29.33  E-value=1.3e+02  Score=22.76  Aligned_cols=41  Identities=15%  Similarity=0.310  Sum_probs=30.7

Q ss_pred             eeEEEEeC-CCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149            8 LSMFVSAG-PYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus         8 l~i~vAaG-PfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      -.|++.-| .+....++.-+.+.++++.+.+....|++.=||
T Consensus       176 ~~i~i~pg~s~~~~K~wp~e~~~~l~~~l~~~~~~Vvl~g~~  217 (334)
T COG0859         176 PYIVINPGASRGSAKRWPLEHYAELAELLIAKGYQVVLFGGP  217 (334)
T ss_pred             CeEEEeccccccccCCCCHHHHHHHHHHHHHCCCEEEEecCh
Confidence            35666667 677778899999999999999988545444445


No 244
>TIGR00504 pyro_pdase pyroglutamyl-peptidase I. Alternate names include pyroglutamate aminopeptidase, pyrrolidone-carboxylate peptidase, and 5-oxoprolyl-peptidase. It removes pyroglutamate (pyrrolidone-carboxylate, a modified glutamine) that can otherwise block hydrolysis of a polypeptide at the amino end, and so can be extremely useful in the biochemical studies of proteins. The biological role in the various species in which it is found is not fully understood. The enzyme appears to be a homodimer. It does not closely resemble any other peptidases.
Probab=29.26  E-value=62  Score=23.72  Aligned_cols=27  Identities=19%  Similarity=0.363  Sum_probs=18.0

Q ss_pred             CCchHHHHH-HHHhhCCCCEEEeecccc
Q psy149           24 SYKPLEDLI-ALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        24 ~y~pL~~ll-~~v~~~~PdvlIL~GPFi   50 (86)
                      +|+...+.+ +.+.+.+||++|.+|=.=
T Consensus        42 ~~~~~~~~l~~~l~~~~Pd~vi~~G~a~   69 (212)
T TIGR00504        42 TFFEAIEALQQAIDEIEPDIVIMLGLAP   69 (212)
T ss_pred             ChHHHHHHHHHHHHHHCCCEEEEeccCC
Confidence            355544444 555567999999999643


No 245
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis]
Probab=29.25  E-value=81  Score=26.07  Aligned_cols=41  Identities=24%  Similarity=0.384  Sum_probs=24.7

Q ss_pred             eEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCCccccCCC
Q psy149            9 SMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGS   61 (86)
Q Consensus         9 ~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~   61 (86)
                      -.+||+||-|+.      .|.+-+...  .--|.|-    |.|+.-|.|..-.
T Consensus       131 ~~vIATGPLTs~------~La~~i~~l--tG~d~l~----FyDAaAPIi~~dS  171 (439)
T COG1206         131 ITVIATGPLTSD------ALAEKIKEL--TGEDYLY----FYDAAAPIIEFDS  171 (439)
T ss_pred             cEEEecCCCCCH------HHHHHHHHh--hCCceEE----eecccCceeeccc
Confidence            468999999976      344444333  3344443    6677777665433


No 246
>PRK09620 hypothetical protein; Provisional
Probab=29.24  E-value=1.2e+02  Score=22.22  Aligned_cols=43  Identities=9%  Similarity=0.083  Sum_probs=31.3

Q ss_pred             ceeEEEEeCC---------CCCCCCCCCchHHHHHHHHhhCCCCEEEeecccc
Q psy149            7 SLSMFVSAGP---------YTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus         7 ~l~i~vAaGP---------fT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      ..+|+|.|||         |=+..+-.|-. ..+.+++.+...+|+++.||.-
T Consensus         3 gk~vlITaG~T~E~iD~VR~itN~SSGfiG-s~LA~~L~~~Ga~V~li~g~~~   54 (229)
T PRK09620          3 GKKVLITSGGCLEKWDQVRGHTNMAKGTIG-RIIAEELISKGAHVIYLHGYFA   54 (229)
T ss_pred             CCEEEEeCCCccCCcCCeeEecCCCcCHHH-HHHHHHHHHCCCeEEEEeCCCc
Confidence            4689999999         55554544544 3566777778899999999853


No 247
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain. CWF19 cell cycle control protein (also known as CWF19-like 1 (CWF19L1) in Homo sapiens), N-terminal metallophosphatase domain.   CWF19 contains C-terminal domains similar to that found in the CwfJ cell cycle control protein.   The metallophosphatase domain belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site
Probab=29.11  E-value=68  Score=22.22  Aligned_cols=18  Identities=17%  Similarity=0.337  Sum_probs=15.2

Q ss_pred             CCCCEEEeeccccCCCCc
Q psy149           38 QEPDVLILIGPLLDTSHP   55 (86)
Q Consensus        38 ~~PdvlIL~GPFiD~~h~   55 (86)
                      .+.|.+|++|-|....+.
T Consensus        25 gpFd~~ic~Gdff~~~~~   42 (150)
T cd07380          25 GPFDALLCVGDFFGDDED   42 (150)
T ss_pred             CCeeEEEEecCccCCccc
Confidence            678999999999987664


No 248
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain. Acid phosphatase 5 (ACP5) removes the mannose 6-phosphate recognition marker from lysosomal proteins.  The exact site of dephosphorylation is not clear. Evidence suggests dephosphorylation may take place in a prelysosomal compartment as well as in the lysosome.  ACP5 belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site ma
Probab=28.95  E-value=65  Score=23.20  Aligned_cols=25  Identities=12%  Similarity=0.306  Sum_probs=17.4

Q ss_pred             hHHHH-HHHHhhCCCCEEEeeccccC
Q psy149           27 PLEDL-IALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        27 pL~~l-l~~v~~~~PdvlIL~GPFiD   51 (86)
                      .+.+. .+.+++.+||.+|.+|=++.
T Consensus        19 ~~~~~~~~~~~~~~~dfvv~~GD~~y   44 (277)
T cd07378          19 AVAKAMAKVAAELGPDFILSLGDNFY   44 (277)
T ss_pred             HHHHHHHHHHHhcCCCEEEeCCCccc
Confidence            34444 44555589999999998763


No 249
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene. This group includes the type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene; their substrate specificity is not well characterized, however.
Probab=28.92  E-value=67  Score=23.19  Aligned_cols=22  Identities=14%  Similarity=0.188  Sum_probs=17.3

Q ss_pred             HHHHHHHHhhCCCCEEEeeccc
Q psy149           28 LEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      +...+.++++.+||+|++.+..
T Consensus       178 ~~~~v~~~~~~~pd~v~~~~~~  199 (336)
T cd06360         178 FASYLAQIPDDVPDAVFVFFAG  199 (336)
T ss_pred             hHHHHHHHHhcCCCEEEEeccc
Confidence            3457888999999999987653


No 250
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only]
Probab=28.72  E-value=65  Score=24.46  Aligned_cols=28  Identities=25%  Similarity=0.377  Sum_probs=24.8

Q ss_pred             CCCchHHHHHHHHhhCCCCEEEeecccc
Q psy149           23 LSYKPLEDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      -++.-+..+++.+...++|+||..|.+.
T Consensus        14 g~~~~~~k~~~~~~~~~~D~lviaGDlt   41 (226)
T COG2129          14 GSEDSLKKLLNAAADIRADLLVIAGDLT   41 (226)
T ss_pred             cchHHHHHHHHHHhhccCCEEEEeccee
Confidence            3566788999999999999999999998


No 251
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine). This subgroup includes the type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine). This subgroup also includes a leucine-specific binding protein (or LivK), which is very similar in sequence and structure to leucine-isoleucine-valine binding protein (LIVBP). ABC-type active transport systems are transmembrane proteins that function in the transport of diverse sets of substrates across extra- and intracellular membranes, including carbohydrates, amino acids, inorganic ions, dipeptides and oligopeptides, metabolic products, lipids and sterols, and heme, to name a few.
Probab=28.66  E-value=1.3e+02  Score=21.68  Aligned_cols=22  Identities=14%  Similarity=0.300  Sum_probs=17.4

Q ss_pred             hHHHHHHHHhhCCCCEEEeecc
Q psy149           27 PLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      .+...+..+++.+||++|+.|.
T Consensus       178 d~~~~l~~i~~~~~~~vi~~~~  199 (334)
T cd06342         178 DFSAILTKIKAANPDAVFFGGY  199 (334)
T ss_pred             cHHHHHHHHHhcCCCEEEEcCc
Confidence            3566688888899999998764


No 252
>cd01827 sialate_O-acetylesterase_like1 sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=28.55  E-value=60  Score=21.62  Aligned_cols=24  Identities=17%  Similarity=0.194  Sum_probs=17.6

Q ss_pred             chHHHHHHHHhhCCCCE-EEeeccc
Q psy149           26 KPLEDLIALTVQQEPDV-LILIGPL   49 (86)
Q Consensus        26 ~pL~~ll~~v~~~~Pdv-lIL~GPF   49 (86)
                      +-+..+++.+++..|+. +|++.|+
T Consensus        93 ~~l~~li~~i~~~~~~~~iil~t~~  117 (188)
T cd01827          93 KDYETMIDSFQALPSKPKIYICYPI  117 (188)
T ss_pred             HHHHHHHHHHHHHCCCCeEEEEeCC
Confidence            35778999988877773 6677775


No 253
>PRK12863 YciI-like protein; Reviewed
Probab=28.49  E-value=67  Score=20.13  Aligned_cols=24  Identities=29%  Similarity=0.371  Sum_probs=17.6

Q ss_pred             HHHHHHhhCCCCEEEeeccccCCCC
Q psy149           30 DLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        30 ~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      +=++++++. ...++..||+.|.+-
T Consensus        23 ~H~~~l~~~-~g~~l~~Gp~~~~~g   46 (94)
T PRK12863         23 AHLAYLETL-EGRLLAAGPLLDDDG   46 (94)
T ss_pred             HHHHHHHHh-CCeEEEeCCCcCCCC
Confidence            334566666 678999999999753


No 254
>cd07952 ED_3B_like Uncharacterized class III extradiol dioxygenases. This subfamily is composed of proteins of unknown function with similarity to the catalytic B subunit of class III extradiol dioxygenases. Class III extradiol dioxygenases use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. They play key roles in the degradation of aromatic compounds.
Probab=28.46  E-value=1.1e+02  Score=22.63  Aligned_cols=30  Identities=27%  Similarity=0.360  Sum_probs=21.2

Q ss_pred             CCCCchHHHHHHHH--hhCCCCEEEeeccccC
Q psy149           22 TLSYKPLEDLIALT--VQQEPDVLILIGPLLD   51 (86)
Q Consensus        22 ~l~y~pL~~ll~~v--~~~~PdvlIL~GPFiD   51 (86)
                      ....++..++++..  +..+||++|+++|=-.
T Consensus        16 ~~~~~~~~~~l~~~~~~~~~Pd~IvvispH~~   47 (256)
T cd07952          16 DEESRKLNEAIKEEGAKNDDPDVLVVITPHGI   47 (256)
T ss_pred             CcchHHHHHHHHHHHHHhcCCCEEEEECCCcc
Confidence            44556667777654  3468999999999544


No 255
>cd05777 DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase delta, a family-B DNA polymerase. The 3'-5' exonuclease domain of eukaryotic DNA polymerase delta. DNA polymerase delta is a family-B DNA polymerase with a catalytic subunit that contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain. It is one of the three DNA-dependent type B DNA polymerases (alpha and epsilon are the other two) that have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase delta is the enzyme responsible for both elongation and maturation of Okazaki fragments on the lagging strand. It is also implicated in mismatch repair (MMR) and base excision repair (BER). The catalytic subunit displays both polymerase and 3'-5' exonuclease activities. The exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic
Probab=28.39  E-value=60  Score=23.42  Aligned_cols=21  Identities=14%  Similarity=0.238  Sum_probs=17.7

Q ss_pred             CCchHHHHHHHHhhCCCCEEE
Q psy149           24 SYKPLEDLIALTVQQEPDVLI   44 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlI   44 (86)
                      ..+=|..|++.+.+..||+++
T Consensus        71 E~eLL~~f~~~i~~~DPDii~   91 (230)
T cd05777          71 EEELLLAWRDFVQEVDPDIIT   91 (230)
T ss_pred             HHHHHHHHHHHHHhcCCCEEE
Confidence            456688999999999999976


No 256
>PLN02331 phosphoribosylglycinamide formyltransferase
Probab=28.38  E-value=64  Score=23.59  Aligned_cols=19  Identities=21%  Similarity=0.406  Sum_probs=16.7

Q ss_pred             HHHHHHHhhCCCCEEEeec
Q psy149           29 EDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~G   47 (86)
                      .++++.+.+.+||++++.|
T Consensus        68 ~~~~~~l~~~~~Dliv~ag   86 (207)
T PLN02331         68 DELVDALRGAGVDFVLLAG   86 (207)
T ss_pred             HHHHHHHHhcCCCEEEEeC
Confidence            4788889999999999987


No 257
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional
Probab=28.36  E-value=1.3e+02  Score=22.72  Aligned_cols=39  Identities=10%  Similarity=0.164  Sum_probs=27.9

Q ss_pred             EEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           10 MFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        10 i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      |+++.|.=........+.+.++++++.+....++++-||
T Consensus       186 i~i~pga~~~~K~Wp~e~fa~l~~~L~~~~~~vvl~ggp  224 (352)
T PRK10422        186 VVIQPTARQIFKCWDNDKFSAVIDALQARGYEVVLTSGP  224 (352)
T ss_pred             EEEecCCCccccCCCHHHHHHHHHHHHHCCCeEEEEcCC
Confidence            455555433556787888999999987766677777788


No 258
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain. YfcE is a manganase-dependent metallophosphatase, found in bacteria and archaea, that cleaves bis-p-nitrophenyl phosphate, thymidine 5'-monophosphate-p-nitrophenyl ester, and p-nitrophenyl phosphorylcholine, but is unable to hydrolyze 2',3 ' or 3',5' cyclic nucleic phosphodiesters, and various phosphomonoesters, including p-nitrophenyl phosphate. This family also includes the Bacilus subtilis YsnB and Methanococcus jannaschii MJ0936 proteins.  This domain family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid ph
Probab=28.28  E-value=68  Score=20.93  Aligned_cols=27  Identities=26%  Similarity=0.325  Sum_probs=21.0

Q ss_pred             CchHHHHHHHHhhCCCCEEEeeccccCCC
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGPLLDTS   53 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GPFiD~~   53 (86)
                      ++-+..+++.+++  +|.+|.+|=+++..
T Consensus        12 ~~~~~~~~~~~~~--~d~ii~~GD~~~~~   38 (155)
T cd00841          12 LELLEKALELFGD--VDLIIHAGDVLYPG   38 (155)
T ss_pred             HHHHHHHHHHhcC--CCEEEECCcccccc
Confidence            3567777777655  99999999888754


No 259
>TIGR01319 glmL_fam conserved hypothetical protein. This small family includes, so far, an uncharacterized protein from E. coli O157:H7 and GlmL from Clostridium tetanomorphum and Clostridium cochlearium. GlmL is located between the genes for the two subunits, epsilon (GlmE) and sigma (GlmS), of the coenzyme-B12-dependent glutamate mutase (methylaspartate mutase), the first enzyme in a pathway of glutamate fermentation. Members shows significant sequence similarity to the hydantoinase branch of the hydantoinase/oxoprolinase family (pfam01968).
Probab=27.84  E-value=50  Score=27.51  Aligned_cols=21  Identities=14%  Similarity=0.237  Sum_probs=17.0

Q ss_pred             HHHHHHHHhhCCCCEEEeecc
Q psy149           28 LEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GP   48 (86)
                      -..=++.+.+.+||+++|.|=
T Consensus       109 ~~~~l~~I~~~~PDIILLaGG  129 (463)
T TIGR01319       109 NNKDIEAIEESNLDIILFAGG  129 (463)
T ss_pred             CHHHHHHHhhcCCCEEEEeCC
Confidence            445577888899999999995


No 260
>TIGR00162 conserved hypothetical protein TIGR00162. This ortholog set includes MJ1210 from Methanococcus jannaschii and AF0525 from Archaeoglobus fulgidus, but not MJ0106 or AF1251.
Probab=27.82  E-value=1.1e+02  Score=21.86  Aligned_cols=45  Identities=11%  Similarity=0.200  Sum_probs=35.1

Q ss_pred             CceeEEEEeCCC-CCCCCCCCchHHHHHHHHhhCCCCEEEeecccc
Q psy149            6 RSLSMFVSAGPY-TQSDTLSYKPLEDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus         6 ~~l~i~vAaGPf-T~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      .+-.+++-.||. ..+.++.|+=-..+++.+.+....-+|.+|=+.
T Consensus        13 ~~~~illl~g~e~~~~p~~~~e~a~~vld~a~~~gv~~iitLgG~~   58 (188)
T TIGR00162        13 NGTDLIILVGNTQSLSPEGQYELVNAIIDVAKKYGARMIYTLGGYG   58 (188)
T ss_pred             CCCCEEEEEcCCCCCChhhHHHHHHHHHHHHHHcCCCEEEEecCCc
Confidence            446788899998 555577788667788888999999888887654


No 261
>TIGR00936 ahcY adenosylhomocysteinase. This enzyme hydrolyzes adenosylhomocysteine as part of a cycle for the regeneration of the methyl donor S-adenosylmethionine. Species that lack this enzyme are likely to have adenosylhomocysteine nucleosidase (EC 3.2.2.9), an enzyme which also acts as 5'-methyladenosine nucleosidase (see TIGR01704).
Probab=27.63  E-value=56  Score=26.44  Aligned_cols=38  Identities=21%  Similarity=0.369  Sum_probs=26.6

Q ss_pred             EEEEeCCCCCCCCC-----------------CCchHHHHHHHHhhCCCCEEEeec
Q psy149           10 MFVSAGPYTQSDTL-----------------SYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        10 i~vAaGPfT~~d~l-----------------~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      .|.+|-||++.|+.                 +-+-..+-++++...+||++|=.|
T Consensus        60 ~~~~~np~stqd~vaaaL~~~gi~v~a~~~~~~~ey~~~~~~~l~~~p~~iiDdG  114 (406)
T TIGR00936        60 AWTSCNPLSTQDDVAAALAKAGIPVFAWRGETNEEYYWAIEQVLDHEPNIIIDDG  114 (406)
T ss_pred             EEEccCCccccHHHHHHHHhCCceEEEecCCCHHHHHHHHHHHhcCCCCEEEecc
Confidence            56778999988765                 222333556667778999988766


No 262
>PF03470 zf-XS:  XS zinc finger domain;  InterPro: IPR005381 This domain is a putative nucleic acid binding zinc finger and is found at the N terminus of proteins that also contain an adjacent XS domain IPR005380 from INTERPRO and in some proteins a C-terminal XH domain IPR005379 from INTERPRO.
Probab=27.57  E-value=72  Score=18.32  Aligned_cols=21  Identities=19%  Similarity=0.466  Sum_probs=16.4

Q ss_pred             CCCCCCC-CCCchHHHHHHHHhh
Q psy149           16 PYTQSDT-LSYKPLEDLIALTVQ   37 (86)
Q Consensus        16 PfT~~d~-l~y~pL~~ll~~v~~   37 (86)
                      ||+.... =+|. +.|||+.+..
T Consensus         2 P~C~~kkk~~Y~-~~~LlqHA~g   23 (43)
T PF03470_consen    2 PFCPGKKKQDYK-YRELLQHASG   23 (43)
T ss_pred             CCCCCCCCccee-hhHHHHHHHh
Confidence            8888763 4688 9999998765


No 263
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This group includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); its ligand specificity has not been determined experimentally.
Probab=27.51  E-value=1.4e+02  Score=20.69  Aligned_cols=38  Identities=13%  Similarity=0.217  Sum_probs=26.2

Q ss_pred             CCceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149            5 RRSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      |.++.+++....      -+.+....+++.+...+||.+|++|.
T Consensus        32 g~~v~l~~~~~~------~~~~~~~~~~~~l~~~~vd~iI~~~~   69 (281)
T cd06325          32 GKNVKIDYQNAQ------GDQSNLPTIARKFVADKPDLIVAIAT   69 (281)
T ss_pred             CceEEEEEecCC------CCHHHHHHHHHHHHhcCCCEEEEcCc
Confidence            446676665322      23356677888888889999999874


No 264
>PRK15401 alpha-ketoglutarate-dependent dioxygenase AlkB; Provisional
Probab=27.45  E-value=1.6e+02  Score=21.82  Aligned_cols=49  Identities=18%  Similarity=0.346  Sum_probs=29.4

Q ss_pred             CCCceeE-EEEeCC---------CCCCCC--CC---Cch----HHHHHHHHhhC------CCCEEEe--------ecccc
Q psy149            4 TRRSLSM-FVSAGP---------YTQSDT--LS---YKP----LEDLIALTVQQ------EPDVLIL--------IGPLL   50 (86)
Q Consensus         4 ~~~~l~i-~vAaGP---------fT~~d~--l~---y~p----L~~ll~~v~~~------~PdvlIL--------~GPFi   50 (86)
                      +|..+++ +..||+         |..+..  ..   +.|    |.+|.+++...      .||.+|+        ||.=.
T Consensus        54 gg~~msv~mt~~G~~~W~~d~~~YrYs~~~~~~~~pwp~~P~~l~~L~~~~~~~~~~~~~~p~a~LvN~Y~~G~~mg~H~  133 (213)
T PRK15401         54 GGYTMSVAMTNCGALGWVTDRRGYRYSPIDPLTGKPWPAMPASFLALAQRAAAAAGFPGFQPDACLINRYAPGAKLSLHQ  133 (213)
T ss_pred             CCCcceeEEeccccceEecCCCCcccCCcCCCCCCCCCCchHHHHHHHHHHHHHcCCCCCCCCEEEEEeccCcCcccccc
Confidence            3456666 566774         444432  23   333    67777777543      8898887        56666


Q ss_pred             CC
Q psy149           51 DT   52 (86)
Q Consensus        51 D~   52 (86)
                      |.
T Consensus       134 D~  135 (213)
T PRK15401        134 DK  135 (213)
T ss_pred             CC
Confidence            64


No 265
>PRK06411 NADH dehydrogenase subunit B; Validated
Probab=27.31  E-value=1.6e+02  Score=21.60  Aligned_cols=36  Identities=22%  Similarity=0.349  Sum_probs=25.8

Q ss_pred             CCceeEEEEeCCCCCCCCCCCchHHHHHHHHhh--CCCCEEEeec
Q psy149            5 RRSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQ--QEPDVLILIG   47 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~--~~PdvlIL~G   47 (86)
                      .+..-|++-+|+-|...       ...+.++.+  .+|..||-+|
T Consensus        72 Pr~aDvllV~G~vt~~~-------~~~l~~~~e~mp~pk~VIA~G  109 (183)
T PRK06411         72 PRQADLMIVAGTLTNKM-------APALRRLYDQMPEPKWVISMG  109 (183)
T ss_pred             CCceeEEEEEeCCCccc-------hHHHHHHHHHcCcCCeEEEEe
Confidence            35577999999998774       445555554  4788898774


No 266
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine  kinases. The Serine Threonine  kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. The N-terminal domain is homologous to the USP family which has a ATP binding fold. The N-terminal domain  is predicted to be involved in ATP binding.
Probab=27.26  E-value=85  Score=20.00  Aligned_cols=20  Identities=5%  Similarity=0.190  Sum_probs=17.6

Q ss_pred             chHHHHHHHHhhCCCCEEEe
Q psy149           26 KPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .|-..+++++++.+.|.+||
T Consensus        90 ~~~~~I~~~a~~~~~dlIV~  109 (146)
T cd01989          90 DVAKAIVEYVADHGITKLVM  109 (146)
T ss_pred             cHHHHHHHHHHHcCCCEEEE
Confidence            57888999999999998887


No 267
>PF14237 DUF4339:  Domain of unknown function (DUF4339)
Probab=27.16  E-value=92  Score=16.96  Aligned_cols=22  Identities=32%  Similarity=0.699  Sum_probs=13.1

Q ss_pred             eCCCCCCCCCCCchHHHHHHHHhh--CCCCEEE
Q psy149           14 AGPYTQSDTLSYKPLEDLIALTVQ--QEPDVLI   44 (86)
Q Consensus        14 aGPfT~~d~l~y~pL~~ll~~v~~--~~PdvlI   44 (86)
                      .|||+..         +|.+.+++  ..++.+|
T Consensus        11 ~GP~s~~---------el~~l~~~g~i~~~tlv   34 (45)
T PF14237_consen   11 QGPFSLE---------ELRQLISSGEIDPDTLV   34 (45)
T ss_pred             ECCcCHH---------HHHHHHHcCCCCCCCeE
Confidence            6898754         55555554  5555554


No 268
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family. The family of KdpD sensor kinase proteins regulates the kdpFABC operon responsible for potassium transport. The USP domain is homologous to the universal stress protein Usp Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity.
Probab=27.01  E-value=88  Score=19.33  Aligned_cols=22  Identities=5%  Similarity=0.152  Sum_probs=19.1

Q ss_pred             chHHHHHHHHhhCCCCEEEeec
Q psy149           26 KPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      .|-..+++++.+.+.|.||+-.
T Consensus        72 ~~~~~I~~~~~~~~~dllviG~   93 (124)
T cd01987          72 DVAEAIVEFAREHNVTQIVVGK   93 (124)
T ss_pred             cHHHHHHHHHHHcCCCEEEeCC
Confidence            4788999999999999999854


No 269
>cd05784 DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase II and similar bacterial family-B DNA polymerases. The 3'-5' exonuclease domain of Escherichia coli DNA polymerase II (Pol II) and similar bacterial proteins. Pol II is a family-B DNA polymerase. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and are involved in metal binding and catalysis. The exonuclease domain has a fundamental role in the proofreading activity of polII. It contains a beta hairpin structure that plays an important role in active site switching in the event of a nucleotide misincorporation. Pol II is involved in a variety of cellular activities, such as the repair of DNA damaged
Probab=27.00  E-value=66  Score=23.02  Aligned_cols=20  Identities=40%  Similarity=0.502  Sum_probs=17.1

Q ss_pred             CchHHHHHHHHhhCCCCEEE
Q psy149           25 YKPLEDLIALTVQQEPDVLI   44 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlI   44 (86)
                      .+=|..|++.+.+..||+++
T Consensus        52 ~~lL~~f~~~i~~~dPDvi~   71 (193)
T cd05784          52 KSLLLALIAWFAQYDPDIII   71 (193)
T ss_pred             HHHHHHHHHHHHhhCCCEEE
Confidence            34589999999999999886


No 270
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway. This group includes the type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway; their substrate specificities are not well characterized.
Probab=27.00  E-value=83  Score=23.04  Aligned_cols=21  Identities=19%  Similarity=0.251  Sum_probs=16.4

Q ss_pred             HHHHHHHhhCCCCEEEeeccc
Q psy149           29 EDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      ...+.++++.+||++++.++-
T Consensus       176 ~~~i~~l~~~~pd~v~~~~~~  196 (333)
T cd06359         176 SAELAQIRAAKPDAVFVFLPG  196 (333)
T ss_pred             HHHHHHHHhCCCCEEEEEccC
Confidence            447788889999999986544


No 271
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type. Members of this protein family are identified as the substrate-binding protein of a urea ABC transport system by similarity to a known urea transporter from Corynebacterium glutamicum, operon structure, proximity of its operons to urease (urea-utilization protein) operons, and by Partial Phylogenetic Profiling vs. urea utilization.
Probab=26.84  E-value=1.2e+02  Score=23.28  Aligned_cols=25  Identities=12%  Similarity=0.154  Sum_probs=19.3

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      -+...+.+++..+||+|++.+.--|
T Consensus       176 Df~~~l~~i~~~~pD~V~~~~~g~~  200 (374)
T TIGR03669       176 QFSSTIQNIQKADPDFVMSMLVGAN  200 (374)
T ss_pred             hHHHHHHHHHHcCCCEEEEcCcCCc
Confidence            4567788999999999998764433


No 272
>PF09822 ABC_transp_aux:  ABC-type uncharacterized transport system;  InterPro: IPR019196  This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins. 
Probab=26.65  E-value=1.7e+02  Score=21.37  Aligned_cols=40  Identities=33%  Similarity=0.443  Sum_probs=27.8

Q ss_pred             CceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccc
Q psy149            6 RSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus         6 ~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      ....++|-+||-+.   ++-+-+..|-+++.+- =.++++++|+
T Consensus       196 ~~~d~Lvi~~P~~~---ls~~e~~~l~~yl~~G-G~ll~~~d~~  235 (271)
T PF09822_consen  196 DDADVLVIAGPKTD---LSEEELYALDQYLMNG-GKLLILLDPF  235 (271)
T ss_pred             CCCCEEEEECCCCC---CCHHHHHHHHHHHHcC-CeEEEEECCc
Confidence            45688999999772   3334555555666543 3799999999


No 273
>PRK02842 light-independent protochlorophyllide reductase subunit N; Provisional
Probab=26.61  E-value=86  Score=24.89  Aligned_cols=31  Identities=23%  Similarity=0.404  Sum_probs=23.1

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccCCCCccccCC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNG   60 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g   60 (86)
                      -+.++.+.+++.+||++| -|+  +...|+++-|
T Consensus       348 D~~~l~~~i~~~~pDlli-g~~--~~~~pl~r~G  378 (427)
T PRK02842        348 DVERQLDRIRALRPDLVV-CGL--GLANPLEAEG  378 (427)
T ss_pred             CHHHHHHHHHHcCCCEEE-ccC--ccCCchhhcC
Confidence            467778899999999887 444  5566777765


No 274
>PF03104 DNA_pol_B_exo1:  DNA polymerase family B, exonuclease domain Several related DNA polymerases were too dissimilar to be included.;  InterPro: IPR006133 DNA is the biological information that instructs cells how to exist in an ordered fashion: accurate replication is thus one of the most important events in the life cycle of a cell. This function is performed by DNA- directed DNA-polymerases 2.7.7.7 from EC) by adding nucleotide triphosphate (dNTP) residues to the 5'-end of the growing chain of DNA, using a complementary DNA chain as a template. Small RNA molecules are generally used as primers for chain elongation, although terminal proteins may also be used for the de novo synthesis of a DNA chain. Even though there are 2 different methods of priming, these are mediated by 2 very similar polymerases classes, A and B, with similar methods of chain elongation. A number of DNA polymerases have been grouped under the designation of DNA polymerase family B. Six regions of similarity (numbered from I to VI) are found in all or a subset of the B family polymerases. The most conserved region (I) includes a conserved tetrapeptide with two aspartate residues. Its function is not yet known. However, it has been suggested that it may be involved in binding a magnesium ion. All sequences in the B family contain a characteristic DTDS motif, and possess many functional domains, including a 5'-3' elongation domain, a 3'-5' exonuclease domain [], a DNA binding domain, and binding domains for both dNTP's and pyrophosphate [].   This domain has 3' to 5' exonuclease activity and adopts a ribonuclease H type fold [].; GO: 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 1QHT_A 4AHC_A 3A2F_A 2JGU_A 4AIL_C 1NOY_A 1NOZ_B 3IAY_A 1WNS_A 3K5O_A ....
Probab=26.60  E-value=55  Score=23.91  Aligned_cols=21  Identities=19%  Similarity=0.474  Sum_probs=17.0

Q ss_pred             CCchHHHHHHHHhhCCCCEEE
Q psy149           24 SYKPLEDLIALTVQQEPDVLI   44 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlI   44 (86)
                      ..+=|..|++.+.+..||+++
T Consensus       222 E~~lL~~f~~~i~~~dPDii~  242 (325)
T PF03104_consen  222 EKELLEAFLDIIQEYDPDIIT  242 (325)
T ss_dssp             HHHHHHHHHHHHHHHS-SEEE
T ss_pred             HHHHHHHHHHHHHhcCCcEEE
Confidence            346688999999999999987


No 275
>COG5012 Predicted cobalamin binding protein [General function prediction only]
Probab=26.57  E-value=54  Score=24.94  Aligned_cols=20  Identities=20%  Similarity=0.569  Sum_probs=17.7

Q ss_pred             chHHHHHHHHhhCCCCEEEe
Q psy149           26 KPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL   45 (86)
                      -|.++|++.+++.|||++-+
T Consensus       142 vP~e~fve~a~e~k~d~v~~  161 (227)
T COG5012         142 VPVEEFVEKAKELKPDLVSM  161 (227)
T ss_pred             CCHHHHHHHHHHcCCcEEec
Confidence            48999999999999998865


No 276
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related. Members of this uncharacterized family share a motif approximating DXH(X25)GDXXD(X25)GNHD as found in several phosphoesterases, including the nucleases SbcD and Mre11. SbcD is a subunit of the SbcCD nuclease of E. coli that can cleave DNA hairpins to unblock stalled DNA replication. All members of this family are archaeal.
Probab=26.54  E-value=74  Score=23.32  Aligned_cols=25  Identities=20%  Similarity=0.296  Sum_probs=17.9

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      -|+.+.+.+.+.+||.+|+.|=..+
T Consensus        46 ~l~rl~~li~~~~~d~vIi~GDl~h   70 (225)
T TIGR00024        46 IIERALSIADKYGIEALIINGDLKH   70 (225)
T ss_pred             HHHHHHHHHhhcCCCEEEEcCcccc
Confidence            3555566667788999999994443


No 277
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain. SoxB (sulfur oxidation protein B) is a periplasmic thiosulfohydrolase and an essential component of the sulfur oxidation pathway in archaea and bacteria.  SoxB has a dinuclear manganese cluster and is thought to catalyze the release of sulfate from a protein-bound cysteine S-thiosulfonate.  SoxB is expressed from the sox (sulfur oxidation) gene cluster, which encodes 15 other sox genes, and has two domains, an N-terminal metallophosphatase domain and a C-terminal 5'-nucleotidase domain.  SoxB binds the SoxYZ complex and is thought to function as a sulfate-thiohydrolase.  SoxB is closely related to the UshA, YchR, and CpdB proteins, all of which have the same two-domain architecture.  The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzy
Probab=26.21  E-value=81  Score=23.06  Aligned_cols=32  Identities=22%  Similarity=0.316  Sum_probs=26.1

Q ss_pred             CCCCchHHHHHHHHhhC-CCCEEEe-eccccCCC
Q psy149           22 TLSYKPLEDLIALTVQQ-EPDVLIL-IGPLLDTS   53 (86)
Q Consensus        22 ~l~y~pL~~ll~~v~~~-~PdvlIL-~GPFiD~~   53 (86)
                      .-.|..+..+++.+++. .||+|++ .|=+++.+
T Consensus        32 ~gG~~r~~~~v~~~~~~~~~~~l~l~~GD~~~gs   65 (264)
T cd07411          32 AGGFAHIATLIKRIRAERNPNTLLLDGGDTWQGS   65 (264)
T ss_pred             cCcHHHHHHHHHHHHHhcCCCeEEEeCCCccCCC
Confidence            34688999999999998 9998866 78777665


No 278
>TIGR00758 UDG_fam4 uracil-DNA glycosylase, family 4. This well-conserved family of proteins is about 200 residues in length and homologous to the N-terminus of the DNA polymerase of phage SPO1 of Bacillus subtilis. The member from Thermus thermophilus HB8 is known to act as uracil-DNA glycosylase, an enzyme of DNA base excision repair. Its appearance as a domain of phage DNA polymerases could be consistent with uracil-DNA glycosylase activity.
Probab=26.10  E-value=71  Score=22.22  Aligned_cols=18  Identities=28%  Similarity=0.460  Sum_probs=14.4

Q ss_pred             HHHHHhhCCCCEEEeecc
Q psy149           31 LIALTVQQEPDVLILIGP   48 (86)
Q Consensus        31 ll~~v~~~~PdvlIL~GP   48 (86)
                      |.+.+...+|.++|++|-
T Consensus        92 l~~eI~~v~P~~Iv~lG~  109 (173)
T TIGR00758        92 LVKQIELIRPKVIICLGR  109 (173)
T ss_pred             HHHHHHhcCCCEEEEECH
Confidence            345566689999999998


No 279
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins. Periplasmic solute-binding domain of active transport proteins found in bacteria and Archaea. Members of this group are initial receptors in the process of active transport across cellular membrane, but their substrate specificities are not known in detail. However, they closely resemble the group of AmiC and active transport systems for short-chain amides and urea (FmdDEF), and thus are likely to exhibit a ligand-binding mode similar to that of the amide sensor protein AmiC from Pseudomonas aeruginosa. Moreover, this binding domain has high sequence identity to the family of hydrophobic amino acid transporters (HAAT), and thus it may also be involved in transport of amino acids.
Probab=26.10  E-value=1.1e+02  Score=22.50  Aligned_cols=22  Identities=18%  Similarity=0.258  Sum_probs=16.9

Q ss_pred             CCCchHHHHHHHHhhCCCCEEEeec
Q psy149           23 LSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      -+|++   ++.++++.+||+|++.+
T Consensus       188 ~d~~~---~i~~l~~~~~d~v~~~~  209 (342)
T cd06329         188 KDFSP---YVAKIKASGADTVITGN  209 (342)
T ss_pred             CchHH---HHHHHHHcCCCEEEEcc
Confidence            45555   47788899999999876


No 280
>PRK13197 pyrrolidone-carboxylate peptidase; Provisional
Probab=25.90  E-value=79  Score=23.15  Aligned_cols=25  Identities=20%  Similarity=0.440  Sum_probs=16.8

Q ss_pred             CCchHHHHH-HHHhhCCCCEEEeecc
Q psy149           24 SYKPLEDLI-ALTVQQEPDVLILIGP   48 (86)
Q Consensus        24 ~y~pL~~ll-~~v~~~~PdvlIL~GP   48 (86)
                      +|+...+.+ +.+.+.+||++|.+|=
T Consensus        45 ~y~~~~~~l~~~l~~~~Pd~vih~G~   70 (215)
T PRK13197         45 VFGKSAEVLKEAIEEVQPDAVICIGQ   70 (215)
T ss_pred             ChHHHHHHHHHHHHHhCCCEEEEecc
Confidence            454444444 4445679999999994


No 281
>PF05125 Phage_cap_P2:  Phage major capsid protein, P2 family ;  InterPro: IPR006441 This entry is represented by Bacteriophage P2, GpN. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family represents the major capsid protein component of the heads (capsids) of bacteriophage P2 and related phage including prophage. These sequences represent one of several analogous families lacking detectable sequence similarity. The gene encoding this component is typically located in an operon encoding the small and large terminase subunits, the portal protein and the prohead or maturation protease. ; GO: 0019028 viral capsid
Probab=25.81  E-value=19  Score=28.72  Aligned_cols=37  Identities=30%  Similarity=0.581  Sum_probs=23.1

Q ss_pred             CCCchHHHHHHHH--------hhCCCCEEEeecc--ccCCCCccccC
Q psy149           23 LSYKPLEDLIALT--------VQQEPDVLILIGP--LLDTSHPLLLN   59 (86)
Q Consensus        23 l~y~pL~~ll~~v--------~~~~PdvlIL~GP--FiD~~h~~i~~   59 (86)
                      =+|.-|+.|+.-+        -++.||+|+++|=  .-|...|++..
T Consensus       196 gdY~nLDalV~D~~~~lId~~~~~d~dLVvivGrdLladk~~~l~n~  242 (333)
T PF05125_consen  196 GDYKNLDALVFDAVNSLIDPWHRDDPDLVVIVGRDLLADKYFPLINA  242 (333)
T ss_pred             CccCCHHHHHHHHHHccCCHHHcCCCCEEEEEChhHHhhhhhhhhcc
Confidence            3555666555433        3479999999994  33555566554


No 282
>TIGR00639 PurN phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent. In phylogenetic analyses, the member from Saccharomyces cerevisiae shows a long branch length but membership in the family, while the formyltetrahydrofolate deformylases form a closely related outgroup.
Probab=25.81  E-value=80  Score=22.60  Aligned_cols=19  Identities=26%  Similarity=0.459  Sum_probs=16.3

Q ss_pred             HHHHHHHhhCCCCEEEeec
Q psy149           29 EDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~G   47 (86)
                      .++.+.+++.+||++++.|
T Consensus        69 ~~~~~~l~~~~~D~iv~~~   87 (190)
T TIGR00639        69 QAIIEELRAHEVDLVVLAG   87 (190)
T ss_pred             HHHHHHHHhcCCCEEEEeC
Confidence            3678888899999999987


No 283
>cd00636 TroA-like Helical backbone metal receptor (TroA-like domain). These proteins have been shown to function in the ABC transport of ferric siderophores and metal ions such as Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is formed in the interface between two globular domains linked by a single helix.  Many of these proteins also possess a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).  The TroA-like proteins differ in their fold and ligand-binding mechanism from the PBPI and PBPII proteins, but are structurally similar, however, to the beta-subunit of the nitrogenase molybdenum-iron protein MoFe.   Most TroA-like proteins are encoded by ABC-type operons and appear to function as periplasmic components of ABC transporters in metal ion uptake.
Probab=25.77  E-value=70  Score=19.41  Aligned_cols=14  Identities=29%  Similarity=0.484  Sum_probs=9.9

Q ss_pred             HHhhCCCCEEEeec
Q psy149           34 LTVQQEPDVLILIG   47 (86)
Q Consensus        34 ~v~~~~PdvlIL~G   47 (86)
                      .+.+.+||++|..|
T Consensus        56 ~l~~l~pDlvi~~~   69 (148)
T cd00636          56 KIAALKPDLIIANG   69 (148)
T ss_pred             HHhccCCCEEEEec
Confidence            33444999998876


No 284
>PLN02605 monogalactosyldiacylglycerol synthase
Probab=25.62  E-value=87  Score=23.83  Aligned_cols=22  Identities=18%  Similarity=0.552  Sum_probs=17.1

Q ss_pred             HHHHHHhhCCCCEEEeeccccC
Q psy149           30 DLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        30 ~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      .+.+.+++.+||++|-.-||..
T Consensus        91 ~l~~~i~~~~pDvIi~thp~~~  112 (382)
T PLN02605         91 EVAKGLMKYKPDIIVSVHPLMQ  112 (382)
T ss_pred             HHHHHHHhcCcCEEEEeCcCcc
Confidence            3456777899999999888744


No 285
>TIGR03446 mycothiol_Mca mycothiol conjugate amidase Mca. Mycobacterium tuberculosis, Corynebacterium glutamicum, and related species use the thiol mycothiol in place of glutathione. This enzyme, homologous to the (dispensible) MshB enzyme of mycothiol biosynthesis, is described as an amidase that acts on conjugates to mycothiol. It is a detoxification enzyme.
Probab=25.50  E-value=95  Score=23.78  Aligned_cols=28  Identities=21%  Similarity=0.274  Sum_probs=19.2

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCCCCc
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDTSHP   55 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~~h~   55 (86)
                      ...|.+.+++.+||+||-..|.--..||
T Consensus       110 ~~~L~~iIr~~~PdvVvT~d~~GgygHp  137 (283)
T TIGR03446       110 AEPLVRVIREFRPHVITTYDENGGYPHP  137 (283)
T ss_pred             HHHHHHHHHHcCCEEEEecCCCCCCCCh
Confidence            3556677778999999987665333343


No 286
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Probab=25.43  E-value=95  Score=20.61  Aligned_cols=25  Identities=16%  Similarity=0.223  Sum_probs=17.3

Q ss_pred             hHHHHHHHHhhCCCCE-EEeeccccC
Q psy149           27 PLEDLIALTVQQEPDV-LILIGPLLD   51 (86)
Q Consensus        27 pL~~ll~~v~~~~Pdv-lIL~GPFiD   51 (86)
                      -+..|++++++..|++ ++++.|++.
T Consensus        82 ~~~~li~~i~~~~p~~~i~~~~~~~~  107 (169)
T cd01831          82 AYVEFIEELRKRYPDAPIVLMLGPML  107 (169)
T ss_pred             HHHHHHHHHHHHCCCCeEEEEecCcc
Confidence            6888899999988884 334444443


No 287
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain. CapA is one of three membrane-associated enzymes in Bacillus anthracis that is required for synthesis of gamma-polyglutamic acid (PGA), a major component of the bacterial capsule.  The YwtB and PgsA proteins of Bacillus subtilis are closely related to CapA and are also included in this alignment model.  CapA belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal
Probab=25.36  E-value=1.8e+02  Score=20.77  Aligned_cols=42  Identities=12%  Similarity=0.109  Sum_probs=24.0

Q ss_pred             CCCceeEEEEeCCCCCCCC-----------CCCchHHHHHHHHhhCCCCEEEee
Q psy149            4 TRRSLSMFVSAGPYTQSDT-----------LSYKPLEDLIALTVQQEPDVLILI   46 (86)
Q Consensus         4 ~~~~l~i~vAaGPfT~~d~-----------l~y~pL~~ll~~v~~~~PdvlIL~   46 (86)
                      +|..+-++-.+.+.+....           .+.+-+.+.++++++. +|++|++
T Consensus       129 ~g~kVg~ig~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~lr~~-~D~vIv~  181 (239)
T cd07381         129 NGIKVAFLAYTYGTNGIPLAAGARPGGVNPLDLERIAADIAEAKKK-ADIVIVS  181 (239)
T ss_pred             CCEEEEEEEEECCCCCCcCcccCCccccCccCHHHHHHHHHHHhhc-CCEEEEE
Confidence            4555666666666654321           1123455556666554 9998885


No 288
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs). Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs). The metabotropic glutamate receptors (mGluR) are key receptors in the modulation of excitatory synaptic transmission in the central nervous system. The mGluRs are coupled to G proteins and are thus distinct from the iGluRs which internally contain ligand-gated ion channels. The mGluR structure is divided into three regions: the extracellular region, the seven-spanning transmembrane region and the cytoplasmic region. The extr
Probab=25.28  E-value=85  Score=22.84  Aligned_cols=25  Identities=12%  Similarity=0.259  Sum_probs=20.5

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      -+...+++++..+||++|+.+.--|
T Consensus       205 d~~~~l~~l~~~~~~vvv~~~~~~~  229 (348)
T cd06350         205 DIKRILKKLKSSTARVIVVFGDEDD  229 (348)
T ss_pred             HHHHHHHHHHhCCCcEEEEEeCcHH
Confidence            4678889999999999999886533


No 289
>PLN02747 N-carbamolyputrescine amidase
Probab=25.27  E-value=92  Score=22.91  Aligned_cols=42  Identities=19%  Similarity=0.322  Sum_probs=26.3

Q ss_pred             CCcCCCceeEEEEeCCCCCCCC--CCCchHHHHHHHHhhCCCCEEEe
Q psy149            1 MTLTRRSLSMFVSAGPYTQSDT--LSYKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus         1 ~~l~~~~l~i~vAaGPfT~~d~--l~y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      |+|+. .++  ||+-.+....+  -+.+...++++++.+..+|++++
T Consensus         1 ~~~~~-~~~--va~~Q~~~~~d~~~N~~~i~~~i~~A~~~gadlvvf   44 (296)
T PLN02747          1 MGMGR-KVV--VAALQFACSDDRAANVDKAERLVREAHAKGANIILI   44 (296)
T ss_pred             CCCCc-ceE--EEEEEecCCCCHHHHHHHHHHHHHHHHHCCCcEEEc
Confidence            45553 454  44444433222  33457788888888899999985


No 290
>cd05160 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain of family-B DNA polymerases. The 3'-5' exonuclease domain of family-B DNA polymerases. This domain has a fundamental role in reducing polymerase errors and is involved in proofreading activity. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. This domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The exonuclease domain of family B polymerase also contains a beta hairpin structure that plays an important role in active site switching in the event of nucleotide misincorporation. Members include Escherichia coli DNA polymerase II, some eubacterial phage DNA polymerases, nuclear replicative
Probab=25.20  E-value=77  Score=21.83  Aligned_cols=21  Identities=19%  Similarity=0.346  Sum_probs=17.1

Q ss_pred             CchHHHHHHHHhhCCCCEEEe
Q psy149           25 YKPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .+-|..|++.+.+..||+++=
T Consensus        64 ~~lL~~f~~~i~~~dpdiivg   84 (199)
T cd05160          64 KELLKRFFDIIREYDPDILTG   84 (199)
T ss_pred             HHHHHHHHHHHHhcCCCEEEE
Confidence            345889999999999999763


No 291
>cd05780 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease domain of Pyrococcus kodakaraensis Kod1 and similar archaeal family-B DNA polymerases. The 3'-5' exonuclease domain of archaeal family-B DNA polymerases with similarity to Pyrococcus kodakaraensis Kod1, including polymerases from Desulfurococcus (D. Tok Pol) and Thermococcus gorgonarius (Tgo Pol). Kod1, D. Tok Pol, and Tgo Pol are thermostable enzymes that exhibit both polymerase and 3'-5' exonuclease activities. They are family-B DNA polymerases. Their amino termini harbor a DEDDy-type DnaQ-like 3'-5' exonuclease domain that contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and are involved in metal binding and catalysis. The exonuclease domain of family B polymerases contains a beta hairpin structure that plays an important role in active site switching in the event of nucleotide misincorporation. Members of this subfamily show
Probab=25.12  E-value=77  Score=22.24  Aligned_cols=20  Identities=20%  Similarity=0.521  Sum_probs=16.8

Q ss_pred             CchHHHHHHHHhhCCCCEEE
Q psy149           25 YKPLEDLIALTVQQEPDVLI   44 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlI   44 (86)
                      .+=|..|++.+.+..||+++
T Consensus        57 ~~lL~~F~~~i~~~dpdiiv   76 (195)
T cd05780          57 KEMIKRFIEIVKEKDPDVIY   76 (195)
T ss_pred             HHHHHHHHHHHHHcCCCEEE
Confidence            35689999999999999876


No 292
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=24.98  E-value=2.1e+02  Score=18.78  Aligned_cols=25  Identities=28%  Similarity=0.509  Sum_probs=17.1

Q ss_pred             CchHHHHHHHHhhCCCC-EEEeeccc
Q psy149           25 YKPLEDLIALTVQQEPD-VLILIGPL   49 (86)
Q Consensus        25 y~pL~~ll~~v~~~~Pd-vlIL~GPF   49 (86)
                      .+-+..+++.+++..|. -+|++||.
T Consensus        80 ~~~~~~li~~i~~~~~~~~iv~~~~~  105 (189)
T cd01825          80 RQQLREFIKRLRQILPNASILLVGPP  105 (189)
T ss_pred             HHHHHHHHHHHHHHCCCCeEEEEcCC
Confidence            35678888888885444 46667875


No 293
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes. This group includes the type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes; their substrate specificities are not well characterized, however. Members also exhibit close similarity to active transport systems for short chain amides and/or urea found in bacteria and archaea.
Probab=24.97  E-value=96  Score=22.23  Aligned_cols=23  Identities=22%  Similarity=0.439  Sum_probs=17.4

Q ss_pred             CCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           23 LSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      .+|++   .++++++.+||++++.+.
T Consensus       173 ~d~~~---~i~~l~~~~~d~i~~~~~  195 (333)
T cd06332         173 LDFSA---ELAQIRAAKPDAVFVFLP  195 (333)
T ss_pred             cchHH---HHHHHHhcCCCEEEEecc
Confidence            34554   677888899999998765


No 294
>PF00102 Y_phosphatase:  Protein-tyrosine phosphatase;  InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity. Consequently, maintaining an appropriate level of protein tyrosine phosphorylation is essential for many cellular functions. Tyrosine-specific protein phosphatases (PTPase; 3.1.3.48 from EC) catalyse the removal of a phosphate group attached to a tyrosine residue, using a cysteinyl-phosphate enzyme intermediate. These enzymes are key regulatory components in signal transduction pathways (such as the MAP kinase pathway) and cell cycle control, and are important in the control of cell growth, proliferation, differentiation and transformation [, ]. The PTP superfamily can be divided into four subfamilies []:   (1) pTyr-specific phosphatases (2) dual specificity phosphatases (dTyr and dSer/dThr) (3) Cdc25 phosphatases (dTyr and/or dThr) (4) LMW (low molecular weight) phosphatases   Based on their cellular localisation, PTPases are also classified as:   Receptor-like, which are transmembrane receptors that contain PTPase domains [] Non-receptor (intracellular) PTPases []   All PTPases carry the highly conserved active site motif C(X)5R (PTP signature motif), employ a common catalytic mechanism, and share a similar core structure made of a central parallel beta-sheet with flanking alpha-helices containing a beta-loop-alpha-loop that encompasses the PTP signature motif []. Functional diversity between PTPases is endowed by regulatory domains and subunits.  This entry repesents several receptor and non-receptor protein-tyrosine phosphatases. Structurally, all known receptor PTPases, are made up of a variable length extracellular domain, followed by a transmembrane region and a C-terminal catalytic cytoplasmic domain. Some of the receptor PTPases contain fibronectin type III (FN-III) repeats, immunoglobulin-like domains, MAM domains or carbonic anhydrase-like domains in their extracellular region. The cytoplasmic region generally contains two copies of the PTPase domain. The first seems to have enzymatic activity, while the second is inactive. The inactive domains of tandem phosphatases can be divided into two classes. Those which bind phosphorylated tyrosine residues may recruit multi-phosphorylated substrates for the adjacent active domains and are more conserved, while the other class have accumulated several variable amino acid substitutions and have a complete loss of tyrosine binding capability. The second class shows a release of evolutionary constraint for the sites around the catalytic centre, which emphasises a difference in function from the first group. There is a region of higher conservation common to both classes, suggesting a new regulatory centre []. PTPase domains consist of about 300 amino acids. There are two conserved cysteines, the second one has been shown to be absolutely required for activity. Furthermore, a number of conserved residues in its immediate vicinity have also been shown to be important.; GO: 0004725 protein tyrosine phosphatase activity, 0006470 protein dephosphorylation; PDB: 3O4T_A 3O4S_A 3O4U_A 2A3K_A 2QDP_A 2QDC_A 2QDM_A 2HVL_A 1ZC0_A 3D44_A ....
Probab=24.78  E-value=2.3e+02  Score=19.32  Aligned_cols=40  Identities=13%  Similarity=0.356  Sum_probs=33.8

Q ss_pred             CceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCC
Q psy149            6 RSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus         6 ~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      ..-+.++|-+|-       .+-..+|-+.|-+.+..++|++.+..+.
T Consensus        40 ~~~~~I~~q~P~-------~~t~~~FW~mv~~~~~~~Iv~L~~~~e~   79 (235)
T PF00102_consen   40 NGKKFIVTQAPM-------PDTIEDFWQMVWEQKVQIIVMLCSFDES   79 (235)
T ss_dssp             STEEEEEEES-S-------GGGHHHHHHHHHHTTBSEEEEESBSEET
T ss_pred             chhhheeecccc-------cccccceehheeeccccceecccccccc
Confidence            467889999993       3578999999999999999999999885


No 295
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor. The ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptor serves critical functions in neuronal development, functioning, and degeneration in the mammalian central nervous system. The functional NMDA receptor is a heterotetramer ccomposed of two NR1 and two NR2 (A, B, C, and D) or of NR3 (A and B) subunits.  The receptor controls a cation channel that is highly permeable to monovalent ions and calcium and exhibits voltage-dependent inhibition by magnesium. Dual agonists, glutamate and glycine, are required for efficient activation of the NMDA receptor.  When co-expressed with NR1, the NR3 subunits form receptors that are activated by glycine alone and therefore 
Probab=24.72  E-value=86  Score=23.59  Aligned_cols=26  Identities=15%  Similarity=0.190  Sum_probs=20.5

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccCC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      -+...++++++.+|+++|+.|..-++
T Consensus       201 d~~~~l~~ik~~~~~vIvl~~~~~~~  226 (377)
T cd06379         201 NVTSLLQEAKELTSRVILLSASEDDA  226 (377)
T ss_pred             hHHHHHHHHhhcCCeEEEEEcCHHHH
Confidence            45677888999999999998875443


No 296
>TIGR01957 nuoB_fam NADH-quinone oxidoreductase, B subunit. This model describes the B chain of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoB. The quinone is plastoquinone in Synechocystis (where the chain is designated K) and in chloroplast, where NADH may be replaced by NADPH. In the methanogenic archaeal genus Methanosarcina, NADH is replaced by F420H2.
Probab=24.58  E-value=1.4e+02  Score=20.95  Aligned_cols=36  Identities=22%  Similarity=0.335  Sum_probs=25.4

Q ss_pred             CCceeEEEEeCCCCCCCCCCCchHHHHHHHHhh--CCCCEEEeec
Q psy149            5 RRSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQ--QEPDVLILIG   47 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~--~~PdvlIL~G   47 (86)
                      .+..-|++-+||-|...       .+-+.++.+  .+|..||-+|
T Consensus        55 Pr~aDvllVtG~vt~~~-------~~~l~~~~e~~p~pk~VIA~G   92 (145)
T TIGR01957        55 PRQADVMIVAGTVTKKM-------APALRRLYDQMPEPKWVISMG   92 (145)
T ss_pred             CCcceEEEEecCCcHHH-------HHHHHHHHHhccCCceEEEec
Confidence            35577999999999873       444555554  4788888775


No 297
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed
Probab=24.58  E-value=1e+02  Score=23.03  Aligned_cols=34  Identities=6%  Similarity=0.152  Sum_probs=21.6

Q ss_pred             EEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccC
Q psy149           10 MFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        10 i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      |++||||++.+.        ++++.+.......+++=+=+.+
T Consensus        15 v~~aag~~~~~~--------~~~~~~~~~g~g~v~~kti~~~   48 (301)
T PRK07259         15 VMPASGTFGFGG--------EYARFYDLNGLGAIVTKSTTLE   48 (301)
T ss_pred             cEECCcCCCCCH--------HHHHHhhhcCCcEEEeCCCCCC
Confidence            699999998662        5555555555666655443333


No 298
>COG1058 CinA Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA [General function prediction only]
Probab=24.28  E-value=1.8e+02  Score=22.30  Aligned_cols=37  Identities=19%  Similarity=0.405  Sum_probs=21.8

Q ss_pred             HHHHHHHhh--CCCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHHHHhh
Q psy149           29 EDLIALTVQ--QEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDSIV   78 (86)
Q Consensus        29 ~~ll~~v~~--~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~i~   78 (86)
                      .++.+.++.  .++|+||+.|             -+.-|.||+-.+.+++.+
T Consensus        48 ~~I~~~l~~a~~r~D~vI~tG-------------GLGPT~DDiT~e~vAka~   86 (255)
T COG1058          48 DRIVEALREASERADVVITTG-------------GLGPTHDDLTAEAVAKAL   86 (255)
T ss_pred             HHHHHHHHHHHhCCCEEEECC-------------CcCCCccHhHHHHHHHHh
Confidence            444444443  4499999965             355566666555555433


No 299
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm). Glutamate mutase catalysis the conversion of (S)-glutamate with (2S,3S)-3-methylaspartate. The rearrangement reaction is initiated by the extraction of a hydrogen from the protein-bound substrate by a 5'-desoxyadenosyl radical, which is generated by the homolytic cleavage of the organometallic bond of the cofactor B12. Glm is a heterotetrameric molecule consisting of two alpha and two epsilon polypeptide chains.
Probab=24.20  E-value=95  Score=21.26  Aligned_cols=20  Identities=20%  Similarity=0.625  Sum_probs=17.7

Q ss_pred             chHHHHHHHHhhCCCCEEEe
Q psy149           26 KPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .|..++++.+.+++||++-|
T Consensus        37 v~~e~~v~aa~~~~adiVgl   56 (128)
T cd02072          37 SPQEEFIDAAIETDADAILV   56 (128)
T ss_pred             CCHHHHHHHHHHcCCCEEEE
Confidence            57899999999999998877


No 300
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain.  DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively. DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass its homodimeric interface twice. Two of
Probab=24.16  E-value=1e+02  Score=22.59  Aligned_cols=11  Identities=36%  Similarity=0.582  Sum_probs=9.3

Q ss_pred             EEEEeCCCCCC
Q psy149           10 MFVSAGPYTQS   20 (86)
Q Consensus        10 i~vAaGPfT~~   20 (86)
                      |++||||.|.+
T Consensus        12 v~~aag~~~~~   22 (289)
T cd02810          12 FGVAAGPLLKT   22 (289)
T ss_pred             CEeCCCCCCCC
Confidence            79999999754


No 301
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain. MS158 is an uncharacterized Microscilla protein with a metallophosphatase domain.  Microscilla proteins MS152, and MS153 are also included in this family.  The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is t
Probab=24.16  E-value=40  Score=22.47  Aligned_cols=21  Identities=19%  Similarity=0.434  Sum_probs=16.5

Q ss_pred             HHHhhCCCCEEEeeccccCCC
Q psy149           33 ALTVQQEPDVLILIGPLLDTS   53 (86)
Q Consensus        33 ~~v~~~~PdvlIL~GPFiD~~   53 (86)
                      +.+++.+||+||+.|=+.+..
T Consensus        20 ~~~~~~~~d~li~~GDi~~~~   40 (166)
T cd07404          20 NFPIAPDADILVLAGDIGYLT   40 (166)
T ss_pred             ccCCCCCCCEEEECCCCCCCc
Confidence            455678999999999887654


No 302
>PF02807 ATP-gua_PtransN:  ATP:guanido phosphotransferase, N-terminal domain;  InterPro: IPR022413 This entry represents the N-terminal domain of ATP:guanido phosphotransferase, which has an all-alpha fold consisting of an irregular array of 6 short helices []. ATP:guanido phosphotransferases are a family of structurally and functionally related enzymes [, ] that reversibly catalyse the transfer of phosphate between ATP and various phosphogens. The enzymes belonging to this family include:   Glycocyamine kinase (2.7.3.1 from EC), which catalyses the transfer of phosphate from ATP to guanidoacetate. Arginine kinase (2.7.3.3 from EC), which catalyses the transfer of phosphate from ATP to arginine. Taurocyamine kinase (2.7.3.4 from EC), an annelid-specific enzyme that catalyses the transfer of phosphate from ATP to taurocyamine. Lombricine kinase (2.7.3.5 from EC), an annelid-specific enzyme that catalyses the transfer of phosphate from ATP to lombricine. Smc74, a cercaria-specific enzyme from Schistosoma mansoni []. Creatine kinase (2.7.3.2 from EC) (CK) [, ], which catalyses the reversible transfer of high energy phosphate from ATP to creatine, generating phosphocreatine and ADP.    Creatine kinase plays an important role in energy metabolism of vertebrates. There are at least four different, but very closely related, forms of CK. Two isozymes, M (muscle) and B (brain), are cytosolic, while the other two are mitochondrial. In sea urchins there is a flagellar isozyme, which consists of the triplication of a CK-domain. A cysteine residue is implicated in the catalytic activity of these enzymes and the region around this active site residue is highly conserved.; GO: 0016301 kinase activity, 0016772 transferase activity, transferring phosphorus-containing groups; PDB: 1U6R_B 2CRK_A 2J1Q_A 1QH4_C 1QK1_F 2GL6_F 3L2F_M 3L2D_D 3L2G_B 3L2E_B ....
Probab=24.12  E-value=91  Score=19.62  Aligned_cols=26  Identities=15%  Similarity=0.474  Sum_probs=14.8

Q ss_pred             CccccCCCcCCCHHHHHHHHHHHhhccc
Q psy149           54 HPLLLNGSLAETFEDFYVKLIDSIVQPL   81 (86)
Q Consensus        54 h~~i~~g~~~~t~eelF~~~i~~i~~~~   81 (86)
                      .--+..|+ .++|+ +|+.+..+|++.-
T Consensus        47 ~vG~~AgD-~esY~-vF~~lfdpvI~dy   72 (76)
T PF02807_consen   47 GVGIYAGD-EESYD-VFKELFDPVIEDY   72 (76)
T ss_dssp             BS----SS-TTHHH-HTHHHHHHHHHHH
T ss_pred             ccceeecC-hhHHH-HHHHHHHHHHHHH
Confidence            33345554 66665 7888888887753


No 303
>PF13483 Lactamase_B_3:  Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A.
Probab=24.03  E-value=1.7e+02  Score=19.34  Aligned_cols=17  Identities=24%  Similarity=0.423  Sum_probs=9.6

Q ss_pred             HHHHHHHHhhCCCCEEE
Q psy149           28 LEDLIALTVQQEPDVLI   44 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlI   44 (86)
                      ..+.++.++..+|.++|
T Consensus       144 ~~~a~~~~~~l~pk~vi  160 (163)
T PF13483_consen  144 PEEAAELAERLKPKLVI  160 (163)
T ss_dssp             HHHHHHHHHHCT-SEEE
T ss_pred             HHHHHHHHHHcCCCEEE
Confidence            45556666666666665


No 304
>TIGR03010 sulf_tusC_dsrF sulfur relay protein TusC/DsrF. The three proteins TusB, TusC, and TusD form a heterohexamer responsible for a sulfur relay reaction. In large numbers of proteobacterial species, this complex acts on a Cys-derived persulfide moiety, delivered by the cysteine desulfurase IscS to TusA, then to TusBCD. The activated sulfur group is then transferred to TusE (DsrC), then by MnmA (TrmU) for modification of an anticodon nucleotide in tRNAs for Glu, Lys, and Gln. The sulfur relay complex TusBCD is also found, under the designation DsrEFH, in phototrophic and chemotrophic sulfur bacteria, such as Chromatium vinosum. In these organisms, it seems the primary purpose is related to sulfur flux, such as oxidation from sulfide to molecular sulfur to sulfate.
Probab=23.97  E-value=1.5e+02  Score=19.11  Aligned_cols=41  Identities=17%  Similarity=0.199  Sum_probs=28.0

Q ss_pred             eeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeecccc
Q psy149            8 LSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus         8 l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      +-+++-++||.+.  -.|+.|+-.+....-.+.=.|+++|-=+
T Consensus         2 il~i~~~~Pyg~~--~~~e~l~~al~~aa~~~eV~vff~~DGV   42 (116)
T TIGR03010         2 LAFVFRQAPHGTA--SGREGLDALLAASAFDEDIGVFFIDDGV   42 (116)
T ss_pred             EEEEEcCCCCCcc--hHHHHHHHHHHHHhccCCeEEEEechHH
Confidence            4578899999654  5678887777655544443577777544


No 305
>PF14826 FACT-Spt16_Nlob:  FACT complex subunit SPT16 N-terminal lobe domain; PDB: 3BIQ_A 3BIT_A 3BIP_A 3CB6_A 3CB5_A.
Probab=23.83  E-value=2.4e+02  Score=19.74  Aligned_cols=38  Identities=16%  Similarity=0.333  Sum_probs=23.1

Q ss_pred             ceeEEEEeCCCCCCCCCCCchHHHHHHHHhh-CCCCEEEee
Q psy149            7 SLSMFVSAGPYTQSDTLSYKPLEDLIALTVQ-QEPDVLILI   46 (86)
Q Consensus         7 ~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~-~~PdvlIL~   46 (86)
                      .=.++|++|+  .+++..|.-=..|=...-- +=||.+|++
T Consensus        28 ~dal~i~~G~--~~e~~~Y~Ks~aLq~WLlGYEfpdTiiv~   66 (163)
T PF14826_consen   28 ADALVIAVGK--ADEDNPYSKSTALQTWLLGYEFPDTIIVF   66 (163)
T ss_dssp             -SEEEEEE-S----TTSTT-HHHHHHHHHHSS--SSEEEEE
T ss_pred             CCEEEEEeCC--cccCccchhHHHHHHHHhcccHhhhhhhh
Confidence            3468999999  7888888877766666655 778877754


No 306
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein  (LIVBP)-like domain of the ionotropic glutamate receptors. This CD represents the ligand-binding domain of the family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein  (LIVBP)-like domain of the ionotropic glutamate receptors, all of which are structurally similar and related to the periplasmic-binding fold type I family. The family C GPCRs consist of metabotropic glutamate receptor (mGluR) receptors, a calcium-sensing receptor (CaSR), gamma-aminobutyric receptors (GABAb), the promiscuous L-alpha-amino acid receptor GPR6A, families of taste and pheromone receptors, and orphan receptors. Truncated splicing va
Probab=23.77  E-value=1.4e+02  Score=20.36  Aligned_cols=23  Identities=9%  Similarity=0.251  Sum_probs=18.6

Q ss_pred             chHHHHHHHHhhCCCCEEEeecc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      .....+++.+++.+++++|+++.
T Consensus       182 ~~~~~~l~~l~~~~~~viv~~~~  204 (298)
T cd06269         182 EDIRRLLKELKSSTARVIVVFSS  204 (298)
T ss_pred             HHHHHHHHHHHhcCCcEEEEEec
Confidence            45778888888888899988765


No 307
>KOG2774|consensus
Probab=23.75  E-value=29  Score=27.55  Aligned_cols=33  Identities=33%  Similarity=0.573  Sum_probs=24.9

Q ss_pred             EEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEee
Q psy149           11 FVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILI   46 (86)
Q Consensus        11 ~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~   46 (86)
                      +.-+|||-..|-|||+-|.+++   .+.+-|-||=+
T Consensus        85 V~~~GPyIy~DILD~K~L~eIV---Vn~RIdWL~Hf  117 (366)
T KOG2774|consen   85 VTDVGPYIYLDILDQKSLEEIV---VNKRIDWLVHF  117 (366)
T ss_pred             hcccCCchhhhhhccccHHHhh---cccccceeeeH
Confidence            4568999999999999998764   44566666543


No 308
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=23.67  E-value=91  Score=22.78  Aligned_cols=23  Identities=26%  Similarity=0.329  Sum_probs=18.4

Q ss_pred             HHHHHHHHhhCCCCEEEeecccc
Q psy149           28 LEDLIALTVQQEPDVLILIGPLL   50 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFi   50 (86)
                      +...+.+++..+||++++.|-.-
T Consensus       179 ~~~~v~~l~~~~~d~v~~~~~~~  201 (340)
T cd06349         179 FRPTITRLRDANPDAIILISYYN  201 (340)
T ss_pred             HHHHHHHHHhcCCCEEEEccccc
Confidence            34578889999999999988543


No 309
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain. DR1281 is an uncharacterized Deinococcus radiodurans protein with a domain that belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.
Probab=23.59  E-value=1.9e+02  Score=21.80  Aligned_cols=42  Identities=10%  Similarity=0.246  Sum_probs=26.0

Q ss_pred             CCCceeEEEEeCCCCCCC-CCCCchHHHHHHHHhhCCCCEEEee
Q psy149            4 TRRSLSMFVSAGPYTQSD-TLSYKPLEDLIALTVQQEPDVLILI   46 (86)
Q Consensus         4 ~~~~l~i~vAaGPfT~~d-~l~y~pL~~ll~~v~~~~PdvlIL~   46 (86)
                      +|..+-|+=..|++.... +--|+-+++.++++++ ++|++|+.
T Consensus       105 ~G~kIaVigl~g~~~~~~~~~P~~~~~~~v~~lk~-~~D~IIV~  147 (255)
T cd07382         105 NGKKIAVINLMGRVFMPPLDNPFRAADELLEELKE-EADIIFVD  147 (255)
T ss_pred             CCEEEEEEEEecccCCCcCCCHHHHHHHHHHHHhc-CCCEEEEE
Confidence            455566666778876532 1124555666666666 79988874


No 310
>cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like. Iron-containing alcohol dehydrogenases (Fe-ADH). Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase-like fold and is a member of the iron-activated alcohol dehydrogenase-like family. They are distinct from other alcohol dehydrogenases which contains different protein domain. Proteins of this family have not been characterized. Their specific function is unknown. They are mainly found in bacteria.
Probab=23.56  E-value=1.1e+02  Score=23.62  Aligned_cols=26  Identities=27%  Similarity=0.281  Sum_probs=21.6

Q ss_pred             CCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           22 TLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        22 ~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      |-.++-+.+.++.+++.++|++|=+|
T Consensus        58 ~p~~~~v~~~~~~~~~~~~D~IIaiG   83 (374)
T cd08183          58 EPSVELVDAAVAEARNAGCDVVIAIG   83 (374)
T ss_pred             CcCHHHHHHHHHHHHhcCCCEEEEec
Confidence            55567788888888889999999887


No 311
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif in ribosomal proteins, NusG, Spt5p, KIN17 and T54.
Probab=23.45  E-value=73  Score=15.00  Aligned_cols=13  Identities=31%  Similarity=0.473  Sum_probs=8.9

Q ss_pred             eeEEEEeCCCCCC
Q psy149            8 LSMFVSAGPYTQS   20 (86)
Q Consensus         8 l~i~vAaGPfT~~   20 (86)
                      -.|.|..|||.-.
T Consensus         6 ~~V~I~~G~~~g~   18 (28)
T smart00739        6 DTVRVIAGPFKGK   18 (28)
T ss_pred             CEEEEeECCCCCc
Confidence            3577778888643


No 312
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain. YhcR is a Bacillus subtilis sugar-nonspecific endonuclease. It cleaves endonucleolytically to yield nucleotide 3'-monophosphate products, similar to Staphylococcus aureus micrococcal nuclease. YhcR appears to be located in the cell wall, and is thought to be a substrate for a Bacillus subtilis sortase. YhcR is the major calcium-activated nuclease of B. subtilis.  The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated wi
Probab=23.42  E-value=1.7e+02  Score=21.80  Aligned_cols=43  Identities=7%  Similarity=0.054  Sum_probs=24.5

Q ss_pred             CCCceeEEEEeCCCCCC-------CCCCCchHH----HHHHHHhhCCCCEEEee
Q psy149            4 TRRSLSMFVSAGPYTQS-------DTLSYKPLE----DLIALTVQQEPDVLILI   46 (86)
Q Consensus         4 ~~~~l~i~vAaGPfT~~-------d~l~y~pL~----~ll~~v~~~~PdvlIL~   46 (86)
                      +|..+-|+=.+.|.+..       ..+.|..-.    ..++++++.++|++|++
T Consensus       145 ~G~kIgviGl~~~~~~~~~~~~~~~g~~f~d~~e~~~~~v~~lr~~~~D~IIvL  198 (288)
T cd07412         145 GGVKVGFIGAVTKDTPNLVSPDGVAGLEFTDEVEAINAVAPELKAGGVDAIVVL  198 (288)
T ss_pred             CCEEEEEEeecCCCccceeccccccCceEcCHHHHHHHHHHHHHHCCCCEEEEE
Confidence            33344445555666543       245554433    34455566789999986


No 313
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=23.22  E-value=41  Score=21.62  Aligned_cols=62  Identities=19%  Similarity=0.345  Sum_probs=42.3

Q ss_pred             CCCCCCCCCchHHHHHHHHhhCCC--CEEEeeccccCCCC-ccccC--CC-------c---------CCCHHHHHHHHHH
Q psy149           17 YTQSDTLSYKPLEDLIALTVQQEP--DVLILIGPLLDTSH-PLLLN--GS-------L---------AETFEDFYVKLID   75 (86)
Q Consensus        17 fT~~d~l~y~pL~~ll~~v~~~~P--dvlIL~GPFiD~~h-~~i~~--g~-------~---------~~t~eelF~~~i~   75 (86)
                      |..++.-+|+-+..+++.+.+..+  =.+|++|=-.|... ..|..  +.       .         .....++|..++.
T Consensus        79 fd~~~~~S~~~~~~~~~~i~~~~~~~~~iivvg~K~D~~~~~~v~~~~~~~~~~~~~~~~~e~Sa~~~~~v~~~f~~~i~  158 (162)
T PF00071_consen   79 FDVTDEESFENLKKWLEEIQKYKPEDIPIIVVGNKSDLSDEREVSVEEAQEFAKELGVPYFEVSAKNGENVKEIFQELIR  158 (162)
T ss_dssp             EETTBHHHHHTHHHHHHHHHHHSTTTSEEEEEEETTTGGGGSSSCHHHHHHHHHHTTSEEEEEBTTTTTTHHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccccceeeeccccccccccchhhHHHHHHHHhCCEEEEEECCCCCCHHHHHHHHHH
Confidence            456666677888899999988666  37888898888665 22210  00       1         5677888888877


Q ss_pred             Hhh
Q psy149           76 SIV   78 (86)
Q Consensus        76 ~i~   78 (86)
                      .|+
T Consensus       159 ~i~  161 (162)
T PF00071_consen  159 KIL  161 (162)
T ss_dssp             HHH
T ss_pred             HHh
Confidence            765


No 314
>PF08846 DUF1816:  Domain of unknown function (DUF1816);  InterPro: IPR014945  Q4C9H3 from SWISSPROT is associated with the IPR008213 from INTERPRO domain suggesting this protein could have a role in phycobilisomes. 
Probab=22.98  E-value=50  Score=20.61  Aligned_cols=24  Identities=17%  Similarity=0.253  Sum_probs=19.0

Q ss_pred             HhhCCCCEEEeeccccCCCCcccc
Q psy149           35 TVQQEPDVLILIGPLLDTSHPLLL   58 (86)
Q Consensus        35 v~~~~PdvlIL~GPFiD~~h~~i~   58 (86)
                      |.+..|++.=-+|||+..+-....
T Consensus        14 I~T~~P~ctYyFGPF~s~~eA~~~   37 (68)
T PF08846_consen   14 IETQNPNCTYYFGPFDSREEAEAA   37 (68)
T ss_pred             EEcCCCCEEEEeCCcCCHHHHHHH
Confidence            567889999999999987764433


No 315
>COG0648 Nfo Endonuclease IV [DNA replication, recombination, and repair]
Probab=22.96  E-value=2.4e+02  Score=21.92  Aligned_cols=56  Identities=20%  Similarity=0.291  Sum_probs=40.7

Q ss_pred             EEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCcCCC--HHHHHHH
Q psy149           12 VSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSLAET--FEDFYVK   72 (86)
Q Consensus        12 vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t--~eelF~~   72 (86)
                      .--+|=++.---+|+-|.++++.+.+..     .+||-||.-|-.-+.+++..+  |++++++
T Consensus       141 e~~agegs~~g~~F~~L~eii~~~~~~~-----~igvCiDtcH~~Aagy~~~~~~~~~~vl~~  198 (280)
T COG0648         141 ENTAGEGSGKGTQFGELAEIIDLIEEKE-----RIGVCIDTCHAFAAGYDIITEEDFEKVLNE  198 (280)
T ss_pred             EEeccccCccccchhhHHHHHHhhcccC-----ceEEEEEchhhhhccCCcCcHHHHHHHHHH
Confidence            4445556666788999999999998754     378899999988776666443  5555543


No 316
>PRK08057 cobalt-precorrin-6x reductase; Reviewed
Probab=22.92  E-value=91  Score=23.36  Aligned_cols=22  Identities=32%  Similarity=0.569  Sum_probs=18.3

Q ss_pred             HHHHHHHhhCCCCEEEeeccccCCCCcc
Q psy149           29 EDLIALTVQQEPDVLILIGPLLDTSHPL   56 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~GPFiD~~h~~   56 (86)
                      .+|.+.+.+++.++|      ||++||.
T Consensus        55 ~~l~~~l~~~~i~~V------IDATHPf   76 (248)
T PRK08057         55 EGLAAYLREEGIDLV------IDATHPY   76 (248)
T ss_pred             HHHHHHHHHCCCCEE------EECCCcc
Confidence            567777789999997      5999986


No 317
>PF12327 FtsZ_C:  FtsZ family, C-terminal domain;  InterPro: IPR024757 The FtsZ family of proteins are involved in polymer formation. FtsZ is the polymer-forming protein of bacterial cell division. It is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ is a GTPase, like tubulin []. FtsZ can polymerise into tubes, sheets, and rings in vitro and is ubiquitous in eubacteria and archaea [].  This entry represents a domain of FtsZ. In most FtsZ proteins is found in the C terminus, except in some alphaproteobacteria proteins where there is an extension C-terminal domain TIGR03483 from TIGRFAMs.; PDB: 2RHO_B 2RHJ_A 2VXY_A 2RHL_B 2RHH_A 2VAM_A 1W5F_B 2R75_1 2R6R_1 1RQ7_A ....
Probab=22.84  E-value=55  Score=20.88  Aligned_cols=43  Identities=19%  Similarity=0.400  Sum_probs=31.5

Q ss_pred             ceeEEEEeCCCCCCCCCCCchHHHHHHHHhh-CCCCEEEeeccccCCCC
Q psy149            7 SLSMFVSAGPYTQSDTLSYKPLEDLIALTVQ-QEPDVLILIGPLLDTSH   54 (86)
Q Consensus         7 ~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~-~~PdvlIL~GPFiD~~h   54 (86)
                      .+-|-|++|     .++.++-..+.++.+++ ..+++-|.+|=-+|.+-
T Consensus        38 ~vLvni~~~-----~d~~l~ev~~~~~~i~~~~~~~a~ii~G~~id~~l   81 (95)
T PF12327_consen   38 GVLVNITGG-----PDLSLSEVNEAMEIIREKADPDANIIWGASIDEEL   81 (95)
T ss_dssp             EEEEEEEE------TTS-HHHHHHHHHHHHHHSSTTSEEEEEEEE-TTG
T ss_pred             eEEEEEEcC-----CCCCHHHHHHHHHHHHHHhhcCceEEEEEEECCCC
Confidence            444556665     46888899999999987 68999999998888653


No 318
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor. Ligand-binding domain of type B natriuretic peptide receptor (NPR-B). NPR-B is one of three known single membrane-spanning natriuretic peptide receptors that have been identified. Natriuretic peptides are family of structurally related but genetically distinct hormones/paracrine factors that regulate blood volume, blood pressure, ventricular hypertrophy, pulmonary hypertension, fat metabolism, and long bone growth. In mammals there are three natriuretic peptides: ANP, BNP, and CNP. Like NPR-A (or GC-A), NPR-B (or GC-B) is a transmembrane guanylyl cyclase, an enzyme that catalyzes the synthesis of cGMP. NPR-B is the predominant natriuretic peptide receptor in the brain. The rank of order activation of NPR-B by natriuretic peptides is CNPANPBNP. Homozygous inactivating mutations in human NPR-B cause a form of short-limbed dwarfism known as acromesomelic dysplasia type Maroteaux.
Probab=22.75  E-value=94  Score=23.68  Aligned_cols=22  Identities=23%  Similarity=0.519  Sum_probs=17.2

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccc
Q psy149           27 PLEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      .+...|.++++ +|+++|++|+.
T Consensus       191 d~~~~l~~ik~-~~~vIi~~~~~  212 (399)
T cd06384         191 DIIEIIQFIKQ-NGRIVYICGPL  212 (399)
T ss_pred             hHHHHHHHHhh-cccEEEEeCCc
Confidence            45677778876 89999988874


No 319
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=22.73  E-value=1e+02  Score=22.61  Aligned_cols=25  Identities=16%  Similarity=0.395  Sum_probs=19.3

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      +...+.++++.+||++|+.+.-=|.
T Consensus       181 ~~~~v~~i~~~~~d~vi~~~~~~~~  205 (344)
T cd06348         181 FQAQITAVLNSKPDLIVISALAADG  205 (344)
T ss_pred             HHHHHHHHHhcCCCEEEECCcchhH
Confidence            4566889999999999998754333


No 320
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain. Purple acid phosphatases (PAPs) belong to a diverse family of binuclear metallohydrolases that have been identified and characterized in plants, animals, and fungi.   PAPs contain a binuclear metal center and their characteristic pink or purple color derives from a charge-transfer transition between a tyrosine residue and a chromophoric ferric ion within the binuclear center.  PAPs catalyze the hydrolysis of a wide range of activated phosphoric acid mono- and di-esters and anhydrides.  PAPs are distinguished from the other phosphatases by their insensitivity to L-(+) tartrate inhibition and are therefore also known as tartrate resistant acid phosphatases (TRAPs).  While only a few copies of PAP-like genes are present in mammalian and fungal genomes, multiple copies are present in plant genomes.  PAPs belong to the metallophosphatase (MPP) superfamily.  MPPs are functionally diver
Probab=22.63  E-value=2.5e+02  Score=20.26  Aligned_cols=24  Identities=13%  Similarity=0.205  Sum_probs=18.7

Q ss_pred             HHHHHHHhh--CCCCEEEeeccccCC
Q psy149           29 EDLIALTVQ--QEPDVLILIGPLLDT   52 (86)
Q Consensus        29 ~~ll~~v~~--~~PdvlIL~GPFiD~   52 (86)
                      .+.++.+.+  .+||.+|+.|=+++.
T Consensus        21 ~~~~~~l~~~~~~~d~vl~~GDl~~~   46 (294)
T cd00839          21 TNTLDHLEKELGNYDAILHVGDLAYA   46 (294)
T ss_pred             HHHHHHHHhccCCccEEEEcCchhhh
Confidence            566777766  899999999977644


No 321
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT); however their ligand specificity has not been determined experimentally.
Probab=22.45  E-value=1e+02  Score=22.45  Aligned_cols=24  Identities=29%  Similarity=0.506  Sum_probs=19.3

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      +...++++++.+||++|+.+.--|
T Consensus       185 ~~~~v~~l~~~~~d~i~~~~~~~~  208 (345)
T cd06338         185 LSPLISKAKAAGPDAVVVAGHFPD  208 (345)
T ss_pred             hHHHHHHHHhcCCCEEEECCcchh
Confidence            556888899999999999886544


No 322
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase. This model represents 5-aminolevulinic acid synthase, an enzyme for one of two routes to the heme precursor 5-aminolevulinate. The protein is a pyridoxal phosphate-dependent enzyme related to 2-amino-3-ketobutyrate CoA tranferase and 8-amino-7-oxononanoate synthase. This enzyme appears restricted to the alpha Proteobacteria and mitochondrial derivatives.
Probab=22.43  E-value=2e+02  Score=21.91  Aligned_cols=30  Identities=13%  Similarity=0.311  Sum_probs=23.9

Q ss_pred             ceeEEEEeCCCCCCCCCCCchHHHHHHHHhhC
Q psy149            7 SLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQ   38 (86)
Q Consensus         7 ~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~   38 (86)
                      ..++++.++|+..+-+.  .|+.++.+.+++.
T Consensus       177 ~~~~v~~e~~~~~~G~~--~~l~~i~~l~~~~  206 (402)
T TIGR01821       177 RPKIIAFESVYSMDGDI--APIEEICDLADKY  206 (402)
T ss_pred             CCeEEEEcCCCCCCCCc--cCHHHHHHHHHHc
Confidence            46789999999887544  5799999888775


No 323
>TIGR00661 MJ1255 conserved hypothetical protein. This model represents nearly the full length of MJ1255 from Methanococcus jannaschii and of an unpublished protein from Vibrio cholerae, as well as the C-terminal half of a protein from Methanobacterium thermoautotrophicum. A small region (~50 amino acids) within the domain appears related to a family of sugar transferases.
Probab=22.43  E-value=94  Score=23.08  Aligned_cols=23  Identities=17%  Similarity=0.212  Sum_probs=18.0

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccc
Q psy149           27 PLEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      -+.+..+.+++.+||+||-.|.|
T Consensus        81 ~~~~~~~~l~~~~pDlVi~d~~~  103 (321)
T TIGR00661        81 AIRREINIIREYNPDLIISDFEY  103 (321)
T ss_pred             HHHHHHHHHHhcCCCEEEECCch
Confidence            44455677788999999998887


No 324
>PF13353 Fer4_12:  4Fe-4S single cluster domain; PDB: 3C8F_A 3CB8_A 3T7V_A 2YX0_A 3CAN_A.
Probab=22.42  E-value=80  Score=20.14  Aligned_cols=29  Identities=31%  Similarity=0.425  Sum_probs=22.1

Q ss_pred             CCCchHHHHHHHHhhCCCCEEEeec--cccC
Q psy149           23 LSYKPLEDLIALTVQQEPDVLILIG--PLLD   51 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~~PdvlIL~G--PFiD   51 (86)
                      ++-+-+.++++.+.+.+...+.+.|  |++.
T Consensus        36 ~~~~~~~~ii~~~~~~~~~~i~l~GGEPll~   66 (139)
T PF13353_consen   36 LSEEIIEEIIEELKNYGIKGIVLTGGEPLLH   66 (139)
T ss_dssp             C-HHHHHHHCHHHCCCCCCEEEEECSTGGGH
T ss_pred             ccchhhhhhhhHHhcCCceEEEEcCCCeeee
Confidence            3345667777888788889999999  9993


No 325
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally.
Probab=22.36  E-value=1e+02  Score=22.78  Aligned_cols=35  Identities=9%  Similarity=0.140  Sum_probs=23.4

Q ss_pred             EeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccC
Q psy149           13 SAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        13 AaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      +...|..+ .-+   +...++++++.+||++|+.|.--|
T Consensus       171 ~~~~~~~~-~~d---~s~~i~~i~~~~~d~v~~~~~~~~  205 (347)
T cd06335         171 AVEWFNWG-DKD---MTAQLLRAKAAGADAIIIVGNGPE  205 (347)
T ss_pred             EEeeecCC-Ccc---HHHHHHHHHhCCCCEEEEEecChH
Confidence            44555433 333   446788888999999999875433


No 326
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF). This group includes the periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF), found in Methylophilus methylotrophus, and its homologs from other bacteria. FmdD, a type I periplasmic binding protein, is induced by short-chain amides and urea and repressed by excess ammonia, while FmdE and FmdF are hydrophobic transmembrane proteins. FmdDEF is predicted to be an ATP-dependent transporter and closely resembles the periplasmic binding protein and the two transmembrane proteins present in various hydrophobic amino acid-binding transport systems.
Probab=22.29  E-value=1.1e+02  Score=22.87  Aligned_cols=24  Identities=17%  Similarity=0.181  Sum_probs=18.2

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      +...+++++..+||++++.+.--|
T Consensus       177 ~~~~v~~l~~~~pd~v~~~~~~~~  200 (348)
T cd06355         177 FQSIINKIKAAKPDVVVSTVNGDS  200 (348)
T ss_pred             HHHHHHHHHHhCCCEEEEeccCCc
Confidence            456778999999999998765433


No 327
>cd05779 DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon, a family-B DNA polymerase. The 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon. DNA polymerase epsilon is a family-B DNA polymerase with a catalytic subunit that contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain. It is one of the three DNA-dependent type B DNA polymerases (alpha and delta are the other two) that have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase epsilon plays a role in elongating the leading strand during DNA replication. It is also involved in DNA repair. The catalytic subunit contains both polymerase and 3'-5' exonuclease activities. The N-terminal exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and are involved in metal binding and catalysis. DNA polymerase epsilon also carries a unique
Probab=22.28  E-value=90  Score=22.59  Aligned_cols=22  Identities=9%  Similarity=0.209  Sum_probs=18.2

Q ss_pred             CCCchHHHHHHHHhhCCCCEEE
Q psy149           23 LSYKPLEDLIALTVQQEPDVLI   44 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~~PdvlI   44 (86)
                      -..+=|.+|++.+.+..||+++
T Consensus        72 ~E~~lL~~f~~~i~~~~Pd~i~   93 (204)
T cd05779          72 DEKALLQRFFEHIREVKPHIIV   93 (204)
T ss_pred             CHHHHHHHHHHHHHHhCCCEEE
Confidence            3456788999999999999976


No 328
>PF13528 Glyco_trans_1_3:  Glycosyl transferase family 1
Probab=22.27  E-value=92  Score=22.53  Aligned_cols=22  Identities=18%  Similarity=0.039  Sum_probs=15.6

Q ss_pred             HHHHHHHHhhCCCCEEEeeccc
Q psy149           28 LEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      +.++++.+++.+||+||-=..+
T Consensus        83 ~~~~~~~l~~~~pDlVIsD~~~  104 (318)
T PF13528_consen   83 IRREIRWLREFRPDLVISDFYP  104 (318)
T ss_pred             HHHHHHHHHhcCCCEEEEcChH
Confidence            3455666788999999975543


No 329
>PRK11756 exonuclease III; Provisional
Probab=22.26  E-value=1e+02  Score=22.29  Aligned_cols=21  Identities=29%  Similarity=0.347  Sum_probs=17.1

Q ss_pred             hHHHHHHHHhhCCCCEEEeec
Q psy149           27 PLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      .+..+.+.+++.+|||+.|--
T Consensus        14 ~~~~i~~~i~~~~pDIi~LQE   34 (268)
T PRK11756         14 RPHQLEAIIEKHQPDVIGLQE   34 (268)
T ss_pred             HHHHHHHHHHhcCCCEEEEEe
Confidence            456788888999999999853


No 330
>PF13458 Peripla_BP_6:  Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A ....
Probab=22.22  E-value=1.2e+02  Score=21.73  Aligned_cols=24  Identities=25%  Similarity=0.421  Sum_probs=18.7

Q ss_pred             chHHHHHHHHhhCCCCEEEeeccc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      .-+..+++++++.+||++++.+.-
T Consensus       177 ~d~~~~~~~l~~~~~d~v~~~~~~  200 (343)
T PF13458_consen  177 TDFSALVQQLKSAGPDVVVLAGDP  200 (343)
T ss_dssp             SHHHHHHHHHHHTTTSEEEEESTH
T ss_pred             ccchHHHHHHhhcCCCEEEEeccc
Confidence            456678888999999998887643


No 331
>cd01979 Pchlide_reductase_N Pchlide_reductase_N: N protein of the NB protein complex of Protochlorophyllide (Pchlide)_reductase. Pchlide reductase catalyzes the reductive formation of chlorophyllide (chlide) from protochlorophyllide (pchlide) during biosynthesis of chlorophylls and bacteriochlorophylls. This group contains both the light-independent Pchlide reductase (DPOR) and light-dependent Pchlide reductase (LPOR).  Angiosperms contain only LPOR, cyanobacteria, algae and gymnosperms contain both DPOR and LPOR, primitive anoxygenic photosynthetic bacteria contain only DPOR. NB is structurally similar to the FeMo protein of nitrogenase, forming an N2B2 heterotetramer. N and B are homologous to the FeMo alpha and beta subunits respectively. Also in common with nitrogenase in vitro DPOR activity requires ATP hydrolysis and dithoionite or ferredoxin as electron donor. The NB protein complex may serve as a catalytic site for Pchlide reduction similar to MoFe for nitrogen reduction.
Probab=22.13  E-value=1.1e+02  Score=23.89  Aligned_cols=32  Identities=22%  Similarity=0.335  Sum_probs=24.9

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccCCCCccccCCC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGS   61 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~   61 (86)
                      -+.++.+.+++.+||++|= |  .-..+|+++.|-
T Consensus       333 d~~~l~~~i~~~~pDlli~-~--~~~a~pl~r~G~  364 (396)
T cd01979         333 DNYRQLDRIRELRPDLVVT-G--LGLANPLEARGI  364 (396)
T ss_pred             CHHHHHHHHHhcCCCEEEe-c--ccccCcHHhCCC
Confidence            5678888899999999885 6  445578888774


No 332
>PF13659 Methyltransf_26:  Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A ....
Probab=22.07  E-value=66  Score=19.70  Aligned_cols=26  Identities=19%  Similarity=0.107  Sum_probs=15.9

Q ss_pred             HHHHHHHhhCCCCEEEeeccccCCCC
Q psy149           29 EDLIALTVQQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~GPFiD~~h   54 (86)
                      .++.+.....+.|++|.--||....+
T Consensus        60 ~~~~~~~~~~~~D~Iv~npP~~~~~~   85 (117)
T PF13659_consen   60 RDLPEPLPDGKFDLIVTNPPYGPRSG   85 (117)
T ss_dssp             HHHHHTCTTT-EEEEEE--STTSBTT
T ss_pred             hhchhhccCceeEEEEECCCCccccc
Confidence            34444456688999999999986643


No 333
>cd01137 PsaA Metal binding protein PsaA.  These proteins have been shown to function as initial receptors in ABC transport of Mn2+ and as surface adhesins in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=22.07  E-value=1.1e+02  Score=22.85  Aligned_cols=53  Identities=17%  Similarity=0.263  Sum_probs=37.8

Q ss_pred             CCchHHHHHHHHhhCCCCEEEeeccccCCCCc--------cccCCCc----CCCHHHHHHHHHHH
Q psy149           24 SYKPLEDLIALTVQQEPDVLILIGPLLDTSHP--------LLLNGSL----AETFEDFYVKLIDS   76 (86)
Q Consensus        24 ~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~--------~i~~g~~----~~t~eelF~~~i~~   76 (86)
                      +..||.++++.|...+.+|-.|+.|=.|..+=        .+++.++    ...||....+++.+
T Consensus        23 s~~pl~~~v~~I~Gd~v~V~~Lip~g~dPH~ye~~p~d~~~l~~Adlvv~~G~~~E~wl~~~~~~   87 (287)
T cd01137          23 TFSILADIARNIAGDRVNVTSIVPPGADPHEYEPTPSDIKKLSKADLILYNGLNLEPWLERLVKN   87 (287)
T ss_pred             EChHHHHHHHHHcCCeeEEEEecCCCCCccCCCCCHHHHHHHHhCCEEEEcCCCcHHHHHHHHHh
Confidence            46799999999999999999999999997651        1344443    34566654555553


No 334
>PRK11573 hypothetical protein; Provisional
Probab=22.03  E-value=1.4e+02  Score=23.82  Aligned_cols=47  Identities=17%  Similarity=0.285  Sum_probs=35.9

Q ss_pred             chHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHHHHhhcc
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDSIVQP   80 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~i~~~   80 (86)
                      .++.++++..++.+-|..|.+.-|=..      .|  -.|+||++++++..|-+.
T Consensus       271 ~~l~~lL~~~~~~~~~~AiVvDEyG~~------~G--iVTleDilEeivGei~de  317 (413)
T PRK11573        271 TPLSTQLVKFQRNKKKVGLVVDEYGDI------QG--LVTVEDILEEIVGDFTTS  317 (413)
T ss_pred             CcHHHHHHHHHhcCCeEEEEEecCCCe------EE--EeeHHHHHHHHhCCCCcc
Confidence            489999999999999999887433211      12  579999999999877554


No 335
>PLN02495 oxidoreductase, acting on the CH-CH group of donors
Probab=21.94  E-value=1.1e+02  Score=24.57  Aligned_cols=34  Identities=15%  Similarity=0.166  Sum_probs=20.0

Q ss_pred             EEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccC
Q psy149           10 MFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        10 i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      +|+||||+|..        .+.++++.+...-.+++=.=|.|
T Consensus        24 ~i~ASgp~t~~--------~e~~~~~~~~g~GAVV~KTi~~~   57 (385)
T PLN02495         24 FVIGSGPPGTN--------YTVMKRAFDEGWGGVIAKTVSLD   57 (385)
T ss_pred             cEeCCccCCCC--------HHHHHHHHhcCCeEEEeccccCC
Confidence            79999999876        33444444445555554333333


No 336
>PF03514 GRAS:  GRAS domain family;  InterPro: IPR005202 Sequence analysis of the products of the GRAS (GAI, RGA, SCR) gene family indicates that they share a variable N terminus and a highly conserved C terminus that contains five recognizable motifs []. Proteins in the GRAS family are transcription factors that seem to be involved in development and other processes. Mutation of the SCARECROW (SCR) gene results in a radial pattern defect, loss of a ground tissue layer, in the root. The PAT1 protein is involved in phytochrome A signal transduction [].  GRAS proteins contain a conserved region of about 350 amino acids that can be divided in 5 motifs, found in the following order: leucine heptad repeat I, the VHIID motif, leucine heptad repeat II, the PFYRE motif and the SAW motif [, ]. Plant specific GRAS proteins have parallels in their motif structure to the animal Signal Transducers and Activators of Transcription (STAT) family of proteins [] which suggests also some parallels in their functions.
Probab=21.90  E-value=1e+02  Score=24.22  Aligned_cols=26  Identities=19%  Similarity=0.432  Sum_probs=22.5

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccCC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      |.+.+|..|+.-+|.|++++-+=.|-
T Consensus       223 ~~~~~L~~ir~L~P~vvv~~E~ea~~  248 (374)
T PF03514_consen  223 PRDAFLRVIRSLNPKVVVLVEQEADH  248 (374)
T ss_pred             hHHHHHHHHHhcCCCEEEEEeecCCC
Confidence            88999999999999999998775443


No 337
>PTZ00198 60S ribosomal protein L22; Provisional
Probab=21.80  E-value=37  Score=23.56  Aligned_cols=25  Identities=28%  Similarity=0.465  Sum_probs=16.8

Q ss_pred             ccCCCCccccCCCc-CCCHHHHHHHHH
Q psy149           49 LLDTSHPLLLNGSL-AETFEDFYVKLI   74 (86)
Q Consensus        49 FiD~~h~~i~~g~~-~~t~eelF~~~i   74 (86)
                      .||++||. .+|-+ ..+||.+++..|
T Consensus        22 ~IDCt~Pv-eD~I~d~a~fekfL~erI   47 (122)
T PTZ00198         22 KIDCTIPA-EDGIIDLSGFEQFLQDRI   47 (122)
T ss_pred             EEEcCCcc-cCCcccHHHHHHHHHHhE
Confidence            47999994 66655 346777776554


No 338
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Transcription of the galactose regulon genes is regulated by Gal iso-repressor (GalS) and Gal repressor (GalR) in different ways, but both repressors recognize the same DNA binding site in the absence of D-galactose. GalS is a dimeric protein like GalR,and its major role is in regulating expression of the high-affinity galactose transporter encoded by the mgl operon, whereas GalR is the exclusive regulator of galactose permease, the low-affinity galactose transporter. GalS and GalR are members of the LacI-GalR family of transcription regulators and both contain the type I periplasmic binding protein-like fold. Hence, they are homologous to the periplasmic sugar bindi
Probab=21.77  E-value=2.7e+02  Score=19.21  Aligned_cols=26  Identities=23%  Similarity=0.314  Sum_probs=19.6

Q ss_pred             chHHHHHHHHhhCCCCEEEeeccccC
Q psy149           26 KPLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      +.-.+.++.+.+.++|.+|+.++..+
T Consensus        42 ~~~~~~i~~~~~~~vdgii~~~~~~~   67 (268)
T cd06270          42 EKEREAIEFLLERRCDALILHSKALS   67 (268)
T ss_pred             HHHHHHHHHHHHcCCCEEEEecCCCC
Confidence            34457788888889999999987544


No 339
>cd01016 TroA Metal binding protein TroA. These proteins have been shown to function as initial receptors in ABC transport of Zn2+ and possibly Fe3+ in many eubacterial species.  The TroA proteins belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=21.68  E-value=1.8e+02  Score=21.59  Aligned_cols=53  Identities=17%  Similarity=0.192  Sum_probs=38.3

Q ss_pred             CchHHHHHHHHhhCCCCEEEeeccccCCCC--------ccccCCCc----CCCHHHHHHHHHHHh
Q psy149           25 YKPLEDLIALTVQQEPDVLILIGPLLDTSH--------PLLLNGSL----AETFEDFYVKLIDSI   77 (86)
Q Consensus        25 y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h--------~~i~~g~~----~~t~eelF~~~i~~i   77 (86)
                      ..||.+|++.|...+.+|-.|+.|=.|..+        ..|++.++    ...||....+++.+.
T Consensus         8 ~~pl~~iv~~I~gd~v~V~~li~~g~dpH~yep~p~d~~~l~~Adliv~~G~~~E~w~~k~~~~~   72 (276)
T cd01016           8 TGMIADAVENIGGDHVEVTGLMGPGVDPHLYKATAGDVEKLQNADVVFYNGLHLEGKMSDVLSKL   72 (276)
T ss_pred             ChHHHHHHHHHcCCeEEEEEeeCCCCCcccCCCCHHHHHHHHhCCEEEEcCcChHHHHHHHHHHh
Confidence            469999999999999999999998888755        11444443    445776656666553


No 340
>TIGR00655 PurU formyltetrahydrofolate deformylase. This model describes formyltetrahydrofolate deformylases. The enzyme is a homohexamer. Sequences from a related enzyme formyl tetrahydrofolate-specific enzyme, phosphoribosylglycinamide formyltransferase, serve as an outgroup for phylogenetic analysis. Putative members of this family, scoring below the trusted cutoff, include a sequence from Rhodobacter capsulatus that lacks an otherwise conserved C-terminal region.
Probab=21.67  E-value=99  Score=23.61  Aligned_cols=19  Identities=21%  Similarity=0.309  Sum_probs=16.4

Q ss_pred             HHHHHHHhhCCCCEEEeec
Q psy149           29 EDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~G   47 (86)
                      .++++.+++.+||+++|.|
T Consensus       150 ~~~~~~l~~~~~Dlivlag  168 (280)
T TIGR00655       150 KRQLELLKQYQVDLVVLAK  168 (280)
T ss_pred             HHHHHHHHHhCCCEEEEeC
Confidence            4678888899999999987


No 341
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally.
Probab=21.39  E-value=1.1e+02  Score=22.93  Aligned_cols=24  Identities=13%  Similarity=0.057  Sum_probs=18.1

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      +...++++++.+||++++.+--=|
T Consensus       192 ~~~~v~~ik~a~pD~v~~~~~~~~  215 (357)
T cd06337         192 FSSQINAFKREGVDIVTGFAIPPD  215 (357)
T ss_pred             HHHHHHHHHhcCCCEEEeCCCccH
Confidence            456788899999999987764433


No 342
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
Probab=21.34  E-value=97  Score=22.93  Aligned_cols=26  Identities=31%  Similarity=0.277  Sum_probs=20.5

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccccCC
Q psy149           27 PLEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      -..++++.+++.+||++|+=+.-+|.
T Consensus        68 d~~~~~~~l~~~~~d~vV~D~y~~~~   93 (279)
T TIGR03590        68 DALELINLLEEEKFDILIVDHYGLDA   93 (279)
T ss_pred             hHHHHHHHHHhcCCCEEEEcCCCCCH
Confidence            35578889999999999997775554


No 343
>PF03372 Exo_endo_phos:  Endonuclease/Exonuclease/phosphatase family Subset of Pfam family Subset of Pfam family;  InterPro: IPR005135  This domain is found in a large number of proteins including magnesium dependent endonucleases and phosphatases involved in intracellular signalling []. Proteins this domain is found in include: AP endonuclease proteins (4.2.99.18 from EC), DNase I proteins (3.1.21.1 from EC), Synaptojanin an inositol-1,4,5-trisphosphate phosphatase (3.1.3.56 from EC) and Sphingomyelinase (3.1.4.12 from EC).; PDB: 2J63_A 2JC4_A 3TEB_B 3MTC_A 3N9V_B 1ZWX_A 2F1N_A 1Y21_A 1NTF_A 2IMQ_X ....
Probab=21.31  E-value=97  Score=20.35  Aligned_cols=20  Identities=15%  Similarity=0.385  Sum_probs=14.9

Q ss_pred             HHHHHHHHhhCCCCEEEeec
Q psy149           28 LEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~G   47 (86)
                      ...+.+.+.+.+||++.|-.
T Consensus        18 ~~~i~~~i~~~~~Dii~LQE   37 (249)
T PF03372_consen   18 RREIAQWIAELDPDIIALQE   37 (249)
T ss_dssp             HHHHHHHHHHHT-SEEEEEE
T ss_pred             HHHHHHHHHhcCCCEEEEec
Confidence            44588888888999999853


No 344
>cd01976 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe protein, beta subunit. A group of proteins similar to the alpha subunit of the MoFe protein of the molybdenum (Mo-) nitrogenase. The nitrogenase enzyme catalyzes the ATP-dependent reduction of dinitrogen to ammonia. The Mo-nitrogenase is the most widespread and best characterized of these systems.  Mo-nitrogenase consists of the MoFe protein (component 1) and the Fe protein (component 2).  MoFe is an alpha2beta2 tetramer. Each alphabeta pair of MoFe contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (FeMoco) contained within the alpha subunit. The Fe protein contains a single [4Fe-4S] cluster.  Electrons are transferred from the [4Fe-4S] cluster of the Fe protein to the P-cluster of the MoFe and in turn to FeMoCo, the site of substrate reduction.
Probab=21.26  E-value=1.3e+02  Score=23.91  Aligned_cols=17  Identities=18%  Similarity=0.260  Sum_probs=15.0

Q ss_pred             HHHHHHHHhhCCCCEEE
Q psy149           28 LEDLIALTVQQEPDVLI   44 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlI   44 (86)
                      +.++.+.+++.+||++|
T Consensus       358 ~~e~~~~i~~~~pDlii  374 (421)
T cd01976         358 HYELEEFVKRLKPDLIG  374 (421)
T ss_pred             HHHHHHHHHHhCCCEEE
Confidence            77888999999999887


No 345
>KOG0086|consensus
Probab=21.18  E-value=2e+02  Score=21.40  Aligned_cols=66  Identities=21%  Similarity=0.337  Sum_probs=43.7

Q ss_pred             CCCCCCCCCchHHHHHHHHhh-CCCC-EEEeeccccCCCCcc----------ccCCC---------cCCCHHHHHHHHHH
Q psy149           17 YTQSDTLSYKPLEDLIALTVQ-QEPD-VLILIGPLLDTSHPL----------LLNGS---------LAETFEDFYVKLID   75 (86)
Q Consensus        17 fT~~d~l~y~pL~~ll~~v~~-~~Pd-vlIL~GPFiD~~h~~----------i~~g~---------~~~t~eelF~~~i~   75 (86)
                      |.-...-+|+.|..-|.-++. ..|+ ++||+|-==|-++..          -++.+         ..+..||-|-++..
T Consensus        89 YD~TsrdsfnaLtnWL~DaR~lAs~nIvviL~GnKkDL~~~R~VtflEAs~FaqEnel~flETSa~TGeNVEEaFl~c~~  168 (214)
T KOG0086|consen   89 YDITSRDSFNALTNWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCAR  168 (214)
T ss_pred             EeccchhhHHHHHHHHHHHHhhCCCcEEEEEeCChhhcChhhhhhHHHHHhhhcccceeeeeecccccccHHHHHHHHHH
Confidence            333444567888888888887 4455 677888755544411          00111         15678999999999


Q ss_pred             Hhhcccc
Q psy149           76 SIVQPLE   82 (86)
Q Consensus        76 ~i~~~~~   82 (86)
                      .|+.+++
T Consensus       169 tIl~kIE  175 (214)
T KOG0086|consen  169 TILNKIE  175 (214)
T ss_pred             HHHHHHh
Confidence            9998875


No 346
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain.  DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN, and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass the dimer interface twice. Two of the Fe-S clusters show a hitherto unobserved coordination involving a glutamine residue.
Probab=21.14  E-value=1.2e+02  Score=22.78  Aligned_cols=11  Identities=27%  Similarity=0.307  Sum_probs=9.4

Q ss_pred             EEEEeCCCCCC
Q psy149           10 MFVSAGPYTQS   20 (86)
Q Consensus        10 i~vAaGPfT~~   20 (86)
                      |++||||+|.+
T Consensus        15 i~~aag~~~~~   25 (299)
T cd02940          15 FGLASAPPTTS   25 (299)
T ss_pred             CEeCCcCCCCC
Confidence            79999999854


No 347
>cd03309 CmuC_like CmuC_like. Proteins similar to the putative corrinoid methyltransferase CmuC. Its function has been inferred from sequence similarity to the methyltransferases CmuA and MtaA. Mutants of Methylobacterium sp. disrupted in cmuC and purU appear deficient in some step of chloromethane metabolism.
Probab=21.10  E-value=2e+02  Score=22.28  Aligned_cols=71  Identities=17%  Similarity=0.311  Sum_probs=39.0

Q ss_pred             eEEEEeCCCCCCCCCCC------------chHHHHHHHH-----------hhC-CCCEEEeeccccCCCCccccCCCcCC
Q psy149            9 SMFVSAGPYTQSDTLSY------------KPLEDLIALT-----------VQQ-EPDVLILIGPLLDTSHPLLLNGSLAE   64 (86)
Q Consensus         9 ~i~vAaGPfT~~d~l~y------------~pL~~ll~~v-----------~~~-~PdvlIL~GPFiD~~h~~i~~g~~~~   64 (86)
                      ...+..||||....|-.            +-+.+|++++           .+. .+|++.+.-++--..-+.+.    ++
T Consensus       115 ~~~~~~Gpf~~a~~l~g~e~~~~~l~~~PE~v~~lld~ltd~~i~y~~~qiea~Gad~I~i~Ddwa~~~~~~LS----pe  190 (321)
T cd03309         115 DVPLPGGVFERFRLRMSMEDALMALYEEPEAAHELFDYLTDAKLKLYERRIKHLEPDLLVYHDDLGSQKGSFIS----PA  190 (321)
T ss_pred             ccCCCCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEEEeCCCccccCCccC----HH
Confidence            44566788886443321            2344555444           223 78988775444332223322    66


Q ss_pred             CHHHHHHHHHHHhhccccC
Q psy149           65 TFEDFYVKLIDSIVQPLEK   83 (86)
Q Consensus        65 t~eelF~~~i~~i~~~~~~   83 (86)
                      .|+|++..-..+|++.+++
T Consensus       191 ~f~efv~P~~krIi~~ik~  209 (321)
T cd03309         191 TFREFILPRMQRIFDFLRS  209 (321)
T ss_pred             HHHHHHHHHHHHHHHHHHh
Confidence            7777776666666666654


No 348
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase. Members of this protein family are related to a known protein-tyrosine autokinase and to numerous homologs from exopolysaccharide biosynthesis region proteins, many of which are designated as chain length determinants. Most members of this family contain a short region, immediately C-terminal to the region modeled here, with an abundance of Tyr residues. These C-terminal tyrosine residues are likely to be autophosphorylation sites. Some members of this family are fusion proteins.
Probab=21.03  E-value=1.4e+02  Score=20.78  Aligned_cols=45  Identities=22%  Similarity=0.290  Sum_probs=28.3

Q ss_pred             ceeEEEEeCCCCCCC--CCCCchHHHHHHHHhhCC-CC-EEEeeccccCC
Q psy149            7 SLSMFVSAGPYTQSD--TLSYKPLEDLIALTVQQE-PD-VLILIGPLLDT   52 (86)
Q Consensus         7 ~l~i~vAaGPfT~~d--~l~y~pL~~ll~~v~~~~-Pd-vlIL~GPFiD~   52 (86)
                      .+.++ .+|+....-  -+..+.+.++++.+++.- .| |+|=++|..+.
T Consensus       114 ~l~vl-~~g~~~~~~~~~~~~~~l~~~l~~l~~~y~~D~IiiD~pp~~~~  162 (207)
T TIGR03018       114 RLSLL-PAGRRHPNPTELLASQRMRSLLHELARRYPDRIIIIDTPPLLVF  162 (207)
T ss_pred             CEEEE-eCCCCCCCHHHHhCcHHHHHHHHHHHhhCCCCEEEEECCCCcch
Confidence            45544 446554331  245577899999998874 58 55557777764


No 349
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
Probab=20.95  E-value=1.2e+02  Score=22.35  Aligned_cols=20  Identities=20%  Similarity=0.318  Sum_probs=15.1

Q ss_pred             HHHHHHhhCCCCEEEeeccc
Q psy149           30 DLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        30 ~ll~~v~~~~PdvlIL~GPF   49 (86)
                      .+.+.+++.+||+++..++.
T Consensus        82 ~~~~~ik~~~pDvv~~~~~~  101 (357)
T PRK00726         82 QARKILKRFKPDVVVGFGGY  101 (357)
T ss_pred             HHHHHHHhcCCCEEEECCCc
Confidence            33556677899999999854


No 350
>PRK14817 NADH dehydrogenase subunit B; Provisional
Probab=20.92  E-value=2.7e+02  Score=20.40  Aligned_cols=36  Identities=11%  Similarity=0.328  Sum_probs=25.5

Q ss_pred             CCceeEEEEeCCCCCCCCCCCchHHHHHHHHhh--CCCCEEEeec
Q psy149            5 RRSLSMFVSAGPYTQSDTLSYKPLEDLIALTVQ--QEPDVLILIG   47 (86)
Q Consensus         5 ~~~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~--~~PdvlIL~G   47 (86)
                      .+..-|++-.|+-|...       ...++++.+  .+|..||-+|
T Consensus        73 PR~ADillVeG~VT~~m-------~~~l~~~~e~~p~pK~VIAvG  110 (181)
T PRK14817         73 PRQADLLMVVGTVNCKQ-------APILQRVYEQMADPKWVMAFG  110 (181)
T ss_pred             CcceeEEEEEecCCccc-------hHHHHHHHHHcccCCEEEEec
Confidence            45667999999998774       334555554  6788898774


No 351
>PRK09426 methylmalonyl-CoA mutase; Reviewed
Probab=20.91  E-value=1.9e+02  Score=25.23  Aligned_cols=52  Identities=13%  Similarity=0.151  Sum_probs=34.2

Q ss_pred             eCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCCCCccccCCCcCCCHHHHHHHHHHHhhc
Q psy149           14 AGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDTSHPLLLNGSLAETFEDFYVKLIDSIVQ   79 (86)
Q Consensus        14 aGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~~h~~i~~g~~~~t~eelF~~~i~~i~~   79 (86)
                      +|=|.....-.|.+..++++.+.++++|+++|++              .+.++.+.+..++..+-+
T Consensus       608 ~~GfeV~~~~~~~s~e~~v~aa~~~~a~ivvlcs--------------~d~~~~e~~~~l~~~Lk~  659 (714)
T PRK09426        608 DLGFDVDIGPLFQTPEEAARQAVENDVHVVGVSS--------------LAAGHKTLVPALIEALKK  659 (714)
T ss_pred             hCCeeEecCCCCCCHHHHHHHHHHcCCCEEEEec--------------cchhhHHHHHHHHHHHHh
Confidence            3444443333467788999999999999999965              355666666555555433


No 352
>PF12847 Methyltransf_18:  Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A ....
Probab=20.91  E-value=86  Score=18.94  Aligned_cols=38  Identities=11%  Similarity=0.236  Sum_probs=19.8

Q ss_pred             ceeEEEEeCCCCCCCCCCCchHHHHHHHHhh-CCCCEEEe
Q psy149            7 SLSMFVSAGPYTQSDTLSYKPLEDLIALTVQ-QEPDVLIL   45 (86)
Q Consensus         7 ~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~-~~PdvlIL   45 (86)
                      +..++++.| |+...-+..+-..++++.+.+ -+|+-.++
T Consensus        70 ~~D~v~~~~-~~~~~~~~~~~~~~~l~~~~~~L~pgG~lv  108 (112)
T PF12847_consen   70 PFDLVICSG-FTLHFLLPLDERRRVLERIRRLLKPGGRLV  108 (112)
T ss_dssp             CEEEEEECS-GSGGGCCHHHHHHHHHHHHHHHEEEEEEEE
T ss_pred             CCCEEEECC-CccccccchhHHHHHHHHHHHhcCCCcEEE
Confidence            455666666 544433433444555665554 55654444


No 353
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF). This group includes the type I periplasmic-binding proteins that are predicted to have a function similar to that of an active transport system for short chain amides and/or urea in bacteria and Archaea, by sequence comparison and phylogenetic analysis.
Probab=20.83  E-value=1.2e+02  Score=22.42  Aligned_cols=23  Identities=17%  Similarity=0.120  Sum_probs=18.2

Q ss_pred             hHHHHHHHHhhCCCCEEEeeccc
Q psy149           27 PLEDLIALTVQQEPDVLILIGPL   49 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL~GPF   49 (86)
                      -+...+++++..+||+|++.+.-
T Consensus       175 d~~~~v~~l~~~~pd~v~~~~~~  197 (334)
T cd06356         175 DFGSTIQKIQAAKPDFVMSILVG  197 (334)
T ss_pred             hHHHHHHHHHhcCCCEEEEeccC
Confidence            35677889999999999986543


No 354
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=20.79  E-value=2.3e+02  Score=18.86  Aligned_cols=24  Identities=21%  Similarity=0.181  Sum_probs=14.1

Q ss_pred             HHHHHHH---hhCCCCEEEeeccccCC
Q psy149           29 EDLIALT---VQQEPDVLILIGPLLDT   52 (86)
Q Consensus        29 ~~ll~~v---~~~~PdvlIL~GPFiD~   52 (86)
                      .++++++   ...+||+++++.=-=|.
T Consensus        54 ~~~~~~l~~~~~~~pd~Vii~~G~ND~   80 (191)
T cd01836          54 ADLLRQLAPLPETRFDVAVISIGVNDV   80 (191)
T ss_pred             HHHHHHHHhcccCCCCEEEEEecccCc
Confidence            4444444   46899988775433343


No 355
>cd04506 SGNH_hydrolase_YpmR_like Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
Probab=20.77  E-value=1e+02  Score=20.91  Aligned_cols=23  Identities=22%  Similarity=0.465  Sum_probs=16.9

Q ss_pred             chHHHHHHHHhhCCCCE-EEeecc
Q psy149           26 KPLEDLIALTVQQEPDV-LILIGP   48 (86)
Q Consensus        26 ~pL~~ll~~v~~~~Pdv-lIL~GP   48 (86)
                      +-|.++++++++..|++ ++++|+
T Consensus       106 ~~l~~~i~~ir~~~p~~~Ivv~~~  129 (204)
T cd04506         106 NNLKKIFKEIRKLNPDAPIFLVGL  129 (204)
T ss_pred             HHHHHHHHHHHHHCCCCeEEEEec
Confidence            35788999999877874 556773


No 356
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides. This group includes the type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides, which are subsequently converted by amidases to yield free carboxylic acids and ammonia. NHases from bacteria and fungi have been purified and characterized. In Rhodococcus sp., the nitrile hydratase operon consists of six genes encoding NHase regulator 2, NHase regulator 1, amidase, NHase alpha subunit, NHase beta subunit, and NHase activator. The operon produces a constitutive hydratase that has a broad substrate spectrum: aliphatic and aromatic nitriles, mononitriles and dinitriles, hydroxynitriles and amino-nitriles, and a constitutive amidase of equally low substrate specificity. NHases are metalloenzymes containing either cobalt or iron, and therefore can be classified int
Probab=20.75  E-value=1.2e+02  Score=22.19  Aligned_cols=25  Identities=8%  Similarity=0.050  Sum_probs=18.7

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      +...++++++.+||++++.+.--|.
T Consensus       176 ~~~~v~~l~~~~pd~v~~~~~~~~~  200 (333)
T cd06358         176 FTSVLERIAASGADAVLSTLVGQDA  200 (333)
T ss_pred             HHHHHHHHHHcCCCEEEEeCCCCch
Confidence            4667788999999999887654343


No 357
>PF06162 DUF976:  Caenorhabditis elegans protein of unknown function (DUF976);  InterPro: IPR010381 This family consists of proteins of unknown function found in Caenorhabditis species.
Probab=20.68  E-value=1e+02  Score=22.42  Aligned_cols=26  Identities=19%  Similarity=0.503  Sum_probs=23.9

Q ss_pred             CCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           23 LSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        23 l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      .+|+...+-+..+.+++||.+|=+||
T Consensus        65 ~sYe~V~ekvpel~~~~~~~viHL~~   90 (166)
T PF06162_consen   65 VSYEEVDEKVPELWKEQPDFVIHLAS   90 (166)
T ss_pred             chHHHHHHHhHHHHhhCCCeEEEecC
Confidence            57899999999999999999999997


No 358
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways. The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active.
Probab=20.55  E-value=2.3e+02  Score=19.82  Aligned_cols=39  Identities=18%  Similarity=0.442  Sum_probs=33.0

Q ss_pred             ceeEEEEeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccCC
Q psy149            7 SLSMFVSAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus         7 ~l~i~vAaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      +-+.+++-+|-..       -..+|-+.|-+++..++++++++.+.
T Consensus        40 ~~~fI~tQ~P~~~-------t~~~FW~mv~~~~~~~IV~l~~~~e~   78 (231)
T cd00047          40 PKAYIATQGPLPN-------TVEDFWRMVWEQKVPVIVMLTELVEK   78 (231)
T ss_pred             CcceEEcCCCChh-------hHHHHHHHHHhcCCCEEEEccccccC
Confidence            4677888888663       68999999999999999999998764


No 359
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
Probab=20.55  E-value=1.1e+02  Score=23.55  Aligned_cols=20  Identities=20%  Similarity=0.340  Sum_probs=16.2

Q ss_pred             HHHHhhCCCCEEEeeccccC
Q psy149           32 IALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        32 l~~v~~~~PdvlIL~GPFiD   51 (86)
                      +..+++.|||++|-+|=++.
T Consensus        84 ~~i~~~~kPdvvi~~Ggy~s  103 (352)
T PRK12446         84 YVRIRKLKPDVIFSKGGFVS  103 (352)
T ss_pred             HHHHHhcCCCEEEecCchhh
Confidence            35577899999999997774


No 360
>PRK15454 ethanol dehydrogenase EutG; Provisional
Probab=20.43  E-value=1.7e+02  Score=23.12  Aligned_cols=26  Identities=15%  Similarity=0.078  Sum_probs=20.4

Q ss_pred             CCCCchHHHHHHHHhhCCCCEEEeec
Q psy149           22 TLSYKPLEDLIALTVQQEPDVLILIG   47 (86)
Q Consensus        22 ~l~y~pL~~ll~~v~~~~PdvlIL~G   47 (86)
                      |-..+-..+.++.+++.++|++|=+|
T Consensus        89 ~P~~~~v~~~~~~~r~~~~D~IiavG  114 (395)
T PRK15454         89 EPCITDVCAAVAQLRESGCDGVIAFG  114 (395)
T ss_pred             CcCHHHHHHHHHHHHhcCcCEEEEeC
Confidence            44455677888888889999998887


No 361
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF). This group includes the type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF), found in bacteria and Archaea. AmiC controls expression of the amidase operon by a ligand-triggered conformational switch. In the absence of ligand or presence of butyramide (repressor), AmiC (the ligand sensor and negative regulator) adopts an open conformation and inhibits the transcription antitermination function of AmiR by direct protein-protein interaction.  In the presence of inducing ligands such as acetamide, AmiC adopts a closed conformation which disrupts a silencing AmiC-AmiR complex and the expression of amidase and other genes of the operon is induced. FmdDEF is predicted to be an ATP-dependent transporter and closely resembles the periplasmic binding protein and the two t
Probab=20.42  E-value=1.2e+02  Score=22.07  Aligned_cols=25  Identities=16%  Similarity=0.081  Sum_probs=19.0

Q ss_pred             HHHHHHHHhhCCCCEEEeeccccCC
Q psy149           28 LEDLIALTVQQEPDVLILIGPLLDT   52 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GPFiD~   52 (86)
                      +..++.+++..+||+|++.|---|.
T Consensus       176 ~~~~v~~~~~~~~d~v~~~~~~~~~  200 (333)
T cd06331         176 FGSVIEKIKAAGPDVVLSTLVGDSN  200 (333)
T ss_pred             HHHHHHHHHHcCCCEEEEecCCCCh
Confidence            5677888888999999987754333


No 362
>cd04502 SGNH_hydrolase_like_7 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=20.36  E-value=2.6e+02  Score=18.28  Aligned_cols=15  Identities=20%  Similarity=0.222  Sum_probs=8.1

Q ss_pred             hCCCCEEEeeccccC
Q psy149           37 QQEPDVLILIGPLLD   51 (86)
Q Consensus        37 ~~~PdvlIL~GPFiD   51 (86)
                      ..+||+++++.=-=|
T Consensus        48 ~~~p~~vvi~~G~ND   62 (171)
T cd04502          48 PYQPRRVVLYAGDND   62 (171)
T ss_pred             cCCCCEEEEEEecCc
Confidence            346776666554333


No 363
>KOG3488|consensus
Probab=20.34  E-value=32  Score=22.14  Aligned_cols=10  Identities=40%  Similarity=0.820  Sum_probs=8.1

Q ss_pred             eeccccCCCC
Q psy149           45 LIGPLLDTSH   54 (86)
Q Consensus        45 L~GPFiD~~h   54 (86)
                      ++=||+|+.|
T Consensus        28 iilPFvDs~h   37 (81)
T KOG3488|consen   28 IILPFVDSMH   37 (81)
T ss_pred             hhhcccchhH
Confidence            3459999999


No 364
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally.
Probab=20.31  E-value=1.8e+02  Score=21.50  Aligned_cols=34  Identities=12%  Similarity=0.107  Sum_probs=22.8

Q ss_pred             eCCCCCCCCCCCchHHHHHHHHhhCCCCEEEeeccccC
Q psy149           14 AGPYTQSDTLSYKPLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        14 aGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      .--|... .-+|++   .+.++++.+||++++.+..-|
T Consensus       178 ~~~~~~~-~~d~~~---~i~~l~~~~~d~v~~~~~~~~  211 (347)
T cd06340         178 DISYPAN-ARDLTS---EVLKLKAANPDAILPASYTND  211 (347)
T ss_pred             eeccCCC-CcchHH---HHHHHHhcCCCEEEEcccchh
Confidence            3344433 335554   677888899999999887655


No 365
>PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional
Probab=20.29  E-value=1.5e+02  Score=23.27  Aligned_cols=28  Identities=21%  Similarity=0.455  Sum_probs=19.8

Q ss_pred             CCCCchHHHHHHHH-hhCCCCEEEeeccc
Q psy149           22 TLSYKPLEDLIALT-VQQEPDVLILIGPL   49 (86)
Q Consensus        22 ~l~y~pL~~ll~~v-~~~~PdvlIL~GPF   49 (86)
                      .++=+-..+-+... .+-+||.+|.++|=
T Consensus        42 Km~pe~~~~~~~~~~~~~~pDf~i~isPN   70 (277)
T PRK00994         42 KMGPEEVEEVVKKMLEEWKPDFVIVISPN   70 (277)
T ss_pred             CCCHHHHHHHHHHHHHhhCCCEEEEECCC
Confidence            44445556656555 56799999999993


No 366
>cd00501 Peptidase_C15 Pyroglutamyl peptidase (PGP) type I, also known as pyrrolidone carboxyl peptidase (pcp) type I:  Enzymes responsible for cleaving pyroglutamate (pGlu) from the N-terminal end of specialized proteins. The N-terminal pGlu protects these proteins from proteolysis by other proteases until the pGlu is removed by a PGP.  PGPs are cysteine proteases with a Cys-His-Glu/Asp catalytic triad. Type I PGPs are found in a wide variety of prokaryotes and eukaryotes. It is not clear whether the functional form is a monomer, a homodimer, or a homotetramer.
Probab=20.23  E-value=1.1e+02  Score=21.46  Aligned_cols=30  Identities=17%  Similarity=0.392  Sum_probs=21.2

Q ss_pred             CchHHHHHHHHh-hCCCCEEEeeccccCCCC
Q psy149           25 YKPLEDLIALTV-QQEPDVLILIGPLLDTSH   54 (86)
Q Consensus        25 y~pL~~ll~~v~-~~~PdvlIL~GPFiD~~h   54 (86)
                      |....+.+..+. +.+||++|.+|-.--.+.
T Consensus        45 y~~~~~~~~~~~~~~~pd~vlhlG~~~~~~~   75 (194)
T cd00501          45 FQKAVEVLPELIEEHKPDLVIHVGLAGGRST   75 (194)
T ss_pred             HHHHHHHHHHHHHHhCCCEEEEecccCCCCc
Confidence            666666665544 579999999998765444


No 367
>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional
Probab=20.17  E-value=2.3e+02  Score=20.95  Aligned_cols=29  Identities=14%  Similarity=0.153  Sum_probs=22.1

Q ss_pred             CCCCCCchHHHHHHHHhhCCCCEEEeecc
Q psy149           20 SDTLSYKPLEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        20 ~d~l~y~pL~~ll~~v~~~~PdvlIL~GP   48 (86)
                      ...+..+.+.++++++.+....++++.|+
T Consensus       191 ~k~Wp~e~~a~li~~l~~~~~~ivl~~G~  219 (322)
T PRK10964        191 DKHWPEAHWRELIGLLAPSGLRIKLPWGA  219 (322)
T ss_pred             cccCCHHHHHHHHHHHHHCCCeEEEeCCC
Confidence            46788888999999998766666665565


No 368
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA). TPRS is a bifunctional tetrameric enzyme (2 alpha and 2 beta subunits) that catalyzes the last two steps of L-tryptophan biosynthesis. Alpha and beta subunit catalyze two distinct reactions which are both strongly stimulated by the formation of the complex. The alpha subunit catalyzes the cleavage of indole 3-glycerol phosphate (IGP) to indole and d-glyceraldehyde 3-phosphate (G3P). Indole is then channeled to the active site of the beta subunit, a PLP-dependent enzyme that catalyzes a replacement reaction to convert L-serine into L-tryptophan.
Probab=20.17  E-value=1.4e+02  Score=21.82  Aligned_cols=30  Identities=17%  Similarity=0.263  Sum_probs=21.5

Q ss_pred             CCCCchHHHHHHHHhhCCCCEEEeeccccC
Q psy149           22 TLSYKPLEDLIALTVQQEPDVLILIGPLLD   51 (86)
Q Consensus        22 ~l~y~pL~~ll~~v~~~~PdvlIL~GPFiD   51 (86)
                      +|.++.+.++++++++...+..+++-|=-.
T Consensus       112 Dl~~ee~~~~~~~~~~~g~~~i~~i~P~T~  141 (242)
T cd04724         112 DLPPEEAEEFREAAKEYGLDLIFLVAPTTP  141 (242)
T ss_pred             CCCHHHHHHHHHHHHHcCCcEEEEeCCCCC
Confidence            456677777788888877777777777543


No 369
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional
Probab=20.13  E-value=1.2e+02  Score=23.13  Aligned_cols=21  Identities=24%  Similarity=0.230  Sum_probs=16.8

Q ss_pred             HHHHHHHHhhCCCCEEEeecc
Q psy149           28 LEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GP   48 (86)
                      +...+.+++..+||+|++.|-
T Consensus       205 ~~~~v~~l~~~~~d~v~~~~~  225 (369)
T PRK15404        205 FSALIAKLKKENVDFVYYGGY  225 (369)
T ss_pred             hHHHHHHHHhcCCCEEEECCC
Confidence            555788999999999887653


No 370
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit. This model represents the S (sigma) subunit of methylaspartate mutase (glutamate mutase), a cobalamin-dependent enzyme that catalyzes the first step in a pathway of glutamate fermentation.
Probab=20.10  E-value=1.3e+02  Score=20.68  Aligned_cols=20  Identities=20%  Similarity=0.599  Sum_probs=17.2

Q ss_pred             chHHHHHHHHhhCCCCEEEe
Q psy149           26 KPLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        26 ~pL~~ll~~v~~~~PdvlIL   45 (86)
                      .|..++++.+.+++||++-+
T Consensus        39 v~~e~~v~aa~~~~adiVgl   58 (134)
T TIGR01501        39 SPQEEFIKAAIETKADAILV   58 (134)
T ss_pred             CCHHHHHHHHHHcCCCEEEE
Confidence            47789999999999998876


No 371
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=20.08  E-value=89  Score=21.00  Aligned_cols=21  Identities=33%  Similarity=0.507  Sum_probs=14.4

Q ss_pred             HHHHHHHHhhCCCCEEEeecc
Q psy149           28 LEDLIALTVQQEPDVLILIGP   48 (86)
Q Consensus        28 L~~ll~~v~~~~PdvlIL~GP   48 (86)
                      |..|.+.+++.....+++.||
T Consensus         8 l~~l~~~l~~~~~~~~~l~G~   28 (234)
T PF01637_consen    8 LEKLKELLESGPSQHILLYGP   28 (234)
T ss_dssp             HHHHHHCHHH--SSEEEEEES
T ss_pred             HHHHHHHHHhhcCcEEEEEcC
Confidence            556666666666788888898


No 372
>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria. Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria. Members of this group are initial receptors in the process of active transport across cellular membrane, but their substrate specificities are not known in detail. However, they closely resemble the group of AmiC and active transport systems for short-chain amides and urea (FmdDEF), and thus are likely to exhibit a ligand-binding mode similar to that of the amide sensor protein AmiC from Pseudomonas aeruginosa. Moreover, this binding domain has high sequence identity to the family of hydrophobic amino acid transporters (HAAT), and thus it may also be involved in transport of amino acids.
Probab=20.07  E-value=1.8e+02  Score=21.36  Aligned_cols=30  Identities=17%  Similarity=0.176  Sum_probs=19.2

Q ss_pred             EeCCCCCCCCCCCchHHHHHHHHhhCCCCEEEee
Q psy149           13 SAGPYTQSDTLSYKPLEDLIALTVQQEPDVLILI   46 (86)
Q Consensus        13 AaGPfT~~d~l~y~pL~~ll~~v~~~~PdvlIL~   46 (86)
                      +.-.|.. +.-||.   ..+.+++..+||++++.
T Consensus       169 ~~~~~~~-~~~d~~---~~v~~l~~~~pd~V~~~  198 (333)
T cd06328         169 TEEYAPT-DTTDFT---PYAQRLLDALKKVLFVI  198 (333)
T ss_pred             eeeeCCC-CCcchH---HHHHHHHhcCCCEEEEE
Confidence            3444443 344444   45788888999998775


No 373
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme. Malic enzyme (ME), a member of the amino acid dehydrogenase (DH)-like domain family, catalyzes the oxidative decarboxylation of L-malate to pyruvate in the presence of cations (typically  Mg++ or Mn++) with the concomitant reduction of cofactor NAD+ or NADP+.  ME has been found in all organisms and plays important roles in diverse metabolic pathways such as photosynthesis and lipogenesis. This enzyme generally forms homotetramers. The conversion of malate to pyruvate by ME typically involves oxidation of malate to produce oxaloacetate, followed by decarboxylation of oxaloacetate to produce pyruvate and CO2.  Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glut
Probab=20.02  E-value=51  Score=25.20  Aligned_cols=19  Identities=32%  Similarity=0.282  Sum_probs=15.5

Q ss_pred             hHHHHHHHHhhCCCCEEEe
Q psy149           27 PLEDLIALTVQQEPDVLIL   45 (86)
Q Consensus        27 pL~~ll~~v~~~~PdvlIL   45 (86)
                      +..+|.+.|++.+||+||=
T Consensus        94 ~~~~L~eav~~~kptvlIG  112 (254)
T cd00762          94 ESGDLEDAVEAAKPDFLIG  112 (254)
T ss_pred             ccCCHHHHHHhhCCCEEEE
Confidence            3457888888899999885


No 374
>PF03949 Malic_M:  Malic enzyme, NAD binding domain;  InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e.g. carbon dioxide released from the reaction may be used in sugar production during the Calvin cycle of photosynthesis []. There are 3 forms of the enzyme []: an NAD-dependent form that decarboxylates oxaloacetate; an NAD-dependent form that does not decarboxylate oxalo-acetate; and an NADPH-dependent form []. Other proteins known to be similar to malic enzymes are the Escherichia coli scfA protein; an enzyme from Zea mays (Maize), formerly thought to be cinnamyl-alcohol dehydrogenase []; and the hypothetical Saccharomyces cerevisiae protein YKL029c. Studies on the duck liver malic enzyme reveals that it can be alkylated by bromopyruvate, resulting in the loss of oxidative decarboxylation and the subsequent enhancement of pyruvate reductase activity []. The alkylated form is able to bind NADPH but not L-malate, indicating impaired substrate-or divalent metal ion-binding in the active site []. Sequence analysis has highlighted a cysteine residue as the point of alkylation, suggesting that it may play an important role in the activity of the enzyme [], although it is absent in the sequences from some species. There are three well conserved regions in the enzyme sequences. Two of them seem to be involved in the binding NAD or NADP. The significance of the third one, located in the central part of the enzymes, is not yet known.; GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, 0051287 NAD binding, 0055114 oxidation-reduction process; PDB: 2DVM_B 1WW8_A 3NV9_A 1PJ2_A 1PJL_B 1GZ3_A 1PJ4_A 1PJ3_C 1EFL_A 1EFK_B ....
Probab=20.01  E-value=50  Score=25.25  Aligned_cols=18  Identities=28%  Similarity=0.390  Sum_probs=13.8

Q ss_pred             HHHHHHHhhCCCCEEEee
Q psy149           29 EDLIALTVQQEPDVLILI   46 (86)
Q Consensus        29 ~~ll~~v~~~~PdvlIL~   46 (86)
                      .+|.+.|+..|||+||=+
T Consensus        96 ~~L~eav~~~kPtvLIG~  113 (255)
T PF03949_consen   96 GSLLEAVKGAKPTVLIGL  113 (255)
T ss_dssp             SSHHHHHHCH--SEEEEC
T ss_pred             cCHHHHHHhcCCCEEEEe
Confidence            589999999999999865


Done!