Diaphorina citri psyllid: psy1491

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MFPHHSALRGASEGNKYYAFRGIPYAEPPLNEFRFQRPKRRYLDGDIHAVKNGNPCLQPSPNDPKKVVGDEDCLTLNVYTPKRPKRRYLDGDIHAVKNGNPCLQPSPNDPKKVVGDEDCLTLNVYTPKIPTQNDPNPELLPVIFWIHGGGYRRGSGLQYDPNDLVMKNTVVVTVQYRLGSLGFLSSKQKDLPGNVGLLDIASALHWTRHYIQNFGGDPNKITTAGQGSGASAAMLLSLSKLTSSWVQGIVAMSGSALSSFAVDYRPEESYKNVTRKSTVCSDMTGVELVKCLQELSPEEIVLSDTDIESSNIQNGGFVSGLAELLTPGPVVEGEDDEWFLPNLLENSAMDLITSTNKTDKIPMLTGVTKQETGTGVKGTRDRFSRSSLRRM
ccccCEEEEEEECccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccEEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHHHccccccHHHHHHHccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHcccccccccccccccccccccccccccCEcccccccccccHHHccHHHHHHHccccccccEEEcccccccccccccccHHHHHHHHccc
MFPHHSALRGASEGNKYYAFRGIPYAEPPLNEFRFQRPKRRYLDGDIHAVKNGNPCLQPSPNDPKKVVGDEDCLTLNVYTPKRPKRRYLDGDIHAVKNGNPCLQPSPNDPKKVVGDEDCLTLNVYTPKIPTQNDPNPELLPVIFWIHGGGYRRGSGLQYDPNDLVMKNTVVVTVQYRLGSLGFLSSKQKDLPGNVGLLDIASALHWTRHYIQNFGGDPNKITTAGQGSGASAAMLLSLSKLTSSWVQGIVAMSGSALSSFAVDYRPEESYKNVTRKSTVCSDMTGVELVKCLQELSPEEIVLSDTDIESSNIQNGGFVSGLAELLTPGPVVEGEDDEWFLPNLLENSAMDLITSTNKTDKIPMLTGVTKQETGTGVKGTRDRFS*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPHHSALRGASEGNKYYAFRGIPYAEPPLNEFRFQRPKRRYLDGDIHAVKNGNPCLQPSPNDPKKVVGDEDCLTLNVYTPKRPKRRYLDGDIHAVKNGNPCLQPSPNDPKKVVGDEDCLTLNVYTPKIPTQNDPNPELLPVIFWIHGGGYRRGSGLQYDPNDLVMKNTVVVTVQYRLGSLGFLSSKQKDLPGNVGLLDIASALHWTRHYIQNFGGDPNKITTAGQGSGASAAMLLSLSKLTSSWVQGIVAMSGSALSSFAVDYRPEESYKNVTRKSTVCSDMTGVELVKCLQELSPEEIVLSDTDIESSNIQNGGFVSGLAELLTPGPVVEGEDDEWFLPNLLENSAMDLITSTNKTDKIPMLTGVTKQETGTGVKGTRDRFSRSSLRRM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031974 [CC]membrane-enclosed lumenprobableGO:0005575
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0004091 [MF]carboxylesterase activityprobableGO:0016787, GO:0003674, GO:0016788, GO:0052689, GO:0003824
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0071709 [BP]membrane assemblyprobableGO:0022607, GO:0016044, GO:0009987, GO:0016043, GO:0008150, GO:0061024, GO:0044085, GO:0044091, GO:0071840, GO:0044763, GO:0044699
GO:0051960 [BP]regulation of nervous system developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045202 [CC]synapseprobableGO:0005575
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0051130 [BP]positive regulation of cellular component organizationprobableGO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0007416 [BP]synapse assemblyprobableGO:0032502, GO:0050808, GO:0044707, GO:0007399, GO:0032501, GO:0009987, GO:0048856, GO:0016043, GO:0008150, GO:0022607, GO:0044763, GO:0071840, GO:0048731, GO:0007275, GO:0044699, GO:0044085
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0044087 [BP]regulation of cellular component biogenesisprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DX4, chain A
Confidence level:very confident
Coverage over the Query: 3-82,130-376
View the alignment between query and template
View the model in PyMOL
Template: 3VKF, chain A
Confidence level:confident
Coverage over the Query: 20-88,99-313,325-374
View the alignment between query and template
View the model in PyMOL