Diaphorina citri psyllid: psy14924


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MENESKTSDKTPVLVYIHGESFSWNSGSVYDGTVLSSFASMVVVTVNYRLGILDESKTSDKTPVLVYIHGESFSWNSGSVYDGTVLSSFASMVVVTVNYRLGILGFLNPSKDYRARIPANFGLLDQIAALHWIKENIGEFGGDPSNISLMGHGTGAACINFLMTSPAVPDGEWSRFLFFKFFQASRHRVTSLMMLSTSSNISLSEKRER
ccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccEEEEEcccccccccccccccHHHcccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHccccccccccccHHHHHHHcccccccccHHccccccccHHHHHcc
*****KTSDKTPVLVYIHGESFSWNSGSVYDGTVLSSFASMVVVTVNYRLGILDESKTSDKTPVLVYIHGESFSWNSGSVYDGTVLSSFASMVVVTVNYRLGILGFLNPSKDYRARIPANFGLLDQIAALHWIKENIGEFGGDPSNISLMGHGTGAACINFLMTSPAVPDGEWSRFLFFKFFQASRHRVTSLMM***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENESKTSDKTPVLVYIHGESFSWNSGSVYDGTVLSSFASMVVVTVNYRLGILDESKTSDKTPVLVYIHGESFSWNSGSVYDGTVLSSFASMVVVTVNYRLGILGFLNPSKDYRARIPANFGLLDQIAALHWIKENIGEFGGDPSNISLMGHGTGAACINFLMTSPAVPDGEWSRFLFFKFFQASRHRVTSLMMLSTSSNISLSEKRER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neuroligin-1 Neuronal cell surface protein thought to be involved in cell-cell-interactions by forming intercellular junctions through binding to beta-neurexins. Seems to play role in formation or maintenance of synaptic junctions. In vitro, triggers the de novo formation of presynaptic structures (By similarity). May be involved in specification of excitatory synapses.confidentQ62765

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0004091 [MF]carboxylesterase activityprobableGO:0016787, GO:0003674, GO:0016788, GO:0052689, GO:0003824
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0072657 [BP]protein localization to membraneprobableGO:0008104, GO:0070727, GO:0016044, GO:0034613, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0006807 [BP]nitrogen compound metabolic processprobableGO:0008150, GO:0008152
GO:0060076 [CC]excitatory synapseprobableGO:0005575, GO:0045202
GO:0051960 [BP]regulation of nervous system developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0001941 [BP]postsynaptic membrane organizationprobableGO:0016044, GO:0009987, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0031404 [MF]chloride ion bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0043167
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0097105 [BP]presynaptic membrane assemblyprobableGO:0007416, GO:0050808, GO:0097090, GO:0061024, GO:0022607, GO:0007275, GO:0071840, GO:0016044, GO:0016043, GO:0044091, GO:0044699, GO:0071709, GO:0032502, GO:0032501, GO:0009987, GO:0044763, GO:0048731, GO:0007399, GO:0044707, GO:0048856, GO:0044085, GO:0008150
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:1901575 [BP]organic substance catabolic processprobableGO:0008150, GO:0071704, GO:0009056, GO:0008152
GO:0051130 [BP]positive regulation of cellular component organizationprobableGO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0044248 [BP]cellular catabolic processprobableGO:0008150, GO:0009987, GO:0009056, GO:0008152, GO:0044237
GO:0090394 [BP]negative regulation of excitatory postsynaptic membrane potentialprobableGO:0042391, GO:0019226, GO:0035637, GO:0050801, GO:0042592, GO:0060079, GO:0051899, GO:0023052, GO:0007154, GO:0044699, GO:0065007, GO:0045837, GO:0065008, GO:0019725, GO:0032501, GO:0050877, GO:0009987, GO:0006873, GO:0044763, GO:0007268, GO:0007267, GO:0060078, GO:0055082, GO:0003008, GO:0044700, GO:0044707, GO:0048878, GO:0008150
GO:0044087 [BP]regulation of cellular component biogenesisprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OGT, chain A
Confidence level:very confident
Coverage over the Query: 50-188
View the alignment between query and template
View the model in PyMOL
Template: 1JJI, chain A
Confidence level:very confident
Coverage over the Query: 8-55
View the alignment between query and template
View the model in PyMOL