Query         psy14934
Match_columns 87
No_of_seqs    109 out of 120
Neff          3.8 
Searched_HMMs 46136
Date          Fri Aug 16 16:12:11 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14934.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14934hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG5092 NMT1 N-myristoyl trans  98.8 3.4E-09 7.3E-14   86.6   2.6   45   42-86      6-53  (451)
  2 KOG2779|consensus               98.7 3.6E-09 7.7E-14   86.6   2.1   44   43-86     12-55  (421)
  3 PF15017 AF1Q:  Drug resistance  60.2     4.8  0.0001   27.2   1.0   20   64-84     16-35  (87)
  4 PF14002 YniB:  YniB-like prote  37.1      17 0.00037   27.2   1.0   14   71-84     55-68  (166)
  5 PF08761 dUTPase_2:  dUTPase;    31.5      21 0.00046   25.3   0.7   10   69-78     54-63  (167)
  6 PHA02047 phage lambda Rz1-like  26.4      31 0.00068   24.0   0.8   13   69-81     76-88  (101)
  7 PF10404 BHD_2:  Rad4 beta-hair  18.2      34 0.00074   20.8  -0.3   11   69-79     51-61  (64)
  8 PF09562 RE_LlaMI:  LlaMI restr  16.1      71  0.0015   25.5   0.9   15   69-83    113-127 (271)
  9 PF05627 AvrRpt-cleavage:  Clea  15.5      57  0.0012   19.1   0.2    8   77-84      6-13  (39)
 10 KOG2422|consensus               14.6      79  0.0017   28.3   0.9    7   72-78    214-220 (665)

No 1  
>COG5092 NMT1 N-myristoyl transferase [Lipid metabolism]
Probab=98.77  E-value=3.4e-09  Score=86.56  Aligned_cols=45  Identities=20%  Similarity=0.469  Sum_probs=34.2

Q ss_pred             cHHHHHHHHHHHhhccCCCC---ChHHHhcCCCcccCCcCCCCCCcCC
Q psy14934         42 SIQEIRKAMEVFSLQQRSAK---TPEEALQKQYQFWSTQPVPKIVVTI   86 (87)
Q Consensus        42 k~k~i~~lL~lLsl~~~~~k---~~~~k~~k~yKFW~TQPVPKldE~V   86 (87)
                      +...|+++|++|+|+.-..+   +.+.+.+++|+||+|||||+|||++
T Consensus         6 ~a~~l~~ll~~l~l~~~~~~~~t~~~~k~~kdhKFW~TQPV~~fdee~   53 (451)
T COG5092           6 KAKKLENLLKLLQLNNDDTSKFTQEQKKMGKDHKFWSTQPVDRFDEEA   53 (451)
T ss_pred             hHHHHHHHHHHHhccCcchhhhhhcchhhcccccceecCCCCccchhh
Confidence            45679999999998643322   2445566889999999999999964


No 2  
>KOG2779|consensus
Probab=98.75  E-value=3.6e-09  Score=86.60  Aligned_cols=44  Identities=41%  Similarity=0.701  Sum_probs=36.0

Q ss_pred             HHHHHHHHHHHhhccCCCCChHHHhcCCCcccCCcCCCCCCcCC
Q psy14934         43 IQEIRKAMEVFSLQQRSAKTPEEALQKQYQFWSTQPVPKIVVTI   86 (87)
Q Consensus        43 ~k~i~~lL~lLsl~~~~~k~~~~k~~k~yKFW~TQPVPKldE~V   86 (87)
                      .+.+..+++++++.++.+..++++..++|+||+|||||++||.|
T Consensus        12 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~fw~tqpV~k~de~~   55 (421)
T KOG2779|consen   12 LRNALKALELMSVIQGPATMMDEAAKKDFKFWSTQPVPKLDEVV   55 (421)
T ss_pred             HHHHHHHHHhcccccCcccccccccccccceeecccccccCccc
Confidence            45556666666667788888999999999999999999999954


No 3  
>PF15017 AF1Q:  Drug resistance and apoptosis regulator
Probab=60.16  E-value=4.8  Score=27.16  Aligned_cols=20  Identities=30%  Similarity=0.788  Sum_probs=15.3

Q ss_pred             HHHhcCCCcccCCcCCCCCCc
Q psy14934         64 EEALQKQYQFWSTQPVPKIVV   84 (87)
Q Consensus        64 ~~k~~k~yKFW~TQPVPKldE   84 (87)
                      ......+|.||+. |+|.||.
T Consensus        16 ~~~~f~sF~fWR~-PlP~id~   35 (87)
T PF15017_consen   16 EDEEFNSFLFWRN-PLPDIDL   35 (87)
T ss_pred             ccccccceeeccC-CCCCCCH
Confidence            3345678999985 9999974


No 4  
>PF14002 YniB:  YniB-like protein
Probab=37.13  E-value=17  Score=27.24  Aligned_cols=14  Identities=36%  Similarity=0.805  Sum_probs=12.3

Q ss_pred             CcccCCcCCCCCCc
Q psy14934         71 YQFWSTQPVPKIVV   84 (87)
Q Consensus        71 yKFW~TQPVPKldE   84 (87)
                      --||+--|||.+++
T Consensus        55 n~FW~nSPvP~~~~   68 (166)
T PF14002_consen   55 NFFWNNSPVPDFDN   68 (166)
T ss_pred             hhhccCCCCCCccc
Confidence            35999999999986


No 5  
>PF08761 dUTPase_2:  dUTPase;  InterPro: IPR014871 2-Deoxyuridine 5-triphosphate nucleotidohydrolase (dUTPase) catalyses the hydrolysis of dUTP to dUMP and pyrophosphate (3.6.1.23 from EC). Members of this family have a novel all-alpha fold and are unrelated to the all-beta fold found in dUTPases of the majority of organisms. This family contains both dUTPase homologues of dUTPase including dCTPase of phage T4. ; PDB: 2YB0_E 2YAZ_B 2YAY_A 2CJE_A 1OGK_A 1OGL_A 1W2Y_B 2CIC_A.
Probab=31.51  E-value=21  Score=25.27  Aligned_cols=10  Identities=10%  Similarity=0.909  Sum_probs=5.9

Q ss_pred             CCCcccCCcC
Q psy14934         69 KQYQFWSTQP   78 (87)
Q Consensus        69 k~yKFW~TQP   78 (87)
                      ..||||++++
T Consensus        54 ~~fK~Wk~~~   63 (167)
T PF08761_consen   54 RCFKYWKKKK   63 (167)
T ss_dssp             ----SSSSTT
T ss_pred             cchHhhcCCC
Confidence            5799999999


No 6  
>PHA02047 phage lambda Rz1-like protein
Probab=26.38  E-value=31  Score=24.03  Aligned_cols=13  Identities=38%  Similarity=0.879  Sum_probs=11.5

Q ss_pred             CCCcccCCcCCCC
Q psy14934         69 KQYQFWSTQPVPK   81 (87)
Q Consensus        69 k~yKFW~TQPVPK   81 (87)
                      .+|+=|.-||||-
T Consensus        76 ~~n~~WaD~PVPp   88 (101)
T PHA02047         76 DQNRPWADRPVPP   88 (101)
T ss_pred             HhCCCcccCCCCh
Confidence            5699999999994


No 7  
>PF10404 BHD_2:  Rad4 beta-hairpin domain 2;  InterPro: IPR018327 Mutations in the nucleotide excision repair (NER) pathway can cause the xeroderma pigmentosum skin cancer predisposition syndrome. NER lesions are limited to one DNA strand, but otherwise they are chemically and structurally diverse, being caused by a wide variety of genotoxic chemicals and ultraviolet radiation. The xeroderma pigmentosum C (XPC) protein has a central role in initiating global-genome NER by recognising the lesion and recruiting downstream factors. In NER in eukaryotes, DNA is incised on both sides of the lesion, resulting in the removal of a fragment ~25-30 nucleotides long. This is followed by repair synthesis and ligation. This reaction, in yeast, requires the damage binding factors Rad14, RPA, and the Rad4-Rad23 complex, the transcription factor TFIIH which contains the two DNA helicases Rad3 and Rad25, essential for creating a bubble structure, and the two endonucleases, the Rad1-Rad10 complex and Rad2, which incise the damaged DNA strand on the 5'- and 3'-side of the lesion, respectively []. The crystal structure of the yeast XPC orthologue Rad4 bound to DNA containing a cyclobutane pyrimidine dimer lesion has been determined. The structure shows that Rad4 inserts a beta-hairpin through the DNA duplex, causing the two damaged base pairs to flip out of the double helix. The expelled nucleotides of the undamaged strand are recognised by Rad4, whereas the two cyclobutane pyrimidine dimer-linked nucleotides become disordered. This indicates that the lesions recognised by Rad4/XPC thermodynamically destabilise the double helix in a manner that facilitates the flipping-out of two base pairs []. Homologues of all the above mentioned yeast genes, except for RAD7, RAD16, and MMS19, have been identified in humans, and mutations in these human genes affect NER in a similar fashion as they do in yeast, with the exception of XPC, the human counterpart of yeast RAD4. Deletion of RAD4 causes the same high level of UV sensitivity as do mutations in the other class 1 genes, and rad4 mutants are completely defective in incision. By contrast, XPC is required for the repair of nontranscribed regions of the genome but not for the repair of the transcribed DNA strand. This entry represents the DNA-binding domain of Rad4, which has a beta-hairpin structure []. Rad4 inserts a beta-hairpin through the DNA duplex, causing the two damaged base pairs to flip out of the double helix. ; GO: 0003684 damaged DNA binding, 0006289 nucleotide-excision repair, 0005634 nucleus; PDB: 2QSG_A 2QSF_A 2QSH_A.
Probab=18.24  E-value=34  Score=20.82  Aligned_cols=11  Identities=36%  Similarity=0.782  Sum_probs=7.3

Q ss_pred             CCCcccCCcCC
Q psy14934         69 KQYQFWSTQPV   79 (87)
Q Consensus        69 k~yKFW~TQPV   79 (87)
                      .=|-||.|+|.
T Consensus        51 ~LYg~wQTe~y   61 (64)
T PF10404_consen   51 PLYGEWQTEPY   61 (64)
T ss_dssp             EEB-GGGEEE-
T ss_pred             cCCCHHHCccc
Confidence            44999999874


No 8  
>PF09562 RE_LlaMI:  LlaMI restriction endonuclease;  InterPro: IPR019063 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].   This entry includes the restriction endonuclease LlaMI, which recognises and cleaves the double-stranded sequence CC^NGG. 
Probab=16.06  E-value=71  Score=25.54  Aligned_cols=15  Identities=40%  Similarity=0.755  Sum_probs=12.1

Q ss_pred             CCCcccCCcCCCCCC
Q psy14934         69 KQYQFWSTQPVPKIV   83 (87)
Q Consensus        69 k~yKFW~TQPVPKld   83 (87)
                      ..-.=|+-+|||++.
T Consensus       113 ~~R~SWSGspiPk~~  127 (271)
T PF09562_consen  113 NNRYSWSGSPIPKIN  127 (271)
T ss_pred             CCcccccCCcCCCcc
Confidence            445669999999985


No 9  
>PF05627 AvrRpt-cleavage:  Cleavage site for pathogenic type III effector avirulence factor Avr;  InterPro: IPR008700  This domain is conserved in small families of otherwise unrelated proteins in both mono-cots and di-cots, suggesting that it has a conserved, plant-specific function. It is found both in the plant RIN4 (resistance R membrane-bound host-target protein) where it appears to contribute to the binding of the protein to both RCS (AvrRpt2 auto-cleavage site) and AvrB, the virulence factor from the infecting bacterium []. The cleavage site for the AvrRpt2 avirulence protein would appear to be the sequence motifs VPQFGDW and LPKFGEW, both of which are highly conserved within the domain []. ; PDB: 2NUD_C.
Probab=15.49  E-value=57  Score=19.06  Aligned_cols=8  Identities=38%  Similarity=0.380  Sum_probs=1.4

Q ss_pred             cCCCCCCc
Q psy14934         77 QPVPKIVV   84 (87)
Q Consensus        77 QPVPKldE   84 (87)
                      -+||+|.+
T Consensus         6 ~~vPkFG~   13 (39)
T PF05627_consen    6 SHVPKFGE   13 (39)
T ss_dssp             ------SG
T ss_pred             CCCCCCCc
Confidence            37999976


No 10 
>KOG2422|consensus
Probab=14.55  E-value=79  Score=28.33  Aligned_cols=7  Identities=29%  Similarity=0.297  Sum_probs=4.0

Q ss_pred             cccCCcC
Q psy14934         72 QFWSTQP   78 (87)
Q Consensus        72 KFW~TQP   78 (87)
                      +-|-|+|
T Consensus       214 r~vl~kP  220 (665)
T KOG2422|consen  214 RTVLTKP  220 (665)
T ss_pred             eeEecCc
Confidence            5555655


Done!