Diaphorina citri psyllid: psy14934


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MLLLKKKKQKADEGSGNPSKAVENGGGGEDQATNSEGGVNFSIQEIRKAMEVFSLQQRSAKTPEEALQKQYQFWSTQPVPKIVVTIG
cccHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHcccccccccccccccccccc
************************************************AM********************YQFWSTQPVPKIVV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLLKKKKQKADEGSGNPSKAVENGGGGEDQATNSEGGVNFSIQEIRKAMEVFSLQQRSAKTPEEALQKQYQFWSTQPVPKIVVTIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycylpeptide N-tetradecanoyltransferase 1 Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.confidentO70310
Glycylpeptide N-tetradecanoyltransferase 1 Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.confidentQ5RAF3
Glycylpeptide N-tetradecanoyltransferase 1 Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.confidentQ8K1Q0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WUU, chain A
Confidence level:probable
Coverage over the Query: 70-82
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1rxt, chain A very confident Alignment | Template Structure