Query         psy14949
Match_columns 102
No_of_seqs    121 out of 1155
Neff          9.4 
Searched_HMMs 46136
Date          Fri Aug 16 16:34:25 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14949.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14949hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00405 cytochrome c; Provisi 100.0   3E-31 6.6E-36  157.3   9.6  102    1-102    12-113 (114)
  2 COG3474 Cytochrome c2 [Energy  100.0 2.4E-30 5.2E-35  153.8   8.9  100    1-101    29-130 (135)
  3 PTZ00048 cytochrome c; Provisi 100.0 7.6E-29 1.6E-33  147.5  10.1  101    1-102    13-113 (115)
  4 KOG3453|consensus               99.8 2.7E-19 5.8E-24  103.5   3.8  100    1-100     7-106 (110)
  5 TIGR03872 cytochrome_MoxG cyto  99.7 2.7E-17 5.8E-22  100.0   8.0   79    2-102    43-122 (133)
  6 TIGR02603 CxxCH_TIGR02603 puta  99.7 3.3E-16 7.2E-21   95.4   7.4   35    1-36      1-35  (133)
  7 TIGR03045 PS_II_C550 cytochrom  99.6 6.4E-16 1.4E-20   96.1   7.3   85    1-101    49-147 (159)
  8 PF13442 Cytochrome_CBB3:  Cyto  99.6 2.6E-16 5.7E-21   85.3   4.4   67    1-98      1-67  (67)
  9 PF00034 Cytochrom_C:  Cytochro  99.6 2.3E-18 5.1E-23   97.1  -4.0   89    3-102     1-91  (91)
 10 PRK13618 psbV cytochrome c-550  99.6 1.7E-15 3.6E-20   94.4   8.1   86    1-101    50-148 (163)
 11 CHL00183 petJ cytochrome c553;  99.6 1.2E-15 2.7E-20   89.8   6.9   80    1-101    24-103 (108)
 12 CHL00133 psbV photosystem II c  99.6 1.3E-15 2.8E-20   94.9   7.0   81    2-101    51-148 (163)
 13 PRK13621 psbV cytochrome c-550  99.6 9.4E-16   2E-20   95.5   6.0   85    2-101    65-154 (170)
 14 TIGR03046 PS_II_psbV2 photosys  99.6 1.3E-15 2.8E-20   94.0   6.2   85    2-101    54-143 (155)
 15 PRK13617 psbV cytochrome c-550  99.6 1.7E-15 3.7E-20   94.5   6.7   84    2-101    58-155 (170)
 16 PRK13697 cytochrome c6; Provis  99.6 5.1E-15 1.1E-19   87.4   6.8   80    1-101    26-105 (111)
 17 PRK13620 psbV cytochrome c-550  99.6 1.4E-14 2.9E-19   92.5   7.2   82    2-100   103-199 (215)
 18 COG2863 Cytochrome c553 [Energ  99.6 6.1E-15 1.3E-19   87.6   4.6   78    1-102    22-101 (121)
 19 TIGR03874 4cys_cytochr c-type   99.5 2.8E-14   6E-19   87.3   7.3   77    4-101    34-115 (143)
 20 TIGR00782 ccoP cytochrome c ox  99.5 4.9E-14 1.1E-18   95.4   7.8   79    3-102   203-282 (285)
 21 PRK13619 psbV cytochrome c-550  99.5   7E-14 1.5E-18   86.0   6.2   85    1-100    49-146 (160)
 22 TIGR00782 ccoP cytochrome c ox  99.5 2.8E-13 6.1E-18   91.7   8.4   80    4-102   108-193 (285)
 23 PRK14486 putative bifunctional  99.5 3.6E-13 7.8E-18   91.4   8.0   76    3-102   215-291 (294)
 24 PRK14487 cbb3-type cytochrome   99.4 2.8E-13   6E-18   87.3   6.1   98    4-102    52-159 (217)
 25 PRK13622 psbV cytochrome c-550  99.3 5.1E-12 1.1E-16   79.7   7.0   85    2-101    61-158 (180)
 26 COG3258 Cytochrome c [Energy p  99.3   1E-11 2.3E-16   81.9   7.2   82    2-101   161-251 (293)
 27 COG4654 Cytochrome c551/c552 [  99.3 6.7E-12 1.4E-16   71.8   3.8   83    1-101    21-105 (110)
 28 PF14495 Cytochrom_C550:  Cytoc  99.3 1.4E-11   3E-16   73.7   5.1   84    2-100    24-120 (135)
 29 COG2010 CccA Cytochrome c, mon  99.2 1.2E-11 2.7E-16   76.1   4.2   19    3-21     51-69  (150)
 30 TIGR00781 ccoO cytochrome c ox  99.1 2.4E-10 5.2E-15   74.4   5.9   77    4-81     51-135 (232)
 31 PRK14486 putative bifunctional  99.1 4.6E-10 9.9E-15   76.4   6.6   75    3-81     51-136 (294)
 32 TIGR03791 TTQ_mauG tryptophan   98.9 1.4E-08   3E-13   69.1   7.5   99    3-102   159-279 (291)
 33 COG2857 CYT1 Cytochrome c1 [En  98.4 1.3E-06 2.8E-11   58.4   6.5   41   61-101   172-212 (250)
 34 PF02433 FixO:  Cytochrome C ox  98.3 5.9E-06 1.3E-10   54.1   7.0   74    4-81     51-135 (226)
 35 PF09098 Dehyd-heme_bind:  Quin  98.1 1.6E-06 3.5E-11   54.0   1.3   19    5-23      2-20  (167)
 36 PRK14485 putative bifunctional  98.0 2.8E-05   6E-10   58.7   7.4   94    4-101   538-647 (712)
 37 PF06537 DUF1111:  Protein of u  98.0 2.8E-06 6.1E-11   61.3   1.2   20    2-21    362-382 (499)
 38 PF09086 DUF1924:  Domain of un  97.8 2.3E-05 5.1E-10   44.8   3.1   20    2-21     10-38  (98)
 39 COG3245 CycB Cytochrome c5 [En  97.8 8.8E-05 1.9E-09   43.9   5.3   17    5-21     49-65  (126)
 40 COG2993 CcoO Cbb3-type cytochr  97.7 6.4E-06 1.4E-10   52.8  -0.0   53   49-101   105-159 (227)
 41 PF02167 Cytochrom_C1:  Cytochr  97.7 2.9E-05 6.3E-10   51.0   2.2   20    2-21     14-33  (219)
 42 TIGR03806 chp_HNE_0200 conserv  97.4 0.00059 1.3E-08   47.2   6.3   36   63-101   280-317 (317)
 43 PF10643 Cytochrome-c551:  Phot  97.2 7.7E-05 1.7E-09   48.3   0.3   20    2-21    168-187 (233)
 44 COG1858 MauG Cytochrome c pero  97.0  0.0022 4.8E-08   45.1   5.5   18    4-21    221-240 (364)
 45 TIGR02162 torC trimethylamine-  97.0 0.00076 1.7E-08   47.8   3.0   18    4-21    322-339 (386)
 46 PF14376 Haem_bd:  Haem-binding  96.9  0.0024 5.3E-08   39.1   4.5   20   83-102   118-137 (137)
 47 COG3748 Predicted membrane pro  96.8  0.0068 1.5E-07   42.1   6.3   16   85-100   387-402 (407)
 48 KOG3052|consensus               96.7 0.00068 1.5E-08   45.3   0.8   18    3-20     95-112 (311)
 49 PRK15032 trimethylamine N-oxid  96.6  0.0019   4E-08   46.0   2.7   18    4-21    319-336 (390)
 50 TIGR03791 TTQ_mauG tryptophan   96.5 0.00096 2.1E-08   45.7   0.9   20    3-22      6-34  (291)
 51 COG3258 Cytochrome c [Energy p  95.9   0.024 5.1E-07   38.3   4.8   14   87-100   121-134 (293)
 52 PF03150 CCP_MauG:  Di-haem cyt  94.9   0.014   3E-07   36.7   1.4   19    3-21      5-32  (159)
 53 PF09626 DHC:  Dihaem cytochrom  94.2   0.097 2.1E-06   31.4   3.8   11   10-20      1-11  (120)
 54 COG3488 Predicted thiol oxidor  94.1   0.028   6E-07   39.4   1.5   20    2-21    350-370 (481)
 55 COG2857 CYT1 Cytochrome c1 [En  91.9   0.024 5.2E-07   38.1  -1.4   21    2-22     42-62  (250)
 56 PF07635 PSCyt1:  Planctomycete  91.0    0.13 2.7E-06   26.9   1.1    9   14-22      1-9   (59)
 57 PF06537 DUF1111:  Protein of u  85.1    0.55 1.2E-05   34.7   1.6   17    9-25     66-83  (499)
 58 COG1858 MauG Cytochrome c pero  84.8    0.54 1.2E-05   33.4   1.4   20    3-22     62-90  (364)
 59 PF09832 DUF2059:  Uncharacteri  83.0     1.2 2.7E-05   23.2   2.0   17   84-100    15-31  (64)
 60 PF07627 PSCyt3:  Protein of un  79.6    0.75 1.6E-05   26.8   0.5    8   13-20     71-78  (101)
 61 TIGR03153 cytochr_NrfH cytochr  78.9    0.77 1.7E-05   28.0   0.4   16    5-20     96-111 (135)
 62 PF08090 Enterotoxin_HS1:  Heat  77.0    0.88 1.9E-05   20.7   0.2   10   12-21     20-29  (36)
 63 COG3488 Predicted thiol oxidor  75.0     1.3 2.8E-05   31.4   0.7   19    9-27     93-112 (481)
 64 PF07583 PSCyt2:  Protein of un  73.9     1.5 3.2E-05   28.8   0.7    7   13-19    176-182 (208)
 65 PF11845 DUF3365:  Protein of u  71.0     1.2 2.7E-05   28.1  -0.2    8   12-19    147-154 (188)
 66 PF15182 OTOS:  Otospiralin      64.9     8.9 0.00019   20.4   2.3   23   78-101    15-37  (69)
 67 COG2996 Predicted RNA-bindinin  62.4      15 0.00032   25.4   3.6   31   60-95    226-256 (287)
 68 PF02304 Phage_B:  Scaffold pro  62.3     6.1 0.00013   23.2   1.6   18    2-19     63-82  (117)
 69 TIGR01904 GSu_C4xC__C2xCH Geob  61.2     3.2   7E-05   20.2   0.3    6   13-18     37-42  (42)
 70 TIGR01905 paired_CXXCH_1 doubl  60.3     3.5 7.6E-05   19.8   0.3    9   13-21      8-16  (41)
 71 PHA00003 B internal scaffoldin  58.2     8.2 0.00018   22.7   1.6   18    2-19     66-85  (120)
 72 PF09699 Paired_CXXCH_1:  Doubl  56.9     3.4 7.4E-05   19.5  -0.1    9   13-21      8-16  (41)
 73 PF06943 zf-LSD1:  LSD1 zinc fi  54.4     5.7 0.00012   17.1   0.4    8   13-20     18-25  (25)
 74 COG3043 NapB Nitrate reductase  53.3      11 0.00023   23.6   1.7    8   13-20     88-95  (155)
 75 PF12162 STAT1_TAZ2bind:  STAT1  53.2      18  0.0004   15.1   2.1   18   77-98      5-22  (23)
 76 PF09722 DUF2384:  Protein of u  52.8      11 0.00023   18.9   1.4   41   60-101    10-50  (54)
 77 PF13822 ACC_epsilon:  Acyl-CoA  52.5      15 0.00033   19.2   2.0   16   86-101    11-26  (62)
 78 cd07321 Extradiol_Dioxygenase_  52.2     7.7 0.00017   21.3   0.8   31   60-96     15-45  (77)
 79 COG3445 Acid-induced glycyl ra  52.1      18 0.00039   21.1   2.3   38   58-96     77-120 (127)
 80 TIGR02826 RNR_activ_nrdG3 anae  51.2      36 0.00078   21.0   3.8    9   13-21     28-36  (147)
 81 PHA02902 putative IMV membrane  50.6      20 0.00043   19.1   2.2   20   81-100    49-68  (70)
 82 PF14769 CLAMP:  Flagellar C1a   50.3      47   0.001   18.9   4.1   18   83-100    61-78  (101)
 83 PF04320 DUF469:  Protein with   49.3      25 0.00054   20.5   2.7   18   84-101    68-85  (101)
 84 PRK11586 napB nitrate reductas  48.5      13 0.00029   23.1   1.6    6   14-19     83-88  (149)
 85 cd07921 PCA_45_Doxase_A_like S  47.7      11 0.00024   22.2   1.0   31   60-96     25-55  (106)
 86 TIGR01053 LSD1 zinc finger dom  46.4     6.6 0.00014   17.7   0.0    9   13-21     21-29  (31)
 87 PHA02119 hypothetical protein   46.4      14 0.00031   20.0   1.3   10   92-101    57-66  (87)
 88 cd06395 PB1_Map2k5 PB1 domain   44.6      21 0.00046   20.0   1.8   15   86-100    57-71  (91)
 89 COG3303 NrfA Formate-dependent  44.5     8.2 0.00018   27.9   0.2   14    8-21    327-340 (501)
 90 PF14522 Cytochrome_C7:  Cytoch  44.1     9.2  0.0002   19.5   0.3    9   12-20     13-21  (65)
 91 PF03892 NapB:  Nitrate reducta  43.9      12 0.00027   22.9   0.9    7   14-20     72-78  (133)
 92 COG3184 Uncharacterized protei  43.1      12 0.00025   24.1   0.7   19   82-100   104-122 (183)
 93 PF11256 DUF3055:  Protein of u  42.5      30 0.00066   19.3   2.2   15   87-101    67-81  (81)
 94 PF07128 DUF1380:  Protein of u  41.5      69  0.0015   19.8   3.9   33   57-100    25-57  (139)
 95 PHA02681 ORF089 virion membran  41.0      31 0.00067   19.4   2.1   20   81-100    47-66  (92)
 96 PF14537 Cytochrom_c3_2:  Cytoc  40.9      14  0.0003   19.5   0.7    8   13-20      8-15  (80)
 97 PF13435 Cytochrome_C554:  Cyto  39.5      13 0.00029   21.1   0.6    9   13-21     50-58  (130)
 98 COG3005 TorC Nitrate/TMAO redu  39.3      12 0.00026   24.3   0.4   10   12-21    135-144 (190)
 99 PRK11702 hypothetical protein;  38.9      41  0.0009   19.9   2.5   18   84-101    75-92  (108)
100 PF06252 DUF1018:  Protein of u  38.9      34 0.00073   20.2   2.2   13   87-99     56-68  (119)
101 CHL00037 petA cytochrome f      38.8      10 0.00023   26.4   0.0    8   14-21     56-63  (320)
102 PRK02693 apocytochrome f; Revi  37.9      11 0.00024   26.1   0.1    8   14-21     49-56  (312)
103 PF07102 DUF1364:  Protein of u  37.2     8.4 0.00018   22.2  -0.5    8   13-20     53-60  (94)
104 PF13453 zf-TFIIB:  Transcripti  37.0      11 0.00024   17.8  -0.0    8   13-20     21-28  (41)
105 PF13821 DUF4187:  Domain of un  36.6      32  0.0007   17.6   1.7   15   87-101    12-26  (55)
106 TIGR02161 napC_nirT periplasmi  36.2      15 0.00032   23.8   0.4   10   12-21    136-145 (185)
107 PF10058 DUF2296:  Predicted in  36.2      14  0.0003   18.9   0.3   10   13-22     24-33  (54)
108 smart00386 HAT HAT (Half-A-TPR  36.1      31 0.00066   14.2   1.4   18    1-18      1-18  (33)
109 cd08168 Cytochrom_C3 Heme-bind  35.8      13 0.00029   20.3   0.2   14    8-21     55-68  (85)
110 PF03264 Cytochrom_NNT:  NapC/N  35.6      19  0.0004   22.7   0.8   16    6-21    115-134 (173)
111 PF02085 Cytochrom_CIII:  Class  35.3      15 0.00032   20.9   0.3    9   13-21     78-86  (102)
112 cd07922 CarBa CarBa is the A s  33.6      22 0.00048   19.8   0.8   31   60-96     16-46  (81)
113 KOG3507|consensus               33.5      17 0.00037   19.0   0.3    9   13-21     22-30  (62)
114 PF08263 LRRNT_2:  Leucine rich  33.2      54  0.0012   15.3   2.1   14   88-101     2-15  (43)
115 PF13986 DUF4224:  Domain of un  33.1      26 0.00057   17.3   1.0   13   85-97      2-14  (47)
116 PF02335 Cytochrom_C552:  Cytoc  32.8      20 0.00044   26.3   0.7    9   11-19    272-280 (434)
117 TIGR03092 SASP_sspI small, aci  32.7      46 0.00099   17.8   1.9   41   60-100    14-62  (65)
118 PF11829 DUF3349:  Protein of u  32.4      50  0.0011   19.1   2.1   16   84-99     34-49  (96)
119 KOG1200|consensus               31.7      59  0.0013   21.8   2.6   20   81-100   218-237 (256)
120 PF10955 DUF2757:  Protein of u  31.6      13 0.00028   20.5  -0.3   13   86-98     32-44  (76)
121 TIGR03152 cyto_c552_HCOOH form  31.5      18 0.00039   26.6   0.3   11   10-20    273-283 (439)
122 PF06883 RNA_pol_Rpa2_4:  RNA p  30.3      46   0.001   17.2   1.6   17   86-102     4-20  (58)
123 cd07923 Gallate_dioxygenase_C   30.2      26 0.00057   20.1   0.8   31   60-96     17-47  (94)
124 PRK10617 cytochrome c-type pro  30.1      20 0.00043   23.5   0.3   10   12-21    145-154 (200)
125 CHL00136 rpl31 ribosomal prote  29.8      21 0.00045   19.2   0.3    8   12-19     36-43  (68)
126 TIGR03631 bact_S13 30S ribosom  29.7      61  0.0013   19.1   2.3   17   84-100    44-60  (113)
127 PF07295 DUF1451:  Protein of u  29.4      55  0.0012   20.3   2.1   36   60-100    12-47  (146)
128 COG1579 Zn-ribbon protein, pos  29.0      20 0.00044   24.2   0.2    8   13-20    199-206 (239)
129 COG0099 RpsM Ribosomal protein  28.9      63  0.0014   19.5   2.2   17   84-100    46-62  (121)
130 TIGR03146 cyt_nit_nrfB cytochr  28.8      19 0.00041   22.1   0.0    8   13-20     42-49  (145)
131 CHL00137 rps13 ribosomal prote  28.8      65  0.0014   19.4   2.3   17   84-100    46-62  (122)
132 PRK00019 rpmE 50S ribosomal pr  28.5      22 0.00048   19.3   0.3    8   12-19     36-43  (72)
133 PF14098 SSPI:  Small, acid-sol  28.3      68  0.0015   17.1   2.1   41   60-100    15-63  (65)
134 PF07757 AdoMet_MTase:  Predict  28.2      36 0.00078   20.2   1.1   13   89-102    38-50  (112)
135 PF05927 Penaeidin:  Penaeidin;  27.9      27 0.00059   18.8   0.5   10   12-21     44-53  (73)
136 PF11293 DUF3094:  Protein of u  27.6      77  0.0017   16.3   2.1   16   85-100     3-18  (55)
137 cd04860 AE_Prim_S AE_Prim_S: p  27.3      59  0.0013   21.8   2.2   16   85-100   150-165 (232)
138 TIGR03823 FliZ flagellar regul  27.0      19 0.00042   22.7  -0.2    9   12-20     23-31  (168)
139 PF09695 YtfJ_HI0045:  Bacteria  26.9      74  0.0016   20.2   2.4   17   84-100   143-159 (160)
140 PF13099 DUF3944:  Domain of un  26.7      81  0.0018   14.7   2.0   14   85-98     12-25  (35)
141 PRK05179 rpsM 30S ribosomal pr  26.5      75  0.0016   19.1   2.3   17   84-100    46-62  (122)
142 PF12123 Amidase02_C:  N-acetyl  26.5      81  0.0017   15.5   2.0   17   84-100    22-38  (45)
143 PRK11659 cytochrome c nitrite   26.4      22 0.00048   22.8   0.0    9   13-21     74-82  (183)
144 TIGR02251 HIF-SF_euk Dullard-l  26.3      80  0.0017   19.5   2.5   22   81-102   137-158 (162)
145 PRK02955 small acid-soluble sp  26.1      68  0.0015   17.3   1.8   41   60-100    17-65  (68)
146 COG1365 Predicted ATPase (PP-l  25.8      19 0.00041   24.1  -0.3    7   14-20    135-141 (255)
147 PF09601 DUF2459:  Protein of u  25.8      69  0.0015   20.4   2.2   15   86-100    98-112 (173)
148 PF12408 DUF3666:  Ribose-5-pho  25.7      53  0.0012   16.4   1.3   12   90-101    37-48  (48)
149 cd03271 ABC_UvrA_II The excisi  25.6      29 0.00063   23.5   0.5   20   81-101   199-218 (261)
150 PRK01397 50S ribosomal protein  25.6      27 0.00059   19.3   0.3    8   12-19     35-42  (78)
151 TIGR03629 arch_S13P archaeal r  25.5      79  0.0017   19.6   2.4   17   84-100    50-66  (144)
152 PRK11125 nrfA cytochrome c nit  25.5      27 0.00058   26.1   0.3   10   10-19    311-320 (480)
153 KOG1605|consensus               25.2 1.3E+02  0.0028   20.7   3.5   22   81-102   226-247 (262)
154 PF09343 DUF2460:  Conserved hy  25.1      84  0.0018   20.6   2.5   17   85-101    50-66  (198)
155 PRK11032 hypothetical protein;  25.1      74  0.0016   20.1   2.2   17   84-100    41-57  (160)
156 PF09383 NIL:  NIL domain;  Int  25.0      81  0.0017   16.7   2.1   15   87-101    55-69  (76)
157 PRK11582 flagella biosynthesis  24.6      22 0.00048   22.5  -0.2    9   12-20     23-31  (169)
158 PF13709 DUF4159:  Domain of un  24.6      73  0.0016   20.8   2.2   16   85-100    66-81  (207)
159 COG0633 Fdx Ferredoxin [Energy  24.2      27 0.00059   20.1   0.1    8   13-20     44-51  (102)
160 PF15332 LIME1:  Lck-interactin  24.0      29 0.00063   22.9   0.2    8   14-21      2-9   (228)
161 PTZ00134 40S ribosomal protein  23.6      87  0.0019   19.7   2.3   17   84-100    59-75  (154)
162 TIGR00778 ahpD_dom alkylhydrop  23.5      82  0.0018   15.0   1.8   11   87-97     38-48  (50)
163 PF14053 DUF4248:  Domain of un  23.2      79  0.0017   16.9   1.8   18   81-98     49-66  (69)
164 TIGR00105 L31 ribosomal protei  23.1      32  0.0007   18.4   0.3    8   12-19     36-43  (68)
165 PF15161 Neuropep_like:  Neurop  23.0      27 0.00058   18.2  -0.1   16    5-20      5-22  (65)
166 PRK13696 hypothetical protein;  23.0      25 0.00053   18.6  -0.2   19   77-95     41-59  (62)
167 PF04270 Strep_his_triad:  Stre  22.9   1E+02  0.0022   15.7   2.1   17   84-100    36-52  (53)
168 PRK00528 rpmE 50S ribosomal pr  22.8      33 0.00071   18.5   0.3    8   12-19     38-45  (71)
169 PF13447 Multi-haem_cyto:  Seve  22.8      46 0.00099   22.8   1.0   12    8-19    210-221 (267)
170 PF01197 Ribosomal_L31:  Riboso  22.5      34 0.00074   18.3   0.3    9   12-20     37-45  (69)
171 PRK04053 rps13p 30S ribosomal   22.4   1E+02  0.0022   19.3   2.4   17   84-100    54-70  (149)
172 PRK01678 rpmE2 50S ribosomal p  22.3      34 0.00074   19.4   0.3    8   12-19     49-56  (87)
173 PF11116 DUF2624:  Protein of u  22.2 1.3E+02  0.0029   16.9   2.6   15   86-100    31-45  (85)
174 PF09286 Pro-kuma_activ:  Pro-k  21.8      87  0.0019   18.8   2.0   14   87-100    60-73  (143)
175 cd07347 harmonin_N_like N-term  21.4      98  0.0021   17.1   2.0   17   84-100    14-30  (78)
176 TIGR03507 decahem_SO1788 decah  21.4      37 0.00079   26.4   0.4   10   12-21    294-303 (664)
177 PF14317 YcxB:  YcxB-like prote  21.3      95  0.0021   15.1   1.9   15   85-99     48-62  (62)
178 PF06648 DUF1160:  Protein of u  20.7      66  0.0014   19.4   1.3   14   86-99     99-112 (122)
179 PF09966 DUF2200:  Uncharacteri  20.6      95  0.0021   18.4   1.9   13   87-99     24-36  (111)
180 PF15614 WHIM3:  WSTF, HB1, Itc  20.2 1.2E+02  0.0025   15.1   1.9   12   87-98      6-17  (46)
181 PF07746 LigA:  Aromatic-ring-o  20.2      31 0.00067   19.5  -0.2   31   60-96     10-40  (88)
182 COG5204 SPT4 Transcription elo  20.1 1.5E+02  0.0032   17.2   2.5   36   60-95     62-97  (112)
183 PF02591 DUF164:  Putative zinc  20.1      39 0.00085   17.0   0.2    7   13-19     24-30  (56)

No 1  
>PTZ00405 cytochrome c; Provisional
Probab=99.97  E-value=3e-31  Score=157.31  Aligned_cols=102  Identities=53%  Similarity=1.045  Sum_probs=95.2

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCCCCcc
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIPGTKM   80 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m   80 (102)
                      ||+++|+++|..+|++||.++..+.+.+||+|.++.++..++.++|.|+..+...++.|+.+.|..||.+|..+.|++.|
T Consensus        12 gd~~~G~~lF~~~C~aCH~~~~~~~~~vGP~L~gv~gR~~g~~~~~~YS~al~~~g~~wd~~~L~~~l~~P~~~~pgt~M   91 (114)
T PTZ00405         12 GDAERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRKSGTVEGFAYSKANADSGVIWTPEVLDVYLENPKKFMPGTKM   91 (114)
T ss_pred             cCHHHHHHHHHhhhHhhCCCCCCCCCCcCCCccccccCccccccCccccHHHHhccCcCCHHHHHHHHHCHHhhCCCCCC
Confidence            57899999999889999998755567899999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCHHHHHHHHHHHhhcC
Q psy14949         81 VFPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      +|.++.+++|+.+|++||++|+
T Consensus        92 ~f~gl~~~~dr~~liaYL~sl~  113 (114)
T PTZ00405         92 SFAGIKKPQERADVIAYLETLK  113 (114)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhc
Confidence            9999989999999999999985


No 2  
>COG3474 Cytochrome c2 [Energy production and conversion]
Probab=99.97  E-value=2.4e-30  Score=153.80  Aligned_cols=100  Identities=53%  Similarity=1.058  Sum_probs=95.7

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhc--CccccHHHHHHHHhCCCCCCCCC
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNK--GITWSASTLDIYLQNPKKYIPGT   78 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~l~~~~~~~~~~~~~~   78 (102)
                      ||+..|+.+|++ |.+||+++.++.+.+||.|.++.+|..++.++|.|+..+...  ++.|+++.|..||++|+.+.|||
T Consensus        29 ~da~~G~~vFkk-C~~CH~i~~~g~nkvGP~L~gVvGR~ags~egf~YS~Amk~~~~g~vWd~~~L~~fL~~Pkk~vpGT  107 (135)
T COG3474          29 GDAAAGEKVFKK-CQACHSIEKGGPNKVGPHLWGVVGRPAGSVEGFSYSAAMKKAGGGIVWDEDNLDEFLTAPKKYVPGT  107 (135)
T ss_pred             ccHHHhHHHHHH-HHHhhccccCCCCCCCCccccccCccccccCCcccCHHHHhccCCcccCHHHHHHHHhChhhhCCCc
Confidence            588999999987 999999998888999999999999999999999999999988  89999999999999999999999


Q ss_pred             ccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         79 KMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        79 ~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                      .|.|.++-.++|+.+||+||+++
T Consensus       108 kM~faGlkk~~dradlIAYLk~~  130 (135)
T COG3474         108 KMAFAGLKKDQDRADLIAYLKSL  130 (135)
T ss_pred             ceeecCCCCHHHHHHHHHHHHhc
Confidence            99999998999999999999985


No 3  
>PTZ00048 cytochrome c; Provisional
Probab=99.96  E-value=7.6e-29  Score=147.48  Aligned_cols=101  Identities=58%  Similarity=1.001  Sum_probs=92.4

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCCCCcc
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIPGTKM   80 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m   80 (102)
                      +++++|+++|+++|++||++++.+...+||+|.++.++..+. ++|.|+..+...++.|+++.|..||.+|+...|++.|
T Consensus        13 ~~~~~G~~~f~~~C~~CH~~~~~g~~~~GP~L~Gi~gR~~g~-~~~~ys~~~~~~g~~wt~~~L~~~l~~P~~~~pgt~M   91 (115)
T PTZ00048         13 GDAKKGAKLFKAKCAQCHTINKGGAVKQGPNLHGFYGRKSGS-ADFPYSDANKNSGIVWSDKHLFEYLVNPKLYIPGTKM   91 (115)
T ss_pred             ccHHHHHHHHHhhhhhcCCCcCCCCCCcCCcccccccccccC-CCCccchhhhhcccccCHHHHHHHHhCcCccCCCCcc
Confidence            578899999998999999998766678999999999998887 7888888887888999999999999999999999999


Q ss_pred             CCCCCCCHHHHHHHHHHHhhcC
Q psy14949         81 VFPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      +|.++.+++|+.+|++||+++.
T Consensus        92 ~~~gl~~~~~~~~liaYL~s~~  113 (115)
T PTZ00048         92 VFAGIKKEKERADLIAYLKEAS  113 (115)
T ss_pred             CcCCCCCHHHHHHHHHHHHHhc
Confidence            9999888999999999999873


No 4  
>KOG3453|consensus
Probab=99.77  E-value=2.7e-19  Score=103.49  Aligned_cols=100  Identities=64%  Similarity=1.118  Sum_probs=93.0

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCCCCcc
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIPGTKM   80 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m   80 (102)
                      +|++.|+.+|.+.|+.||..+..+....+|++.++.++..+...+|.++.....-++.|.++.|..++.+|..+.||+-|
T Consensus         7 ~d~~~g~~~f~~rc~qch~~~~~~~~k~~p~l~gl~g~~~g~~~~~sy~~a~KnKgV~wgE~tl~eyLenpkkyipGtKm   86 (110)
T KOG3453|consen    7 GDVEKGKKIFPQRCAQCHTVEKGGFHKTGPNLHGLFGRQLGQAAGLSYTDANKNKGVTWGEDTLMEYLENPKKYIPGTKM   86 (110)
T ss_pred             cccccccccceeeccccccccCCcccccCCcchhhHHHhhccccCcceeecccCCceEEcchhHHHHHhCCCccccccce
Confidence            57889999999999999999877777899999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCHHHHHHHHHHHhh
Q psy14949         81 VFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~s  100 (102)
                      -|.++-...|..++++||.+
T Consensus        87 ifaGikk~~eraDlIayl~k  106 (110)
T KOG3453|consen   87 IFAGIKKKAERADLIAYLKK  106 (110)
T ss_pred             eecccCchHHHHHHHHHHHH
Confidence            99988666999999999975


No 5  
>TIGR03872 cytochrome_MoxG cytochrome c(L), periplasmic. This model describes a periplasmic c-type cytochrome that serves as the primary electron acceptor for the quinoprotein methanol dehydrogenase, a PQQ enzyme. The member from Paracoccus denitrificans is also characterized as an electron acceptor for methylamine dehydrogenase, a tryptophan tryptophylquinone enzyme. This protein is called cytochrome c(L) in methylotrophic bacteria such Methylobacterium extorquens, but c551i in Paracoccus denitrificans.
Probab=99.73  E-value=2.7e-17  Score=100.00  Aligned_cols=79  Identities=19%  Similarity=0.259  Sum_probs=55.3

Q ss_pred             cHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCCCCcc-
Q psy14949          2 SVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIPGTKM-   80 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m-   80 (102)
                      .++.|+++|..+|++||+.++.|.  .+|+|.+.......                ....+.+...+.++.    ..+| 
T Consensus        43 ~~a~G~~ly~~~CAaCHG~~g~G~--~gP~L~~~~~~~~~----------------~~~~~~l~~~i~~G~----~g~Mp  100 (133)
T TIGR03872        43 ALKKGESLFATACSGCHGHLAEGK--LGPGLNDDYWTYPK----------------NTTDKGLFETIFGGA----NGMMG  100 (133)
T ss_pred             HHHHHHHHHHHhhHHhCCCCCCCC--CCCCCcCcccccCC----------------cccHHHHHHHHHcCC----CCCCc
Confidence            357899999999999999987543  46888764321110                012344666666653    2356 


Q ss_pred             CCCCCCCHHHHHHHHHHHhhcC
Q psy14949         81 VFPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      ++...|+++||++|++||++++
T Consensus       101 ~~~~~LsdeeI~aLaaYI~sl~  122 (133)
T TIGR03872       101 PQYGNLTLDEMLQIMAWIRHLY  122 (133)
T ss_pred             ccccCCCHHHHHHHHHHHHHhC
Confidence            5777789999999999999975


No 6  
>TIGR02603 CxxCH_TIGR02603 putative heme-binding domain, Pirellula/Verrucomicrobium type. This model represents a domain limited to very few species but expanded into large paralogous families in some species that conain it. We find it in over 20 copies each in Pirellula sp. strain 1 (phylum Planctomycetes) and Verrucomicrobium spinosum DSM 4136 (phylum Verrucomicrobia), and no matches above trusted cutoff an any other species so far. This domain, about 140 amino acids long, contains an absolutely conserved motif CxxCH, the cytochrome c family heme-binding site signature (PS00190).
Probab=99.67  E-value=3.3e-16  Score=95.40  Aligned_cols=35  Identities=37%  Similarity=0.732  Sum_probs=30.3

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCc
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVV   36 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~   36 (102)
                      ||+++|+.+|..+|++||++++.| ...||+|.++.
T Consensus         1 gd~~~G~~~f~~~C~~CH~~~g~g-~~~gP~L~~~~   35 (133)
T TIGR02603         1 GDAEKGKAVYAQRCYVCHRIGGEG-VDVGPDLTGVG   35 (133)
T ss_pred             CCHHHHHHHHHhHHHHhCCCCCCC-CccCCCccccc
Confidence            789999999998899999999754 46799998864


No 7  
>TIGR03045 PS_II_C550 cytochrome c-550. Members of this protein family are cytochrome c-550, the PsbV extrinsic protein of photosystem II, from both Cyanobacteria and chloroplasts. A paralog to this protein, PsbV2, is found in some species in addition to PsbV itself.
Probab=99.65  E-value=6.4e-16  Score=96.09  Aligned_cols=85  Identities=19%  Similarity=0.251  Sum_probs=56.9

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCC-CCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCC-----
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGG-ANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKY-----   74 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g-~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~-----   74 (102)
                      +++++|+++|+.+|++||...... .+.+++.+..+.....                ...+.+.|.+|+++|..+     
T Consensus        49 ~~~~~Gk~lF~~~Ca~CH~~G~~~~~p~vgl~l~~L~~A~~----------------~r~~v~~Lv~~iknP~~~dg~~~  112 (159)
T TIGR03045        49 EQVKRGKRLFNTACGTCHVGGITKTNPNVGLDPEALALATP----------------PRDNVEALVDYMKNPTSYDGEES  112 (159)
T ss_pred             HhHHHHHHHHHHHHHHhCCCCCCCCCCCCCCChhhHHhcCC----------------CccCHHHHHHHHhCcccccccch
Confidence            367899999999999999522111 1233444433322110                012578899999999865     


Q ss_pred             --------CCCCccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         75 --------IPGTKMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        75 --------~~~~~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                              .+...||....||++|+++|++||..+
T Consensus       113 ~~~~hp~~k~~~~mP~~~~LsdeEL~avAaYIl~q  147 (159)
T TIGR03045       113 IAELHPSIRSADIFPKMRNLTDEDLRLIAGHILVQ  147 (159)
T ss_pred             hhhcccccCcccccCCcCCCCHHHHHHHHHHHHHh
Confidence                    345677755557999999999999764


No 8  
>PF13442 Cytochrome_CBB3:  Cytochrome C oxidase, cbb3-type, subunit III ; PDB: 1KB0_A 2DGE_D 2CE1_A 2CE0_A 2V07_A 1W2L_A 2ZOO_A 2ZBO_G 1DVV_A 2EXV_A ....
Probab=99.64  E-value=2.6e-16  Score=85.26  Aligned_cols=67  Identities=30%  Similarity=0.594  Sum_probs=49.8

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCCCCcc
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIPGTKM   80 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m   80 (102)
                      ++++.|+.+|.++|++||+.++     .||++.+.                      .|+.+.+..++.++..    .|.
T Consensus         1 a~~~~G~~ly~~~C~~CH~~~~-----~gp~l~~~----------------------~~~~~~l~~~i~~g~~----~Mp   49 (67)
T PF13442_consen    1 ADAAKGKALYEQNCASCHGPGG-----AGPSLAGK----------------------DWSPEELYNIIRNGRG----GMP   49 (67)
T ss_dssp             -HHHHHHHHHHHHTHHHHGTGS-----SSSTSTHH----------------------HHHHHHHHHHHHHTBT----TBS
T ss_pred             CcHHHHHHHHHhHhHHhcCCCc-----cCccchhh----------------------hhhHHHHHHHHHhCcC----CCC
Confidence            3688999999999999998332     24655431                      3356788889988773    233


Q ss_pred             CCCCCCCHHHHHHHHHHH
Q psy14949         81 VFPGLRKEKDREDLIAYL   98 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl   98 (102)
                      ++...||++|+++|++||
T Consensus        50 ~~~~~ls~~e~~~l~~yi   67 (67)
T PF13442_consen   50 PFGGQLSDEEIEALAAYI   67 (67)
T ss_dssp             CTTTTSTHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHC
Confidence            666678999999999997


No 9  
>PF00034 Cytochrom_C:  Cytochrome c;  InterPro: IPR003088 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes. Ambler [] recognised four classes of cytC. Class I includes the low-spin soluble cytC of mitochondria and bacteria, with the haem-attachment site towards the N terminus, and the sixth ligand provided by a methionine residue about 40 residues further on towards the C terminus. On the basis of sequence similarity, class I cytC were further subdivided into five classes, IA to IE. Class IB includes the eukaryotic mitochondrial cytC and prokaryotic 'short' cyt c2 exemplified by Rhodopila globiformis cyt c2; class IA includes 'long' cyt c2, such as Rhodospirillum rubrum cyt c2 and Aquaspirillum itersonii cyt c-550, which have several extra loops by comparison with class IB cytC.; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1YNR_B 2AI5_A 1AYG_A 3O5C_C 1YEA_A 3CXH_W 1YTC_A 1YEB_A 2YBB_Y 2B4Z_A ....
Probab=99.64  E-value=2.3e-18  Score=97.10  Aligned_cols=89  Identities=26%  Similarity=0.415  Sum_probs=49.0

Q ss_pred             HHhHHHHHHHhcccccCCCCCCCCCC-CCCccCCcCCcCCCCCCCccchhhhhcCccccHH-HHHHHHhCCCCCCCCCcc
Q psy14949          3 VENGKKIFTRACAQCHTANEGGANKV-GPNLFGVVGRQTGQAPGFDYTDANKNKGITWSAS-TLDIYLQNPKKYIPGTKM   80 (102)
Q Consensus         3 ~~~G~~lf~~~C~~CH~~~~~g~~~~-gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~~~~~~~~~~~~~~~m   80 (102)
                      +++|++||+.+|++||+.++.+.... +|+|.++..+.....     ...      .+... .+......+........|
T Consensus         1 a~~G~~l~~~~C~~CH~~~~~~~~~~~~p~l~~~~~~~~~~~-----~~~------~~~~~~~~~~~~~~~~~~~~~~~~   69 (91)
T PF00034_consen    1 AARGKELFQANCAACHGADGNGDGGGPGPDLTGIGKRYSYDW-----IGR------YITNPEAISPPAHMPDAMPMFPMM   69 (91)
T ss_dssp             HHHHHHHHHHHTTTTHBTSTTSSSSSTSHBHTTHTHHBTTHH-----THH------HHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ChhHHHHHhCcChhcCCCCCcCCccccCccccCccccchHHH-----HHH------HHHHHhhhccccchhhccCcccCC
Confidence            57899999879999999987654444 577877654332100     000      00001 000000000000111223


Q ss_pred             CCCCCCCHHHHHHHHHHHhhcC
Q psy14949         81 VFPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      +....||++|+++|++||++||
T Consensus        70 ~~~~~ls~~e~~~l~ayl~slk   91 (91)
T PF00034_consen   70 PMPKILSDEEIADLAAYLRSLK   91 (91)
T ss_dssp             HHHHTSSHHHHHHHHHHHHHTS
T ss_pred             cccCCCCHHHHHHHHHHHHHhC
Confidence            2222569999999999999986


No 10 
>PRK13618 psbV cytochrome c-550; Provisional
Probab=99.64  E-value=1.7e-15  Score=94.45  Aligned_cols=86  Identities=26%  Similarity=0.332  Sum_probs=60.4

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCC------
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKY------   74 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~------   74 (102)
                      +++++|+++|+++|++||. .  |.+..+|++.+......+..+            .+.+.+.|.+|+++|..+      
T Consensus        50 ~~~~~G~~lF~~~Ca~CH~-~--G~~~~~p~~~l~~~~La~a~p------------~rd~v~~l~~yik~P~~~Dg~~~~  114 (163)
T PRK13618         50 KQVKEGKRLFNYACAQCHA-G--GVTKTNQNVGLEPEALALATP------------NRDNIEGLVDYMKNPTTYDGEEEI  114 (163)
T ss_pred             hhHHHHHHHHHHHHHHhcC-C--CCCCCCCCcCCChhhhccCCC------------CccCHHHHHHHHhCchhccccchh
Confidence            4678999999999999994 3  346667766643221211111            012578899999999986      


Q ss_pred             -------CCCCccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         75 -------IPGTKMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        75 -------~~~~~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                             .+...||-...|||+|+.+|++||..+
T Consensus       115 ~~~h~~ik~~~~mP~~~~Lsd~eL~ava~yll~~  148 (163)
T PRK13618        115 SEIHPSIKSADIFTAMRNLTDKDLEAIAGHILVQ  148 (163)
T ss_pred             cccccccCccccCCCCCCCCHHHHHHHHHHHHhc
Confidence                   456677755557999999999999753


No 11 
>CHL00183 petJ cytochrome c553; Provisional
Probab=99.63  E-value=1.2e-15  Score=89.82  Aligned_cols=80  Identities=28%  Similarity=0.452  Sum_probs=54.0

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCCCCcc
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIPGTKM   80 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m   80 (102)
                      ++++.|+.+|..+|++||+..   .+..+|++....             +.+... ...+.+.+..+++++...||    
T Consensus        24 a~~~~G~~ly~~~Ca~CHg~g---~~~~~P~~~~~~-------------~~l~~~-~~~~~~~i~~~i~~G~~~MP----   82 (108)
T CHL00183         24 ADLDNGEQIFSANCAACHAGG---NNVIMPEKTLKK-------------DALEAN-SMNSIEAITYQVTNGKNAMP----   82 (108)
T ss_pred             ccHHHHHHHHHHHHHHHCCCC---CCCCCCCcccCH-------------HHHhhC-cCCCHHHHHHHHHcCccccc----
Confidence            367899999999999999842   344566653211             001000 11246788888988764222    


Q ss_pred             CCCCCCCHHHHHHHHHHHhhc
Q psy14949         81 VFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~sl  101 (102)
                      +|.+.||++|+++|++||.++
T Consensus        83 ~f~~~Ls~~ei~~i~aYi~~~  103 (108)
T CHL00183         83 AFGGRLSDEDIEDVANYVLSQ  103 (108)
T ss_pred             cccCCCCHHHHHHHHHHHHHh
Confidence            576778999999999999875


No 12 
>CHL00133 psbV photosystem II cytochrome c550; Validated
Probab=99.63  E-value=1.3e-15  Score=94.85  Aligned_cols=81  Identities=20%  Similarity=0.299  Sum_probs=55.4

Q ss_pred             cHHhHHHHHHHhcccccCCCCCCCCCCCCCc----cCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCC----
Q psy14949          2 SVENGKKIFTRACAQCHTANEGGANKVGPNL----FGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKK----   73 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~----   73 (102)
                      ++++|+++|+.+|++||..   |.+..+|.+    ..+....                ....+.+.|.+||++|..    
T Consensus        51 ~~~~Gk~lF~~~CaaCH~~---G~~~~~p~vgl~l~~L~~A~----------------~~r~~~~~Lv~~iknP~~ydg~  111 (163)
T CHL00133         51 QVKRGKRLFNASCGACHVG---GITKTNPNVGLDPEALSLAT----------------PPRDNIEALVDYMKNPTTYDGL  111 (163)
T ss_pred             HHHHHHHHHHhhHHHhCCC---CCCCCCCCCCCCHHHHhhcC----------------CCcccHHHHHHHHhCcccccch
Confidence            5789999999999999952   233334433    3222100                012257899999999987    


Q ss_pred             ---------CCCCCccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         74 ---------YIPGTKMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        74 ---------~~~~~~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                               ..++..||-...||++|+.+|++||..+
T Consensus       112 ~~i~~~~~~~K~~~~MPa~~~LsdeEL~aVAaYIl~q  148 (163)
T CHL00133        112 ESIAEIHPSIKSADIFPKMRSLTDEDLYAIAGHILLQ  148 (163)
T ss_pred             HHHHHhhcccCccccCCCCCCCCHHHHHHHHHHHHhc
Confidence                     3345668644667999999999998753


No 13 
>PRK13621 psbV cytochrome c-550; Provisional
Probab=99.62  E-value=9.4e-16  Score=95.48  Aligned_cols=85  Identities=24%  Similarity=0.446  Sum_probs=57.8

Q ss_pred             cHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCC-----
Q psy14949          2 SVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIP-----   76 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~-----   76 (102)
                      |++.|+++|..+|++||. .  |++.+.|..+.......+..+            ..-..+.|.+|+++|+.+.+     
T Consensus        65 d~~~G~~lF~~~Ca~CH~-g--G~n~v~p~ktL~~~~L~~a~p------------~rd~I~~LV~~iknPms~kg~~~~~  129 (170)
T PRK13621         65 QLTDGKQLFDSNCLNCHV-G--GATLPNPNVSLSLKDLRGATP------------PRDNIAALVAYQRDPMSYDGSEESY  129 (170)
T ss_pred             HHHhHHHHHHHHHHHhcc-C--CCCCcCCCCCCCHHHHhcCCC------------chHHHHHHHHHhhCCCCCCcccccc
Confidence            678999999999999994 2  345555644332211111100            11245789999999999876     


Q ss_pred             CCccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         77 GTKMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        77 ~~~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                      +..|+....||++|+.+|++||..+
T Consensus       130 ~~~mps~~~LSdeEL~aIAaYLL~q  154 (170)
T PRK13621        130 GCRQVPEDWMTDEELQNLAAFILRA  154 (170)
T ss_pred             cccCCccCCCCHHHHHHHHHHHHhh
Confidence            5556555667999999999999764


No 14 
>TIGR03046 PS_II_psbV2 photosystem II cytochrome PsbV2. Members of this protein family are PsbV2, a protein closely related cytochrome c-550 (PsbV), a protein important to the water-splitting and oxygen-evolving activity of photosystem II. Mutant studies in Thermosynechococcus elongatus showed PsbV2 can partially replace PsbV, from which it appears to have arisen first by duplication, then by intergenic recombination with a different gene.
Probab=99.62  E-value=1.3e-15  Score=94.04  Aligned_cols=85  Identities=25%  Similarity=0.451  Sum_probs=56.2

Q ss_pred             cHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCC-----
Q psy14949          2 SVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIP-----   76 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~-----   76 (102)
                      |+.+|+++|+.+|++||.-   |++.+.|..+..........+            .+-..+.|.+|+++|+.+.+     
T Consensus        54 d~~~G~~lF~~~Ca~CH~g---G~n~~~p~~~L~~~~L~~atp------------~Rd~I~~Lv~~iknP~s~kG~~~~~  118 (155)
T TIGR03046        54 QLTDGKNLFESNCLNCHVG---GATLPNPNVSLSLKDLKGATP------------PRDTIQSLVAYQRDPMSYDGSEESY  118 (155)
T ss_pred             HHHhHHHHHHHHHHHhccC---CCCCcCCCCCCCHHHHhcCCC------------chHHHHHHHHHhhCCcccCcccccc
Confidence            6789999999999999953   234444433222111111000            01135789999999998866     


Q ss_pred             CCccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         77 GTKMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        77 ~~~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                      +..|+....|+++|+++|++||..+
T Consensus       119 ~~~mp~~~~LsdeEL~aIAaYLl~q  143 (155)
T TIGR03046       119 GCRPVPEDWMDDEEVENLAAFILRA  143 (155)
T ss_pred             cccCCcccCCCHHHHHHHHHHHHHh
Confidence            4456655667999999999999764


No 15 
>PRK13617 psbV cytochrome c-550; Provisional
Probab=99.62  E-value=1.7e-15  Score=94.53  Aligned_cols=84  Identities=19%  Similarity=0.320  Sum_probs=59.8

Q ss_pred             cHHhHHHHHHHhcccccCCCCCC-CCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCC-----
Q psy14949          2 SVENGKKIFTRACAQCHTANEGG-ANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYI-----   75 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~~~g-~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~-----   75 (102)
                      ++++|+++|+.+|++||...+-. .+.+||+|..+.....                .+.+.+.|.+|+++|..+.     
T Consensus        58 ~~~~G~~~F~~~C~~CH~~g~T~~n~~vg~dL~~L~aa~p----------------~r~nv~aLv~yikdP~sydg~~s~  121 (170)
T PRK13617         58 EIKAGRKVFNTSCGTCHAGGITKTNQNVGLDPETLALATP----------------ARDNVDALVDYLKDPTSYDGEYSI  121 (170)
T ss_pred             HHHHHHHHHHcchhhhccCCCcCCCCCcCCCHHHHhccCC----------------CCCCHHHHHHHHhChHhhcchhhc
Confidence            46789999998999999654321 2457888854421110                1235789999999998766     


Q ss_pred             ----CCC----ccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         76 ----PGT----KMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        76 ----~~~----~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                          |+.    .||-...||++|+++|++||..+
T Consensus       122 ~e~~P~~~~~~imP~~~~LsdeeL~alAayLl~~  155 (170)
T PRK13617        122 ADLHPSMRSADLYPAMRDLNDEDLRLMAGYILVA  155 (170)
T ss_pred             cccCccccccccCcccCCCCHHHHHHHHHHHHhc
Confidence                553    56644446999999999999876


No 16 
>PRK13697 cytochrome c6; Provisional
Probab=99.59  E-value=5.1e-15  Score=87.43  Aligned_cols=80  Identities=24%  Similarity=0.428  Sum_probs=52.1

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCCCCcc
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIPGTKM   80 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m   80 (102)
                      +|++.|+.+|+.+|++||+.+. +....+|.+....               +...+ .++.+.+...++++...||    
T Consensus        26 ~~~~~G~~ly~~~C~~CHg~g~-~~~~~~p~l~~~~---------------~~~~~-~~~~~~l~~~i~~g~~~Mp----   84 (111)
T PRK13697         26 ADAANGEQVFSANCASCHAGGK-NLVNAGKTLKKAD---------------LEKYG-MYSLEAITAQVTNGKNAMP----   84 (111)
T ss_pred             cCHHHHHHHHHHHHHHhCCCCC-CCCCCCCCCCHHH---------------HHhcC-CCCHHHHHHHHHcCCCCCC----
Confidence            3567899999999999998532 1112244443211               00000 2346678888888753333    


Q ss_pred             CCCCCCCHHHHHHHHHHHhhc
Q psy14949         81 VFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~sl  101 (102)
                      +|...+|++|+++|++||.++
T Consensus        85 ~~~~~ls~~di~~l~~Yi~~~  105 (111)
T PRK13697         85 AFKDRLSPDQIEDVAAYVLEQ  105 (111)
T ss_pred             CCcCCCCHHHHHHHHHHHHHH
Confidence            676778999999999999875


No 17 
>PRK13620 psbV cytochrome c-550; Provisional
Probab=99.56  E-value=1.4e-14  Score=92.48  Aligned_cols=82  Identities=24%  Similarity=0.254  Sum_probs=59.9

Q ss_pred             cHHhHHHHHHHhcccccCCCCCC--CCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCC---
Q psy14949          2 SVENGKKIFTRACAQCHTANEGG--ANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIP---   76 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~~~g--~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~---   76 (102)
                      ++++|+++|++.|++|| +.|..  .+.++|+++.+.....                ...+.+.|..||++|..+.+   
T Consensus       103 q~~~GkqLF~~~Ca~CH-VgG~Tktnp~vgpdLt~LaaAtp----------------pRdn~e~Lv~wLkdP~sydg~~s  165 (215)
T PRK13620        103 QVAEGKQLFAYACGQCH-VGGITKTDPNVGLDPEALALATP----------------PRDSVESLVDYLHNPTTYDGERE  165 (215)
T ss_pred             HHHHHHHHHHhhhhhcc-CCCCCCCCCCCCCCHHHHhccCC----------------CCCCHHHHHHHHhCccccCCcch
Confidence            57899999999999999 44311  2355676664321110                02367899999999999887   


Q ss_pred             ----------CCccCCCCCCCHHHHHHHHHHHhh
Q psy14949         77 ----------GTKMVFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        77 ----------~~~m~~~~~ls~~e~~~l~~yl~s  100 (102)
                                +..||-...||++|+.+|+.|+.-
T Consensus       166 iae~HPs~~s~d~mP~~r~LtdedL~aIa~~IL~  199 (215)
T PRK13620        166 ISELHPSTKSTDIFPKMRNLTEDDLVAISGHILL  199 (215)
T ss_pred             hhhcCccccccccccccCCCCHHHHHHHHHHHhc
Confidence                      778875555699999999999864


No 18 
>COG2863 Cytochrome c553 [Energy production and conversion]
Probab=99.55  E-value=6.1e-15  Score=87.55  Aligned_cols=78  Identities=27%  Similarity=0.386  Sum_probs=54.8

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCC-CCCCCCc
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPK-KYIPGTK   79 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~-~~~~~~~   79 (102)
                      +|++.|+++|.+.|++||+.++.+.....|+|.++.                        .++|...++.-+ ...++..
T Consensus        22 ~~a~~G~~~~~~~Ca~CHG~~g~~~~~~~P~Lagq~------------------------~~yl~~~L~a~k~g~r~~~v   77 (121)
T COG2863          22 ADAALGKALAAQSCAACHGADGNSPAPGYPKLAGQS------------------------EAYLEKQLKAYKDGKRPGPV   77 (121)
T ss_pred             hhHHHHHHhhcchhhhccCCCCCCccCCCCCcCCCC------------------------HHHHHHHHHHHHcCCCCcch
Confidence            467899999988899999999876555567776543                        344444443222 1123345


Q ss_pred             c-CCCCCCCHHHHHHHHHHHhhcC
Q psy14949         80 M-VFPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        80 m-~~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      | .....|||+||.+|++|+.+++
T Consensus        78 M~~~a~~LsD~Di~~lAa~~a~~~  101 (121)
T COG2863          78 MNAIASGLSDEDIADLAAYYAAQK  101 (121)
T ss_pred             HHHHHHhCCHHHHHHHHHHHHhCC
Confidence            6 4566679999999999999874


No 19 
>TIGR03874 4cys_cytochr c-type cytochrome, methanol metabolism-related. This family represents a c-type cytochrome related to (but excluding) cytochrome c-555 of Methylococcus capsulatus. Members contain four invariant Cys residues, including two from a heme-binding motif shared with c-555, and two others.
Probab=99.55  E-value=2.8e-14  Score=87.30  Aligned_cols=77  Identities=22%  Similarity=0.320  Sum_probs=56.3

Q ss_pred             HhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCC---CCcc
Q psy14949          4 ENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIP---GTKM   80 (102)
Q Consensus         4 ~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~---~~~m   80 (102)
                      -.|+++|..+|++||+.++.|.. ..|+|.+....                    .+...|.+.|.++.....   ...|
T Consensus        34 ~~G~~lY~~~CAaCHG~dG~G~~-~~P~Lans~v~--------------------~s~~nli~vIl~G~~~~~~~~~~~M   92 (143)
T TIGR03874        34 YSGYRRYHSECHVCHGPDGMGST-YAPALKDSVKR--------------------MSYGDFLGVVANGRQNVSAAQNNVM   92 (143)
T ss_pred             ccHHHHHHHHHHHhCCCCCCCCC-CCCCCCCcccc--------------------CCHHHHHHHHHhCCCCCCCCCCCCC
Confidence            36999999999999999986543 57777532211                    146678888888775321   1346


Q ss_pred             -CCCCCCCHH-HHHHHHHHHhhc
Q psy14949         81 -VFPGLRKEK-DREDLIAYLSTL  101 (102)
Q Consensus        81 -~~~~~ls~~-e~~~l~~yl~sl  101 (102)
                       +|...|+++ ||.+|++||++.
T Consensus        93 PaF~~~LsD~~eIa~L~~YLR~~  115 (143)
T TIGR03874        93 PAFGDNPNVMCYLDDLYVYLRAR  115 (143)
T ss_pred             CCccccCCcHHHHHHHHHHHHhc
Confidence             588888886 999999999864


No 20 
>TIGR00782 ccoP cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase.
Probab=99.53  E-value=4.9e-14  Score=95.41  Aligned_cols=79  Identities=23%  Similarity=0.393  Sum_probs=55.2

Q ss_pred             HHhHHHHHHHhcccccCCCCCCCCCC-CCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCCCCccC
Q psy14949          3 VENGKKIFTRACAQCHTANEGGANKV-GPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIPGTKMV   81 (102)
Q Consensus         3 ~~~G~~lf~~~C~~CH~~~~~g~~~~-gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m~   81 (102)
                      +++|+++|.+.|++||+.++.|.... .|+|.+....+.         .         +...+.+.+++++.   +.|.+
T Consensus       203 ~~~G~~lf~~~Ca~CHG~~G~G~~~~gaP~L~~~~~~y~---------~---------~~~~i~~~i~~G~~---g~Mp~  261 (285)
T TIGR00782       203 AAKGQELFADNCTTCHGEDGKGLQELGAPNLTDDVWLYG---------G---------DLKTITTTITNGRG---GVMPA  261 (285)
T ss_pred             HHHHHHHHhccchhhCCCCCCCCCCCCCCCCCcchhhcC---------C---------CHHHHHHHHHhCCC---CCCCC
Confidence            46899999989999999997654333 488876432111         0         23456666776542   22335


Q ss_pred             CCCCCCHHHHHHHHHHHhhcC
Q psy14949         82 FPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        82 ~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      |...||++||++|++||.+|+
T Consensus       262 ~~~~Ls~~ei~~La~Yv~sL~  282 (285)
T TIGR00782       262 WGPRLSEAQIKALAAYVHSLG  282 (285)
T ss_pred             ccccCCHHHHHHHHHHHHHhc
Confidence            777789999999999999974


No 21 
>PRK13619 psbV cytochrome c-550; Provisional
Probab=99.50  E-value=7e-14  Score=85.96  Aligned_cols=85  Identities=25%  Similarity=0.362  Sum_probs=58.8

Q ss_pred             CcHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCC-----
Q psy14949          1 MSVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYI-----   75 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~-----   75 (102)
                      +|+++|+++|+.+|+.||..   |++.++|++...........+            .+...+.|.+|+++|..+.     
T Consensus        49 ~d~~~GkklF~~~Ca~CH~g---G~nk~~Pnl~L~~~~L~~atP------------~RdnV~aLVdymk~PtsyDG~~~~  113 (160)
T PRK13619         49 KQITNGQRLFVQECTQCHLQ---GKTKTNNNVSLGLEDLAGAEP------------PRDNVLALVDYLKHPTSYDGEDDY  113 (160)
T ss_pred             HHHHHHHHHHHHHHHHcccC---CCCCcCCCCCcCHHHHHhcCC------------CcccHHHHHHHHhCCcccccchhh
Confidence            46889999999999999975   467778877653222211111            1235778999999999872     


Q ss_pred             ---C-----CCccCCCCCCCHHHHHHHHHHHhh
Q psy14949         76 ---P-----GTKMVFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        76 ---~-----~~~m~~~~~ls~~e~~~l~~yl~s  100 (102)
                         .     ...||-..-|+|+|+.+|++|+..
T Consensus       114 a~~hpsi~~~di~P~mr~LtdedL~~iAg~IL~  146 (160)
T PRK13619        114 SELHPNVSRPDIFPELRNFTEDDLYDVAGYMLV  146 (160)
T ss_pred             hhhcccccccccccccCCCCHHHHHHHHHHHHh
Confidence               1     123443334799999999999864


No 22 
>TIGR00782 ccoP cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase.
Probab=99.47  E-value=2.8e-13  Score=91.73  Aligned_cols=80  Identities=29%  Similarity=0.380  Sum_probs=53.9

Q ss_pred             HhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCC----C-CC
Q psy14949          4 ENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYI----P-GT   78 (102)
Q Consensus         4 ~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~----~-~~   78 (102)
                      +.|+++|..+|++||+.++.|. ...|+|.+.....         .         .+.+.+...++++....    . ..
T Consensus       108 ~~G~~lf~~~Ca~CHG~~g~G~-~g~P~L~~~~~~~---------g---------~~~~~i~~~i~~G~~~~~~~~~~~~  168 (285)
T TIGR00782       108 NAGAAIFRTWCAQCHGSGAGGA-KGFPNLLDNDWLW---------G---------GTLEGIHTTIKHGIRDPDDGDTYVG  168 (285)
T ss_pred             HHHHHHHHHHhHHhCCCCCCCC-CCCCCCCCCcccc---------C---------CCHHHHHHHHHhCccCcccCCcCCC
Confidence            6799999999999999987543 2237665421100         0         03556777777665311    0 23


Q ss_pred             cc-CCCCCCCHHHHHHHHHHHhhcC
Q psy14949         79 KM-VFPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        79 ~m-~~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      .| +|...||++|+++|++||++++
T Consensus       169 ~Mp~~~~~LsdeeI~aVaaYv~sl~  193 (285)
T TIGR00782       169 EMPAFGPLLEEADIKDVASYVMSLS  193 (285)
T ss_pred             CCCccccccChHHHHHHHHHHHHhc
Confidence            45 5767789999999999999863


No 23 
>PRK14486 putative bifunctional cbb3-type cytochrome c oxidase subunit II/cytochrome c; Provisional
Probab=99.46  E-value=3.6e-13  Score=91.38  Aligned_cols=76  Identities=20%  Similarity=0.358  Sum_probs=51.3

Q ss_pred             HHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCCCCcc-C
Q psy14949          3 VENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIPGTKM-V   81 (102)
Q Consensus         3 ~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m-~   81 (102)
                      +.+|+++|+.+|++||+.++.|.  .+|.+......                   ....+.+...+.++..   +..| +
T Consensus       215 ~~~G~~ly~~~Ca~CHg~~g~G~--~gp~p~~~~~~-------------------~~~~~~~~~~I~~G~~---~~~MP~  270 (294)
T PRK14486        215 IAKGKALYDANCAACHGDEAQGQ--EGVALNDIDDG-------------------DLPDAAYFGMIKGGSD---AKGMPG  270 (294)
T ss_pred             HHHHHHHHHHHHHHhcCCCCCCC--CCCCccccccC-------------------CCcHHHHHHHHHcCCC---cCCCCc
Confidence            56899999999999999886543  34433322110                   0023345666777663   2245 5


Q ss_pred             CCCCCCHHHHHHHHHHHhhcC
Q psy14949         82 FPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        82 ~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      |...||++|+++|++||++++
T Consensus       271 f~~~Lsdeei~~LaaYV~sl~  291 (294)
T PRK14486        271 FGGDLSDDDIWAIVAYIRSQK  291 (294)
T ss_pred             ccccCCHHHHHHHHHHHHhcc
Confidence            667689999999999999874


No 24 
>PRK14487 cbb3-type cytochrome c oxidase subunit II; Provisional
Probab=99.44  E-value=2.8e-13  Score=87.34  Aligned_cols=98  Identities=21%  Similarity=0.250  Sum_probs=60.9

Q ss_pred             HhHHHHHHH-hcccccC--CCCCCCC--CCC-CCccCCc--CCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCC
Q psy14949          4 ENGKKIFTR-ACAQCHT--ANEGGAN--KVG-PNLFGVV--GRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYI   75 (102)
Q Consensus         4 ~~G~~lf~~-~C~~CH~--~~~~g~~--~~g-p~l~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~   75 (102)
                      .+|+.+|.+ .|..||+  +.+-...  .-| +++.+-.  .++. .-..-...|+|.+.|.+.+.+++..+|.+|+...
T Consensus        52 l~Gr~iyi~eGC~~CHsQ~VR~~~~e~~r~G~~S~a~e~~yd~P~-lwGs~RtGPDLt~vG~R~s~~w~~~hl~nP~~v~  130 (217)
T PRK14487         52 LAGRDIYIREGCYNCHSQMIRPFRAETERYGHYSLAGESVYDHPF-LWGSKRTGPDLARVGGRYSDEWHRNHLINPRSVV  130 (217)
T ss_pred             HHHHHHHHhcChhhccCccccCCchhhhhcCcccccchhhccccc-ccCCCCCCcchhhhhccCCHHHHHHHHhCcccCC
Confidence            579999975 6999998  3321000  001 1111100  0000 0001123455666666678899999999999999


Q ss_pred             CCCccCCCCCCCHHHHH--HHHHHHhhcC
Q psy14949         76 PGTKMVFPGLRKEKDRE--DLIAYLSTLH  102 (102)
Q Consensus        76 ~~~~m~~~~~ls~~e~~--~l~~yl~sl~  102 (102)
                      |++.||-...|++++++  +|++||++|+
T Consensus       131 PgS~MPay~~L~~~~ld~~~~~~~l~~l~  159 (217)
T PRK14487        131 PESNMPAYPWLAENDLDGTDTAEKMTALR  159 (217)
T ss_pred             CCCCCCCCcccccccCCHHHHHHHHHHhh
Confidence            99999744445677766  9999999874


No 25 
>PRK13622 psbV cytochrome c-550; Provisional
Probab=99.34  E-value=5.1e-12  Score=79.75  Aligned_cols=85  Identities=25%  Similarity=0.416  Sum_probs=51.1

Q ss_pred             cHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCC------
Q psy14949          2 SVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYI------   75 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~------   75 (102)
                      ++..|+++|..+|++||.. |  .+...|..+.......+..+.            .-+.+.|..++++|..+.      
T Consensus        61 ~~~~G~~lF~~~Ca~CH~~-G--~ni~~P~~tLk~~aL~~a~p~------------rdnv~AIv~yLk~p~tYdg~~~~~  125 (180)
T PRK13622         61 QLAKGKKLFNRACAQCHVG-G--QTYPNPDVSLKLSDLEGATPP------------RDNVLAIVDYIKNPVTYDGVESLL  125 (180)
T ss_pred             HHHHHHHHHHhhhHHhccC-C--CCCcCCCcccCHHHHcCCCCC------------cccHHHHHHHHhcccccCCccchh
Confidence            4578999999999999954 2  333334333211111100000            124567888999988544      


Q ss_pred             ---CC----CccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         76 ---PG----TKMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        76 ---~~----~~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                         |.    +.||-...|||+|+.+|++||..+
T Consensus       126 e~~p~~~~~~~~p~~~~LsdeEI~~VA~yIl~q  158 (180)
T PRK13622        126 EYHPNTQLLSEYPRLRNLTDEDLKLIAGYILVQ  158 (180)
T ss_pred             hccccchhccccccccCCCHHHHHHHHHHHHhC
Confidence               11    123322457999999999999764


No 26 
>COG3258 Cytochrome c [Energy production and conversion]
Probab=99.30  E-value=1e-11  Score=81.87  Aligned_cols=82  Identities=26%  Similarity=0.439  Sum_probs=50.1

Q ss_pred             cHHhHHHHHHHhcccccCCCCCCCCC--------CCCCccCCcCCcCCCCCCCccchhhhhcCc-cccHHHHHHHHhCCC
Q psy14949          2 SVENGKKIFTRACAQCHTANEGGANK--------VGPNLFGVVGRQTGQAPGFDYTDANKNKGI-TWSASTLDIYLQNPK   72 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~~~g~~~--------~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~l~~~~~~~~   72 (102)
                      |+.+|+.||.++|+.||+.+|.|...        ..|+|.+-.        .|.       .|. ..-...+..||+.-+
T Consensus       161 dp~rG~kly~eqCa~CHg~~G~G~k~~~~~~~~y~fPpLwG~d--------Sfn-------~GagMari~t~A~Fi~~nM  225 (293)
T COG3258         161 DPVRGKKLYAEQCAACHGADGQGLKNDDEQGAGYLFPPLWGPD--------SFN-------DGAGMARINTLARFIKANM  225 (293)
T ss_pred             CchhHHHHHHHHHHHhcCCCCCccccCcCCCcceecCcccCCc--------ccC-------CccchhhHHHHHHHHHhcC
Confidence            77899999999999999999765322        234444321        111       111 112245667776432


Q ss_pred             CCCCCCccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         73 KYIPGTKMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        73 ~~~~~~~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                         |-..-....+||++|.++|++|+.++
T Consensus       226 ---P~g~~~~~P~Lsd~dA~DiAay~~~~  251 (293)
T COG3258         226 ---PYGFSGTNPILSDQDAWDIAAYVNSQ  251 (293)
T ss_pred             ---CCCcCccCCccChHHHHHHHHHHcCC
Confidence               21111122358999999999999764


No 27 
>COG4654 Cytochrome c551/c552 [Energy production and conversion]
Probab=99.26  E-value=6.7e-12  Score=71.77  Aligned_cols=83  Identities=20%  Similarity=0.376  Sum_probs=58.4

Q ss_pred             CcHHhHHHHHHHh-cccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCC-CCC
Q psy14949          1 MSVENGKKIFTRA-CAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYI-PGT   78 (102)
Q Consensus         1 ~d~~~G~~lf~~~-C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~-~~~   78 (102)
                      +++++|+.||.++ |.+||.++   ...+||++..+...+.+..+               ....|...++++.... ...
T Consensus        21 ~~a~~~~aif~qkgC~~CHq~~---vktVGPS~kdIAakYag~~~---------------~~~kl~q~i~~g~~g~wg~i   82 (110)
T COG4654          21 ADAEDGKAIFSQKGCVACHQPD---VKTVGPSYKDIAAKYAGKAG---------------ALAKLAQGIKPGGVGVWGPI   82 (110)
T ss_pred             cchhhhHHHHHhccchhhcccc---ccccCccHHHHHHHHccchh---------------HHHHHHHhccccCcCccccC
Confidence            3678999999975 99999988   67789999988777665433               2344555555544322 235


Q ss_pred             ccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         79 KMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        79 ~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                      .||....+++.+...++.||.+.
T Consensus        83 pMppqp~~sd~~a~~~~kwvl~~  105 (110)
T COG4654          83 PMPPQPAISDADAKTLAKWVLAF  105 (110)
T ss_pred             CCCCcccccchHHHHHHHHHHhc
Confidence            67766566788888888887653


No 28 
>PF14495 Cytochrom_C550:  Cytochrome c-550 domain; PDB: 3ARC_V 1IZL 3A0H_V 3A0B_v 1E29_A 1F1C_B 1S5L_V 4FBY_i 3PRR_V 3PRQ_V ....
Probab=99.25  E-value=1.4e-11  Score=73.65  Aligned_cols=84  Identities=26%  Similarity=0.444  Sum_probs=49.1

Q ss_pred             cHHhHHHHHHHhcccccCCCCCCCCCCCCCccCCcCCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCCCCC---
Q psy14949          2 SVENGKKIFTRACAQCHTANEGGANKVGPNLFGVVGRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYIPGT---   78 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~~~g~~~~gp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~---   78 (102)
                      ++.+|++||+..|+.||.   +|.....|+............+            .+.+.+.|.+|+++|..+..-.   
T Consensus        24 q~~~GkrLF~~~C~~CH~---GG~TktNpnV~L~le~L~~AtP------------pRDNi~~LVdYmk~PtsYDG~~~i~   88 (135)
T PF14495_consen   24 QLKRGKRLFNASCAQCHV---GGITKTNPNVSLSLEDLAGATP------------PRDNIEALVDYMKNPTSYDGEESIS   88 (135)
T ss_dssp             HHHHHHHHHHHHTHHHHG---GGCBTTSTTSBSSHHHHHTSSS--------------SSHHHHHHHHHS-B-TTSSSBGT
T ss_pred             HHHHHHHHHHHHHHhhcc---CCcccCCCCCCcCHHHHccCCC------------CcccHHHHHHHhhCCCCcCCchhHH
Confidence            467899999999999995   1234445554332211111111            1336788999999999765321   


Q ss_pred             ----------ccCCCCCCCHHHHHHHHHHHhh
Q psy14949         79 ----------KMVFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        79 ----------~m~~~~~ls~~e~~~l~~yl~s  100 (102)
                                ..|-..-|+++|+.+|++||..
T Consensus        89 e~hp~~~s~di~p~mr~ltdddL~~iAg~IL~  120 (135)
T PF14495_consen   89 ELHPSIKSADIFPKMRNLTDDDLYAIAGYILR  120 (135)
T ss_dssp             TTS-STTCTTTSGGGTS--HHHHHHHHHHHHH
T ss_pred             HhCcCcccchhhHhhcCCCHHHHHHHHHHHHh
Confidence                      1111123689999999999864


No 29 
>COG2010 CccA Cytochrome c, mono- and diheme variants [Energy production and conversion]
Probab=99.23  E-value=1.2e-11  Score=76.10  Aligned_cols=19  Identities=37%  Similarity=0.744  Sum_probs=17.4

Q ss_pred             HHhHHHHHHHhcccccCCC
Q psy14949          3 VENGKKIFTRACAQCHTAN   21 (102)
Q Consensus         3 ~~~G~~lf~~~C~~CH~~~   21 (102)
                      ...|+++|..+|+.||+.+
T Consensus        51 ~~~G~~~f~~~C~~CHg~~   69 (150)
T COG2010          51 RGAGLALFLGNCAACHGPN   69 (150)
T ss_pred             HHHHHHHhcccchhccCCC
Confidence            5689999999999999988


No 30 
>TIGR00781 ccoO cytochrome c oxidase, cbb3-type, subunit II. This model describes the monoheme subunit of the cbb3-type cytochrome oxidase, found in a subset of Proteobacterial species. Species having this protein also have CcoN (subunit I, containing copper and two heme groups), CcoP (subunit III, containing two hemes), and CcoQ (essential for incorporation of the prosthetic groups).
Probab=99.10  E-value=2.4e-10  Score=74.37  Aligned_cols=77  Identities=21%  Similarity=0.258  Sum_probs=44.2

Q ss_pred             HhHHHHHHH-hcccccC--CCCCC--CCCCC-CCccCCc--CCcCCCCCCCccchhhhhcCccccHHHHHHHHhCCCCCC
Q psy14949          4 ENGKKIFTR-ACAQCHT--ANEGG--ANKVG-PNLFGVV--GRQTGQAPGFDYTDANKNKGITWSASTLDIYLQNPKKYI   75 (102)
Q Consensus         4 ~~G~~lf~~-~C~~CH~--~~~~g--~~~~g-p~l~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~   75 (102)
                      .+|+.+|.+ .|..||+  +.+..  ...-| +++.+-.  .++. .-..-...|+|...|..++.+++..++.+|+...
T Consensus        51 l~Gr~iyi~eGC~~CHsQ~VR~~~~e~~ryG~~S~a~e~~yd~p~-lwGs~RtGPDLt~vG~R~s~~wh~~hl~nPr~v~  129 (232)
T TIGR00781        51 LAGRDIYIREGCYHCHSQMIRPFRAEVERYGHYSLAGESMYDHPF-QWGSKRTGPDLARVGGRYSDEWHVKHLFDPRSVV  129 (232)
T ss_pred             HHHHHHHHhcChhhcccccccCcchhhhhcCcccccchhhccccc-ccCCCCcCcCcccccccCCHHHHHHHHhCccccC
Confidence            579999975 6999997  33210  00000 1111100  0000 0000123445555566667899999999999999


Q ss_pred             CCCccC
Q psy14949         76 PGTKMV   81 (102)
Q Consensus        76 ~~~~m~   81 (102)
                      |++.||
T Consensus       130 PgSiMP  135 (232)
T TIGR00781       130 PESIMP  135 (232)
T ss_pred             CCCCCC
Confidence            999997


No 31 
>PRK14486 putative bifunctional cbb3-type cytochrome c oxidase subunit II/cytochrome c; Provisional
Probab=99.07  E-value=4.6e-10  Score=76.37  Aligned_cols=75  Identities=15%  Similarity=0.278  Sum_probs=45.9

Q ss_pred             HHhHHHHHHH-hcccccCCCCCCCCCCCCCccCCcCCcCC----------CCCCCccchhhhhcCccccHHHHHHHHhCC
Q psy14949          3 VENGKKIFTR-ACAQCHTANEGGANKVGPNLFGVVGRQTG----------QAPGFDYTDANKNKGITWSASTLDIYLQNP   71 (102)
Q Consensus         3 ~~~G~~lf~~-~C~~CH~~~~~g~~~~gp~l~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~   71 (102)
                      ..+|+.||.+ .|..||+..-   .+....... .++...          .-..-...|.|...|..++.+++..+|.+|
T Consensus        51 ~~~G~~~y~~~gC~~CH~q~v---r~~~~~~~~-~g~~s~~~~~~~~~p~~~g~~r~GPDL~~vG~r~~~~w~~~~l~~P  126 (294)
T PRK14486         51 ELAGRDVYQREGCVNCHTQTV---RPLKSEVVR-YGQYSKAGEFAYDHPFLWGSKRTGPDLARIGGKYPDAWHYAHFEDP  126 (294)
T ss_pred             HHHHHHHHHHcCchhhcCccc---cCCcccccc-cCCCCcchhhhccccccccCCCCCCchhhhcccCCHHHHHHHHhCc
Confidence            3579999986 6999998420   000111100 000000          001112355666667777899999999999


Q ss_pred             CCCCCCCccC
Q psy14949         72 KKYIPGTKMV   81 (102)
Q Consensus        72 ~~~~~~~~m~   81 (102)
                      +...|++.||
T Consensus       127 ~~~~p~s~MP  136 (294)
T PRK14486        127 QAVVPRSNMP  136 (294)
T ss_pred             ccCCCCCCCC
Confidence            9999999886


No 32 
>TIGR03791 TTQ_mauG tryptophan tryptophylquinone biosynthesis enzyme MauG. Members of this protein family are the tryptophan tryptophylquinone biosynthesis (TTQ) enzyme MauG, as found in Methylobacterium extorquens and related species. This protein is required to complete the maturation of the TTQ cofactor in the methylamine dehydrogenase light (beta) chain.
Probab=98.86  E-value=1.4e-08  Score=69.15  Aligned_cols=99  Identities=24%  Similarity=0.335  Sum_probs=54.0

Q ss_pred             HHhHHHHHH--HhcccccCCCCCC---CCCCC-CC-c-cCC------------cCCcCCCCCCCccchhhhhcCccccHH
Q psy14949          3 VENGKKIFT--RACAQCHTANEGG---ANKVG-PN-L-FGV------------VGRQTGQAPGFDYTDANKNKGITWSAS   62 (102)
Q Consensus         3 ~~~G~~lf~--~~C~~CH~~~~~g---~~~~g-p~-l-~~~------------~~~~~~~~~~~~~~~~~~~~~~~~~~~   62 (102)
                      ..+|..||.  .+|+.||...--+   -..+| |. + .+.            ....+++..+...++++.+.|...+.+
T Consensus       159 e~~G~~LF~~k~~C~~CH~g~~ftd~~f~~iG~~~~~d~G~~~~~~~~~~~~~~~FrtPsLRnV~~taPY~HdG~~~tL~  238 (291)
T TIGR03791       159 AKRGFALFKGKAGCAACHSSWRFTDDSFHDIGLKAGLDLGRGAFAPPQVTAMQHAFKTPSLRDLPMEGPFMHDGQLGSLD  238 (291)
T ss_pred             HHHHHHHhcCCCCCCCCCCCCCcCCchHHhcCCCCccCCCcccccccccccccCcccCccccccccCCCCCCCCCcCCHH
Confidence            468999998  3699999632100   00112 11 0 011            111223333444444555677777777


Q ss_pred             HHHHHHhCCCCCCCC--CccCCCCCCCHHHHHHHHHHHhhcC
Q psy14949         63 TLDIYLQNPKKYIPG--TKMVFPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        63 ~l~~~~~~~~~~~~~--~~m~~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      .+..+........++  ..+. .-.||++|+.+|++||++|.
T Consensus       239 evv~~y~~~g~~~~~~~~~~~-~~~Lt~~E~~dLvaFL~tLt  279 (291)
T TIGR03791       239 AVIDHYEKGGEKRPSISAEMK-PFELSEREREDLIAFIETLD  279 (291)
T ss_pred             HHHHHHHccCccccccccccc-cCCCCHHHHHHHHHHHHhcC
Confidence            777776554322221  1111 11369999999999999973


No 33 
>COG2857 CYT1 Cytochrome c1 [Energy production and conversion]
Probab=98.39  E-value=1.3e-06  Score=58.40  Aligned_cols=41  Identities=32%  Similarity=0.454  Sum_probs=34.0

Q ss_pred             HHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         61 ASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        61 ~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                      ...+..+|++|....+++.|+-...++|+++++|++||+.+
T Consensus       172 ~~~~~~~i~~p~~~k~~~~m~~~~~~tdq~~~dlvaYL~~~  212 (250)
T COG2857         172 EGELGIFIADPLKDKPGTYMPGNPALTDQEVKDLVAYLKWA  212 (250)
T ss_pred             hhhHhhhccCccccCCcCCCCCChhhHHHHHHHHHHHHHHc
Confidence            34488999999999999988744445899999999999875


No 34 
>PF02433 FixO:  Cytochrome C oxidase, mono-heme subunit/FixO;  InterPro: IPR003468 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO) []. Cytochrome cbb3 oxidases are required both to support symbiotic nitrogen fixation, whilst ensuring that the oxygen-labile nitrogenase is not compromised. Cytochrome cbb3 oxidases consist of four subunits: FixN (or CcoN), FixO (or CcoO), FixP (or CcoP) and FixQ (or CcoQ). The catalytic core is comprised of subunits FixN, FixO and FixP, where FixN acts as the catalytic subunit, and Fix O and FixP are membrane-bound mono- and di-haem cytochromes c, respectively. The FixQ subunit protects the core complex in the presence of oxygen from proteolytic degradation []. This entry represents the mono-haem FixO subunit.
Probab=98.26  E-value=5.9e-06  Score=54.06  Aligned_cols=74  Identities=22%  Similarity=0.263  Sum_probs=46.2

Q ss_pred             HhHHHHHHH-hcccccCCCCCCCCCCCCCccCCcCCcCC----------CCCCCccchhhhhcCccccHHHHHHHHhCCC
Q psy14949          4 ENGKKIFTR-ACAQCHTANEGGANKVGPNLFGVVGRQTG----------QAPGFDYTDANKNKGITWSASTLDIYLQNPK   72 (102)
Q Consensus         4 ~~G~~lf~~-~C~~CH~~~~~g~~~~gp~l~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~   72 (102)
                      .+|+.+|.+ .|..||+-.-   .++...... ++++..          .-+.-...|+|...|...+.++-..-+.+|+
T Consensus        51 l~GR~iYi~eGC~~CHSQ~V---Rp~~~e~~R-yG~yS~a~e~~yd~P~lwGSkRtGPDLarvG~r~s~~Wh~~Hl~~Pr  126 (226)
T PF02433_consen   51 LAGRDIYIREGCYYCHSQMV---RPFRAEVER-YGRYSVAGEYVYDHPFLWGSKRTGPDLARVGGRYSDDWHLAHLYNPR  126 (226)
T ss_pred             HhHHHHHHHcCchhcccccC---CCchhhhhh-cCCCCchhhhhccCccccCCCCcCccHHHHhccCChHHHHHHhhChH
Confidence            479999996 5999998531   111111100 111110          0112234566666777778888888899999


Q ss_pred             CCCCCCccC
Q psy14949         73 KYIPGTKMV   81 (102)
Q Consensus        73 ~~~~~~~m~   81 (102)
                      ...|++.||
T Consensus       127 ~v~p~SiMP  135 (226)
T PF02433_consen  127 SVVPGSIMP  135 (226)
T ss_pred             hhCCCCCCC
Confidence            999999996


No 35 
>PF09098 Dehyd-heme_bind:  Quinohemoprotein amine dehydrogenase A, alpha subunit, haem binding;  InterPro: IPR015182 Quinohemoprotein amine dehydrogenases (QHNDH) 1.4.99 from EC) are enzymes produced in the periplasmic space of certain Gram-negative bacteria, such as Paracoccus denitrificans and Pseudomonas putida, in response to primary amines, including n-butylamine and benzylamine. QHNDH catalyses the oxidative deamination of a wide range of aliphatic and aromatic amines through formation of a Schiff-base intermediate involving one of the quinone O atoms []. Catalysis requires the presence of a novel redox cofactor, cysteine tryptophylquinone (CTQ). CTQ is derived from the post-translational modification of specific residues, which involves the oxidation of the indole ring of a tryptophan residue to form tryptophylquinone, followed by covalent cross-linking with a cysteine residue []. There is one CTQ per subunit in QHNDH. In addition to CTQ, two haem c cofactors are present in QHNDH that mediate the transfer of the substrate-derived electrons from CTQ to an external electron acceptor, cytochrome c-550 [, ]. QHNDH is a heterotrimer of alpha, beta and gamma subunits. The alpha and beta subunits contain signal peptides necessary for the translocation of QHNDH to the periplasm. The alpha subunit is composed of four domains - domain 1 forming a dihaem cytochrome, and domains 2-4 forming antiparallel beta-barrel structures; the beta subunit is a 7-bladed beta-propeller that provides part of the active site; and the small, catalytic gamma subunit contains the novel cross-linked CTQ cofactor, in addition to additional thioester cross-links between Cys and Asp/Glu residues that encage CTQ. The gamma subunit assumes a globular secondary structure with two short alpha-helices having many turns and bends [].  This entry represents the dihaem cytochrome c domain of the QHNDH alpha subunit. The domain contain two cysteine residues that are involved in thioether linkages to haem []. ; PDB: 1PBY_A 1JJU_A 1JMZ_A 1JMX_A.
Probab=98.06  E-value=1.6e-06  Score=54.02  Aligned_cols=19  Identities=32%  Similarity=0.847  Sum_probs=15.1

Q ss_pred             hHHHHHHHhcccccCCCCC
Q psy14949          5 NGKKIFTRACAQCHTANEG   23 (102)
Q Consensus         5 ~G~~lf~~~C~~CH~~~~~   23 (102)
                      .|++|.+++|+.||+.+..
T Consensus         2 ~G~~Lv~~kC~~CHs~~~~   20 (167)
T PF09098_consen    2 DGEQLVQEKCAGCHSADYD   20 (167)
T ss_dssp             -HHHHHHHCHCCTC-EECT
T ss_pred             cHHHHHHHHHHHhcCcccc
Confidence            6999999999999987643


No 36 
>PRK14485 putative bifunctional cbb3-type cytochrome c oxidase subunit I/II; Provisional
Probab=98.03  E-value=2.8e-05  Score=58.70  Aligned_cols=94  Identities=17%  Similarity=0.229  Sum_probs=56.9

Q ss_pred             HhHHHHHHH-hcccccCCCCCCCCCCCCCccCCcCCcCC----------CCCCCccchhhhhcCccccHHHHHHHHhCCC
Q psy14949          4 ENGKKIFTR-ACAQCHTANEGGANKVGPNLFGVVGRQTG----------QAPGFDYTDANKNKGITWSASTLDIYLQNPK   72 (102)
Q Consensus         4 ~~G~~lf~~-~C~~CH~~~~~g~~~~gp~l~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~   72 (102)
                      .+|+.+|.+ .|..||+-.-   .+..++... .+++..          .-..-...|++...|.+.+.++-..-+.||+
T Consensus       538 ~~Gr~iyi~egC~~CHsq~v---r~~~~e~~r-~G~~s~~~e~~~d~p~~~Gs~rtgpdl~~~g~~~~~~wh~~hl~~p~  613 (712)
T PRK14485        538 LEGRDLYIREGCYNCHSQMI---RPFRSEVER-YGEYSKAGEFVYDHPFLWGSKRTGPDLAREGGKYPDSWHYNHMEDPQ  613 (712)
T ss_pred             HhhHHHHHHcCccccccccC---CCCchhHHh-cCCCCchhhhhccCCcccCCCCcCcchhhhcCCCChHHHHHHhcCch
Confidence            579999996 5999997531   111111100 111110          0111234566666777777788888889999


Q ss_pred             CCCCCCccC-C----CCCCCHHHHHHHHHHHhhc
Q psy14949         73 KYIPGTKMV-F----PGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        73 ~~~~~~~m~-~----~~~ls~~e~~~l~~yl~sl  101 (102)
                      ...|++.|| |    ...++.+++.+-+..++.+
T Consensus       614 ~~~p~s~mp~y~~l~~~~~~~~~~~~~~~~~~~~  647 (712)
T PRK14485        614 STSPGSIMPAYPWLLENELDISDTPAKIKAMQTL  647 (712)
T ss_pred             hcCCCCCCCCChhhhhCCCChHHHHHHHHHHHhc
Confidence            999999886 3    3445666666666666553


No 37 
>PF06537 DUF1111:  Protein of unknown function (DUF1111);  InterPro: IPR010538 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=97.96  E-value=2.8e-06  Score=61.35  Aligned_cols=20  Identities=45%  Similarity=0.959  Sum_probs=16.6

Q ss_pred             cHHhHHHHHHH-hcccccCCC
Q psy14949          2 SVENGKKIFTR-ACAQCHTAN   21 (102)
Q Consensus         2 d~~~G~~lf~~-~C~~CH~~~   21 (102)
                      ++.+|++||.+ .|++||...
T Consensus       362 ~v~~G~~lF~~~GCa~CH~p~  382 (499)
T PF06537_consen  362 QVLRGKQLFYQIGCASCHTPS  382 (499)
T ss_pred             HHHHHHHHHHhcCCcccCCCc
Confidence            45789999997 599999754


No 38 
>PF09086 DUF1924:  Domain of unknown function (DUF1924);  InterPro: IPR015170 This entry is found in a set of bacterial proteins, including Cytochrome c-type protein. It is functionally uncharacterised. ; PDB: 1DW2_C 1DW1_A 1DW3_C 1DW0_A 1OAE_A 1GU2_B 1E8E_A.
Probab=97.82  E-value=2.3e-05  Score=44.81  Aligned_cols=20  Identities=50%  Similarity=0.969  Sum_probs=15.0

Q ss_pred             cHHhHHHHHHH-h--------cccccCCC
Q psy14949          2 SVENGKKIFTR-A--------CAQCHTAN   21 (102)
Q Consensus         2 d~~~G~~lf~~-~--------C~~CH~~~   21 (102)
                      ++++|+++|.. +        |++||+.+
T Consensus        10 sa~rG~~~f~~~~~~~g~~~sCasCH~~~   38 (98)
T PF09086_consen   10 SAARGEAFFTSKHTGNGKEWSCASCHTAD   38 (98)
T ss_dssp             -HHHHHHHHH--ECCTTCECSCHHHH-SS
T ss_pred             CHHHHHHHHHccCCCCCCCCCcccccCCC
Confidence            67899999974 2        99999876


No 39 
>COG3245 CycB Cytochrome c5 [Energy production and conversion]
Probab=97.80  E-value=8.8e-05  Score=43.90  Aligned_cols=17  Identities=41%  Similarity=1.038  Sum_probs=14.5

Q ss_pred             hHHHHHHHhcccccCCC
Q psy14949          5 NGKKIFTRACAQCHTAN   21 (102)
Q Consensus         5 ~G~~lf~~~C~~CH~~~   21 (102)
                      .|+.+|...|..||+..
T Consensus        49 ~Gk~vy~~tC~~CHa~~   65 (126)
T COG3245          49 EGKKVYGATCQACHAAG   65 (126)
T ss_pred             ccchhHhhhhhHhccCC
Confidence            38999999999999743


No 40 
>COG2993 CcoO Cbb3-type cytochrome oxidase, cytochrome c subunit [Energy production and conversion]
Probab=97.74  E-value=6.4e-06  Score=52.76  Aligned_cols=53  Identities=25%  Similarity=0.281  Sum_probs=33.9

Q ss_pred             chhhhhcCccccHHHHHHHHhCCCCCCCCCccC-CCCCCC-HHHHHHHHHHHhhc
Q psy14949         49 TDANKNKGITWSASTLDIYLQNPKKYIPGTKMV-FPGLRK-EKDREDLIAYLSTL  101 (102)
Q Consensus        49 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m~-~~~~ls-~~e~~~l~~yl~sl  101 (102)
                      .|++-..|-.++.++=..-+.+|+.+.|.+.|| |..+.+ +-|++++.+=++++
T Consensus       105 GPDLaRVG~ryS~dWH~~Hl~~PR~vVPeSiMPsY~~L~~~~ld~~d~~~~~~~~  159 (227)
T COG2993         105 GPDLARVGGRYSDDWHRAHLLDPRSVVPESIMPSYPWLFDNKLDVDDIGAELKAL  159 (227)
T ss_pred             CcchhhhccccccHHHHHHccCchhcCccccCcccHHHhcCCCchHHHHHHHHhh
Confidence            344444555567777777788999999999886 443322 23566666555543


No 41 
>PF02167 Cytochrom_C1:  Cytochrome C1 family;  InterPro: IPR002326 Cytochrome bc1 complex (ubiquinol:ferricytochrome c oxidoreductase) is found in mitochondria, photosynthetic bacteria and other prokaryotes. It is minimally composed of three subunits: cytochrome b, carrying a low- and a high-potential haem group; cytochrome c1 (cyt c1); and a high-potential Rieske iron-sulphur protein. The general function of the complex is electron transfer between two mobile redox carriers, ubiquinol and cytochrome c; the electron transfer is coupled with proton translocation across the membrane, thus generating proton-motive force in the form of an electrochemical potential that can drive ATP synthesis. In its structure and functions, the cytochrome bc1 complex bears extensive analogy to the cytochrome b6f complex of chloroplasts and cyanobacteria; cyt c1 plays an analogous role to cytochrome f, in spite of their different structures [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1P84_D 2IBZ_D 1EZV_D 3CX5_O 3CXH_O 1KB9_D 1KYO_D 1ZRT_Q 2CA4_B 2C9X_B ....
Probab=97.67  E-value=2.9e-05  Score=50.97  Aligned_cols=20  Identities=30%  Similarity=0.908  Sum_probs=17.7

Q ss_pred             cHHhHHHHHHHhcccccCCC
Q psy14949          2 SVENGKKIFTRACAQCHTAN   21 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~   21 (102)
                      .+.+|.++|.+.|++||+.+
T Consensus        14 slqRG~qvy~~~C~~CHsl~   33 (219)
T PF02167_consen   14 SLQRGAQVYMEVCASCHSLK   33 (219)
T ss_dssp             HHHHHHHHHHHTGGGTSBCT
T ss_pred             HHHHHHHHHHHHHhhccccc
Confidence            36789999999999999975


No 42 
>TIGR03806 chp_HNE_0200 conserved hypothetical protein, HNE_0200 family. The model TIGR03805 describes an uncharacterized protein family that contains repeats associated with the formation of a right-handed helical stack of parallel beta strands, homologous to those found in a number of carbohydrate-binding proteins and sugar hydrolases. This model describes another uncharacterized protein family, found in the same species as TIGR03805 member proteins, usually as the adjacent gene or in a fusion protein. An example is HNE_0200 from Hyphomonas neptunium ATCC 15444. Sometimes two members of this family are with a single member of TIGR03805. The function is unknown.
Probab=97.44  E-value=0.00059  Score=47.22  Aligned_cols=36  Identities=19%  Similarity=0.280  Sum_probs=22.6

Q ss_pred             HHHHHHhCCCCCCCCCccCCCC--CCCHHHHHHHHHHHhhc
Q psy14949         63 TLDIYLQNPKKYIPGTKMVFPG--LRKEKDREDLIAYLSTL  101 (102)
Q Consensus        63 ~l~~~~~~~~~~~~~~~m~~~~--~ls~~e~~~l~~yl~sl  101 (102)
                      .|...+..   ..++.+||..+  +..++++.-|..||.+|
T Consensus       280 iL~~R~~~---~d~~~~MPp~G~~l~~~e~vaLI~~WI~~l  317 (317)
T TIGR03806       280 ILLYRMHS---TEPGVRMPELGRSLVHQEGLALIRQWIASL  317 (317)
T ss_pred             hHHHHHhc---CCccccCCcCCCCCCCHHHHHHHHHHHHhC
Confidence            35555542   22456777543  33457899999999875


No 43 
>PF10643 Cytochrome-c551:  Photosystem P840 reaction-centre cytochrome c-551;  InterPro: IPR019604  A photosynthetic reaction-centre complex is found in certain green sulphur bacteria such as Chlorobium vibrioforme, which are anaerobic photo-auto-trophic organisms. The primary electron donor is P840, a probable B-Chl a dimer, and the primary electron acceptor is a B-Chl monomer. Also on the donor side c-type cytochromes are known to function as electron donors to photo-oxidised P840. This family is thus the secondary endogenous donor of the photosynthetic reaction-centre complex and is a membrane-bound cytochrome containing a single haem group. ; PDB: 3A9F_A.
Probab=97.25  E-value=7.7e-05  Score=48.25  Aligned_cols=20  Identities=35%  Similarity=0.833  Sum_probs=15.1

Q ss_pred             cHHhHHHHHHHhcccccCCC
Q psy14949          2 SVENGKKIFTRACAQCHTAN   21 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~   21 (102)
                      |...-+.+|+.+|..||+.+
T Consensus       168 df~AAk~L~~~KCNkCHTl~  187 (233)
T PF10643_consen  168 DFAAAKALFDRKCNKCHTLK  187 (233)
T ss_dssp             -HHHHHHHHHHHTTSSS-SH
T ss_pred             hHHHHHHHHHhhccccccHH
Confidence            34567899999999999865


No 44 
>COG1858 MauG Cytochrome c peroxidase [Inorganic ion transport and metabolism]
Probab=97.01  E-value=0.0022  Score=45.09  Aligned_cols=18  Identities=33%  Similarity=0.875  Sum_probs=14.7

Q ss_pred             HhHHHHHH-H-hcccccCCC
Q psy14949          4 ENGKKIFT-R-ACAQCHTAN   21 (102)
Q Consensus         4 ~~G~~lf~-~-~C~~CH~~~   21 (102)
                      .+|.++|. + +|++||...
T Consensus       221 ~rGl~LF~~k~~C~aCH~g~  240 (364)
T COG1858         221 KRGLALFKGKANCAACHNGI  240 (364)
T ss_pred             HHHHHHHccCCCchhhccCc
Confidence            47999999 5 599999753


No 45 
>TIGR02162 torC trimethylamine-N-oxide reductase c-type cytochrome TorC. This family includes consists of TorC, a pentahemic c-type cytochrome subunit of periplasmic reductases for trimethylamine-N-oxide (TMAO). The N-terminal half is closely related to tetrahemic NapC (or NirT) subunits of periplasmic nitrate (or nitrite) reductases; some species have both TMAO and nitrate reductase complexes.
Probab=96.96  E-value=0.00076  Score=47.82  Aligned_cols=18  Identities=28%  Similarity=0.739  Sum_probs=15.4

Q ss_pred             HhHHHHHHHhcccccCCC
Q psy14949          4 ENGKKIFTRACAQCHTAN   21 (102)
Q Consensus         4 ~~G~~lf~~~C~~CH~~~   21 (102)
                      ..|+.+|..+|+.||+.-
T Consensus       322 ~~a~~ly~~~Cs~CH~~~  339 (386)
T TIGR02162       322 AYAKSMYNGACSMCHVQP  339 (386)
T ss_pred             HHHHHHHhcchhhhcCCC
Confidence            369999999999999754


No 46 
>PF14376 Haem_bd:  Haem-binding domain
Probab=96.89  E-value=0.0024  Score=39.08  Aligned_cols=20  Identities=10%  Similarity=0.332  Sum_probs=17.0

Q ss_pred             CCCCCHHHHHHHHHHHhhcC
Q psy14949         83 PGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        83 ~~~ls~~e~~~l~~yl~sl~  102 (102)
                      ...||++|+..|++|+++.+
T Consensus       118 ~a~Ls~~ek~~Ll~Wi~~~R  137 (137)
T PF14376_consen  118 EAKLSEEEKQALLNWIKEQR  137 (137)
T ss_pred             CCCCCHHHHHHHHHHHHHcC
Confidence            45679999999999998764


No 47 
>COG3748 Predicted membrane protein [Function unknown]
Probab=96.77  E-value=0.0068  Score=42.09  Aligned_cols=16  Identities=19%  Similarity=0.366  Sum_probs=13.9

Q ss_pred             CCCHHHHHHHHHHHhh
Q psy14949         85 LRKEKDREDLIAYLST  100 (102)
Q Consensus        85 ~ls~~e~~~l~~yl~s  100 (102)
                      .+||||+.-|.+|+++
T Consensus       387 ~mT~eER~ll~aW~e~  402 (407)
T COG3748         387 QMTDEERALLAAWFES  402 (407)
T ss_pred             cCCHHHHHHHHHHHHh
Confidence            3589999999999976


No 48 
>KOG3052|consensus
Probab=96.66  E-value=0.00068  Score=45.32  Aligned_cols=18  Identities=28%  Similarity=0.957  Sum_probs=16.2

Q ss_pred             HHhHHHHHHHhcccccCC
Q psy14949          3 VENGKKIFTRACAQCHTA   20 (102)
Q Consensus         3 ~~~G~~lf~~~C~~CH~~   20 (102)
                      +.+|-++|++.|++||+.
T Consensus        95 iRRGyqVYkqVCaaCHSm  112 (311)
T KOG3052|consen   95 IRRGYQVYKQVCAACHSM  112 (311)
T ss_pred             HhhhHHHHHHHHHHhhhh
Confidence            568999999999999984


No 49 
>PRK15032 trimethylamine N-oxide reductase cytochrome c-type subunit; Provisional
Probab=96.60  E-value=0.0019  Score=45.96  Aligned_cols=18  Identities=28%  Similarity=0.732  Sum_probs=15.3

Q ss_pred             HhHHHHHHHhcccccCCC
Q psy14949          4 ENGKKIFTRACAQCHTAN   21 (102)
Q Consensus         4 ~~G~~lf~~~C~~CH~~~   21 (102)
                      ..|+++|+.+|+.||+.-
T Consensus       319 ~ya~~ly~~~Cs~CHa~~  336 (390)
T PRK15032        319 AYADSLYNGTCNQCHGAP  336 (390)
T ss_pred             HHHHHHHhccchhhcCCC
Confidence            358999999999999754


No 50 
>TIGR03791 TTQ_mauG tryptophan tryptophylquinone biosynthesis enzyme MauG. Members of this protein family are the tryptophan tryptophylquinone biosynthesis (TTQ) enzyme MauG, as found in Methylobacterium extorquens and related species. This protein is required to complete the maturation of the TTQ cofactor in the methylamine dehydrogenase light (beta) chain.
Probab=96.53  E-value=0.00096  Score=45.70  Aligned_cols=20  Identities=35%  Similarity=0.745  Sum_probs=15.4

Q ss_pred             HHhHHHHHHH---------hcccccCCCC
Q psy14949          3 VENGKKIFTR---------ACAQCHTANE   22 (102)
Q Consensus         3 ~~~G~~lf~~---------~C~~CH~~~~   22 (102)
                      ++-|+.||..         .|++||..+.
T Consensus         6 ~~LGk~LFfD~~LS~~~~~SCasCH~p~~   34 (291)
T TIGR03791         6 AALGKALFFDPRLSRDGSMSCATCHNPGL   34 (291)
T ss_pred             HHHHHHHhcCcccCCCCCcCchhcCCccc
Confidence            4679999952         4999998763


No 51 
>COG3258 Cytochrome c [Energy production and conversion]
Probab=95.86  E-value=0.024  Score=38.31  Aligned_cols=14  Identities=14%  Similarity=0.411  Sum_probs=11.4

Q ss_pred             CHHHHHHHHHHHhh
Q psy14949         87 KEKDREDLIAYLST  100 (102)
Q Consensus        87 s~~e~~~l~~yl~s  100 (102)
                      +..|+++|++|++=
T Consensus       121 DspEmkAmlaY~kW  134 (293)
T COG3258         121 DSPEMKAMLAYMKW  134 (293)
T ss_pred             CCHHHHHHHHHHHH
Confidence            45799999999864


No 52 
>PF03150 CCP_MauG:  Di-haem cytochrome c peroxidase;  InterPro: IPR004852 This is a group of distinct cytochrome c peroxidases (CCPs) that contain two haem groups. Similar to other cytochrome c peroxidases, they reduce hydrogen peroxide to water using c-type haem as an oxidizable substrate. However, since they possess two, instead of one, haem prosthetic groups, bacterial CCPs reduce hydrogen peroxide without the need to generate semi-stable free radicals. The two haem groups have significantly different redox potentials. The high potential (+320 mV) haem feeds electrons from electron shuttle proteins to the low potential (-330 mV) haem, where peroxide is reduced (indeed, the low potential site is known as the peroxidatic site) []. The CCP protein itself is structured into two domains, each containing one c-type haem group, with a calcium-binding site at the domain interface. This family also includes MauG proteins, whose similarity to di-haem CCP was previously recognised [].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1IQC_A 2VHD_B 1EB7_A 3RN0_A 3SVW_B 3RMZ_A 3SJL_B 3PXW_A 3SLE_B 3PXS_A ....
Probab=94.95  E-value=0.014  Score=36.66  Aligned_cols=19  Identities=42%  Similarity=0.899  Sum_probs=13.7

Q ss_pred             HHhHHHHHHH---------hcccccCCC
Q psy14949          3 VENGKKIFTR---------ACAQCHTAN   21 (102)
Q Consensus         3 ~~~G~~lf~~---------~C~~CH~~~   21 (102)
                      ++.|+.||..         .|++||..+
T Consensus         5 ~~LGk~LF~D~~LS~~~~~SCasCH~~~   32 (159)
T PF03150_consen    5 AALGKKLFFDPRLSGDGTVSCASCHDPE   32 (159)
T ss_dssp             HHHHHHHHT-GGGSTTSS--HHHHS-TT
T ss_pred             HHHHHHHhCCCccCCCcCcCchhhCCCc
Confidence            4679999964         499999765


No 53 
>PF09626 DHC:  Dihaem cytochrome c;  InterPro: IPR018588  Dihaem cytochrome c (DHC) is a soluble c-type cytochrome that folds into two distinct domains, each binding a single haem group and connected by a small linker region. Despite little sequence similarity, the N-terminal domain (residues 12-75) is a class I type cytochrome c, that binds one of the haems, but the domain surrounding the other haem is structurally unique. DHC binds electrostatically to an oxygen-binding protein, sphaeroides haem protein (SHP), as a component of a conserved electron transfer pathway. DHC acts as the physiological electron donor for SHP during phototrophic growth []. In certain species DHC is found upstream of IPR011577 from INTERPRO. ; PDB: 2FWT_A 2FW5_A.
Probab=94.24  E-value=0.097  Score=31.41  Aligned_cols=11  Identities=36%  Similarity=1.123  Sum_probs=7.4

Q ss_pred             HHHhcccccCC
Q psy14949         10 FTRACAQCHTA   20 (102)
Q Consensus        10 f~~~C~~CH~~   20 (102)
                      |.+.|++||-+
T Consensus         1 Y~~eCgsCH~a   11 (120)
T PF09626_consen    1 YKEECGSCHMA   11 (120)
T ss_dssp             -HHHTTSSS--
T ss_pred             CccchhhccCc
Confidence            67889999953


No 54 
>COG3488 Predicted thiol oxidoreductase [Energy production and conversion]
Probab=94.14  E-value=0.028  Score=39.43  Aligned_cols=20  Identities=45%  Similarity=0.973  Sum_probs=16.3

Q ss_pred             cHHhHHHHHHH-hcccccCCC
Q psy14949          2 SVENGKKIFTR-ACAQCHTAN   21 (102)
Q Consensus         2 d~~~G~~lf~~-~C~~CH~~~   21 (102)
                      ++..||+||.+ .|.+||...
T Consensus       350 ~vl~GkkLF~~agC~aCH~pk  370 (481)
T COG3488         350 QVLAGKKLFAQAGCVACHTPK  370 (481)
T ss_pred             hhhhhhHHHHhcCchhccCCc
Confidence            45689999987 699999753


No 55 
>COG2857 CYT1 Cytochrome c1 [Energy production and conversion]
Probab=91.89  E-value=0.024  Score=38.11  Aligned_cols=21  Identities=24%  Similarity=0.763  Sum_probs=17.6

Q ss_pred             cHHhHHHHHHHhcccccCCCC
Q psy14949          2 SVENGKKIFTRACAQCHTANE   22 (102)
Q Consensus         2 d~~~G~~lf~~~C~~CH~~~~   22 (102)
                      .+.+|.++|.+.|..||+...
T Consensus        42 ~lq~g~~~~~~~c~~chs~~~   62 (250)
T COG2857          42 SLQRGAQLYKEYCSACHSLKL   62 (250)
T ss_pred             HhhhceeeeecCChhhccccc
Confidence            456899999999999998763


No 56 
>PF07635 PSCyt1:  Planctomycete cytochrome C;  InterPro: IPR011429 These proteins share a region of homology at their N terminus that contains the C-{CPWHF}-{CPWR}-C-H-{CFYW} motif typical of cytochrome c.
Probab=91.05  E-value=0.13  Score=26.85  Aligned_cols=9  Identities=33%  Similarity=1.091  Sum_probs=7.5

Q ss_pred             cccccCCCC
Q psy14949         14 CAQCHTANE   22 (102)
Q Consensus        14 C~~CH~~~~   22 (102)
                      |..||+.+.
T Consensus         1 C~~CHg~~~    9 (59)
T PF07635_consen    1 CFSCHGPDK    9 (59)
T ss_pred             CcCCCCCCC
Confidence            999998764


No 57 
>PF06537 DUF1111:  Protein of unknown function (DUF1111);  InterPro: IPR010538 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=85.07  E-value=0.55  Score=34.69  Aligned_cols=17  Identities=29%  Similarity=0.882  Sum_probs=12.6

Q ss_pred             HHHH-hcccccCCCCCCC
Q psy14949          9 IFTR-ACAQCHTANEGGA   25 (102)
Q Consensus         9 lf~~-~C~~CH~~~~~g~   25 (102)
                      +|+. .|.+||--+|-|.
T Consensus        66 LfN~~SC~sCH~~dGRG~   83 (499)
T PF06537_consen   66 LFNARSCQSCHIKDGRGH   83 (499)
T ss_pred             hhhhhhHhhcccCCCCCC
Confidence            6775 5999998776443


No 58 
>COG1858 MauG Cytochrome c peroxidase [Inorganic ion transport and metabolism]
Probab=84.78  E-value=0.54  Score=33.40  Aligned_cols=20  Identities=40%  Similarity=0.821  Sum_probs=15.6

Q ss_pred             HHhHHHHHHH---------hcccccCCCC
Q psy14949          3 VENGKKIFTR---------ACAQCHTANE   22 (102)
Q Consensus         3 ~~~G~~lf~~---------~C~~CH~~~~   22 (102)
                      ++.|+.||-.         .|++||...-
T Consensus        62 ~aLGk~LffDprLS~sg~~SC~sCH~~~~   90 (364)
T COG1858          62 AALGKKLFFDPRLSASGTISCATCHNLAR   90 (364)
T ss_pred             HHHHHHhhcCcccCCCCCcCchhhcCccc
Confidence            5679999953         4999998764


No 59 
>PF09832 DUF2059:  Uncharacterized protein conserved in bacteria (DUF2059);  InterPro: IPR018637  This entry contains proteins that have no known function. ; PDB: 2X3O_B 3OAO_A.
Probab=82.99  E-value=1.2  Score=23.18  Aligned_cols=17  Identities=12%  Similarity=0.329  Sum_probs=13.6

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      ..+|++|+.+|++|..|
T Consensus        15 ~~ft~~El~~i~~FY~S   31 (64)
T PF09832_consen   15 EHFTEEELDAILAFYES   31 (64)
T ss_dssp             HHS-HHHHHHHHHHHHS
T ss_pred             HHCCHHHHHHHHHHHCC
Confidence            34689999999999976


No 60 
>PF07627 PSCyt3:  Protein of unknown function (DUF1588);  InterPro: IPR013039  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013042 from INTERPRO and IPR013043 from INTERPRO.
Probab=79.63  E-value=0.75  Score=26.77  Aligned_cols=8  Identities=63%  Similarity=1.389  Sum_probs=6.5

Q ss_pred             hcccccCC
Q psy14949         13 ACAQCHTA   20 (102)
Q Consensus        13 ~C~~CH~~   20 (102)
                      .|++||..
T Consensus        71 ~Ca~CH~~   78 (101)
T PF07627_consen   71 ACASCHRK   78 (101)
T ss_pred             cHHHHhhh
Confidence            49999973


No 61 
>TIGR03153 cytochr_NrfH cytochrome c nitrate reductase, small subunit. Members of this protein family are NrfH, a tetraheme cytochrome c. NrfH is the cytochrome c nitrate reductase small subunit, and forms a heterodimer with NrfA, the catalytic subunit. While NrfA can act as a monomer, NrfH can bind to and anchor NrfA in the membrane and enables electron transfer to NrfA from quinones.
Probab=78.93  E-value=0.77  Score=27.98  Aligned_cols=16  Identities=25%  Similarity=0.885  Sum_probs=12.3

Q ss_pred             hHHHHHHHhcccccCC
Q psy14949          5 NGKKIFTRACAQCHTA   20 (102)
Q Consensus         5 ~G~~lf~~~C~~CH~~   20 (102)
                      .++++.+.+|.+||+.
T Consensus        96 ~~~~~~~~nC~~CH~~  111 (135)
T TIGR03153        96 HSRKVVQENCVRCHAG  111 (135)
T ss_pred             HHhHhhhcchHHHHhH
Confidence            3466777899999974


No 62 
>PF08090 Enterotoxin_HS1:  Heat stable E.coli enterotoxin 1;  InterPro: IPR012557 Heat-stable toxin 1 of entero-aggregative Escherichia coli (EAST1) is a small toxin. It is not, however, solely associated with entero-aggregative E. coli but also with many other diarrhoeic E. coli families. Some studies have established the role of EAST1 in some human outbreaks of diarrhoea. Isolates from farm animals have been shown to carry the astA gene coding for EAST1. However, the relation between the presence of EAST1 and disease is not conclusive [].
Probab=77.01  E-value=0.88  Score=20.70  Aligned_cols=10  Identities=40%  Similarity=1.022  Sum_probs=7.6

Q ss_pred             HhcccccCCC
Q psy14949         12 RACAQCHTAN   21 (102)
Q Consensus        12 ~~C~~CH~~~   21 (102)
                      ..|++||+..
T Consensus        20 tac~s~~grt   29 (36)
T PF08090_consen   20 TACGSCHGRT   29 (36)
T ss_pred             hhhccCCCCc
Confidence            3699999754


No 63 
>COG3488 Predicted thiol oxidoreductase [Energy production and conversion]
Probab=74.97  E-value=1.3  Score=31.38  Aligned_cols=19  Identities=32%  Similarity=0.815  Sum_probs=13.2

Q ss_pred             HHHH-hcccccCCCCCCCCC
Q psy14949          9 IFTR-ACAQCHTANEGGANK   27 (102)
Q Consensus         9 lf~~-~C~~CH~~~~~g~~~   27 (102)
                      +|+. .|..||-.+|-|.++
T Consensus        93 lfN~raCqnCHvkDGRGrPP  112 (481)
T COG3488          93 LFNTRACQNCHVKDGRGRPP  112 (481)
T ss_pred             ccccccccccccccCCCCCC
Confidence            5664 599999888655443


No 64 
>PF07583 PSCyt2:  Protein of unknown function (DUF1549);  InterPro: IPR011444 The function is not known. It is found associated with IPR022655 from INTERPRO. It is also found associated with the Planctomycete cytochrome C domain IPR011429 from INTERPRO.
Probab=73.90  E-value=1.5  Score=28.81  Aligned_cols=7  Identities=71%  Similarity=1.611  Sum_probs=6.0

Q ss_pred             hcccccC
Q psy14949         13 ACAQCHT   19 (102)
Q Consensus        13 ~C~~CH~   19 (102)
                      .|+.||-
T Consensus       176 ~CAqCHd  182 (208)
T PF07583_consen  176 QCAQCHD  182 (208)
T ss_pred             chhhccC
Confidence            5999994


No 65 
>PF11845 DUF3365:  Protein of unknown function (DUF3365);  InterPro: IPR021796  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 198 to 657 amino acids in length. 
Probab=70.98  E-value=1.2  Score=28.13  Aligned_cols=8  Identities=38%  Similarity=1.182  Sum_probs=6.9

Q ss_pred             HhcccccC
Q psy14949         12 RACAQCHT   19 (102)
Q Consensus        12 ~~C~~CH~   19 (102)
                      ..|..||+
T Consensus       147 ~~CL~CHg  154 (188)
T PF11845_consen  147 ESCLSCHG  154 (188)
T ss_pred             hHHHHccC
Confidence            46999998


No 66 
>PF15182 OTOS:  Otospiralin
Probab=64.95  E-value=8.9  Score=20.39  Aligned_cols=23  Identities=22%  Similarity=0.312  Sum_probs=19.0

Q ss_pred             CccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         78 TKMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        78 ~~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                      ..||++.. |..|.|.-+.|+++|
T Consensus        15 pa~PYWPf-stsDFW~YveyFrtl   37 (69)
T PF15182_consen   15 PAMPYWPF-STSDFWNYVEYFRTL   37 (69)
T ss_pred             CcCCcCCc-cchHHHHHHHHHHHh
Confidence            46788877 678999999999986


No 67 
>COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only]
Probab=62.35  E-value=15  Score=25.37  Aligned_cols=31  Identities=23%  Similarity=0.286  Sum_probs=23.9

Q ss_pred             cHHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHH
Q psy14949         60 SASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLI   95 (102)
Q Consensus        60 ~~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~   95 (102)
                      +.+.+..+++.     .+..|||+...|+++|++..
T Consensus       226 daq~Il~yL~~-----~gG~mpf~DKSsPEdIk~~F  256 (287)
T COG2996         226 DAQMILTYLES-----NGGFMPFNDKSSPEDIKATF  256 (287)
T ss_pred             hHHHHHHHHHH-----cCCccccCCCCCHHHHHHHh
Confidence            45556677764     47789999998999999864


No 68 
>PF02304 Phage_B:  Scaffold protein B;  InterPro: IPR003513 This is a family of proteins from single-stranded DNA bacteriophages. Scaffold proteins B and D are required for procapsid formation. Sixty copies of the internal scaffold protein B are found in the procapsid.; GO: 0019069 viral capsid assembly, 0046729 viral procapsid; PDB: 1CD3_B 1AL0_B.
Probab=62.35  E-value=6.1  Score=23.22  Aligned_cols=18  Identities=39%  Similarity=0.837  Sum_probs=13.0

Q ss_pred             cHHhHHHHHHHh--cccccC
Q psy14949          2 SVENGKKIFTRA--CAQCHT   19 (102)
Q Consensus         2 d~~~G~~lf~~~--C~~CH~   19 (102)
                      +++.|+.+|.++  |+.|--
T Consensus        63 ~iE~~ka~~~R~FG~A~~~d   82 (117)
T PF02304_consen   63 DIEAGKAACARRFGCATCDD   82 (117)
T ss_dssp             HHHHHHHHHHHHHHSS--SC
T ss_pred             HHHHHHHHHHHHcCCCCcch
Confidence            578899999975  999973


No 69 
>TIGR01904 GSu_C4xC__C2xCH Geobacter sulfurreducens CxxxxCH...CXXCH domain. This domain occurs from three to eight times in eight different proteins of Geobacter sulfurreducens. The final CXXCH motif matches ProSite motif PS00190, the cytochrome c family heme-binding site signature, suggesting
Probab=61.17  E-value=3.2  Score=20.17  Aligned_cols=6  Identities=50%  Similarity=1.564  Sum_probs=5.3

Q ss_pred             hccccc
Q psy14949         13 ACAQCH   18 (102)
Q Consensus        13 ~C~~CH   18 (102)
                      .|.+||
T Consensus        37 ~C~~CH   42 (42)
T TIGR01904        37 GCNGCH   42 (42)
T ss_pred             cCcccC
Confidence            599999


No 70 
>TIGR01905 paired_CXXCH_1 doubled CXXCH domain. This model represents a domain of about 41 amino acids that contains, among other motifs, two copies of the motif CXXCH associated with heme binding. Almost every member of this family has at least three copies of this domain (at least six copies of CXXCH) is predicted to be a high molecular weight c-type cytochrome. Members are found mostly in species of Shewanella, Geobacter, and Vibrio.
Probab=60.35  E-value=3.5  Score=19.83  Aligned_cols=9  Identities=33%  Similarity=1.147  Sum_probs=7.3

Q ss_pred             hcccccCCC
Q psy14949         13 ACAQCHTAN   21 (102)
Q Consensus        13 ~C~~CH~~~   21 (102)
                      .|.+||..-
T Consensus         8 ~C~~CH~pH   16 (41)
T TIGR01905         8 DCTSCHDPH   16 (41)
T ss_pred             Ccccccccc
Confidence            599999754


No 71 
>PHA00003 B internal scaffolding protein
Probab=58.20  E-value=8.2  Score=22.74  Aligned_cols=18  Identities=39%  Similarity=0.676  Sum_probs=15.0

Q ss_pred             cHHhHHHHHHHh--cccccC
Q psy14949          2 SVENGKKIFTRA--CAQCHT   19 (102)
Q Consensus         2 d~~~G~~lf~~~--C~~CH~   19 (102)
                      +++.|+.+|.++  |+.|--
T Consensus        66 ~iEagk~~c~RrFGgAtcdd   85 (120)
T PHA00003         66 DIEAGKAICARRFGGATCDD   85 (120)
T ss_pred             HHHHHHHHHHHHcCCCCcch
Confidence            578899999974  999974


No 72 
>PF09699 Paired_CXXCH_1:  Doubled CXXCH motif (Paired_CXXCH_1)
Probab=56.92  E-value=3.4  Score=19.52  Aligned_cols=9  Identities=33%  Similarity=1.150  Sum_probs=7.2

Q ss_pred             hcccccCCC
Q psy14949         13 ACAQCHTAN   21 (102)
Q Consensus        13 ~C~~CH~~~   21 (102)
                      .|.+||..-
T Consensus         8 ~C~~CH~~H   16 (41)
T PF09699_consen    8 QCTSCHDPH   16 (41)
T ss_pred             ChhHhcccc
Confidence            499999755


No 73 
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=54.36  E-value=5.7  Score=17.07  Aligned_cols=8  Identities=63%  Similarity=1.290  Sum_probs=6.1

Q ss_pred             hcccccCC
Q psy14949         13 ACAQCHTA   20 (102)
Q Consensus        13 ~C~~CH~~   20 (102)
                      .|+.||.+
T Consensus        18 rCa~C~~V   25 (25)
T PF06943_consen   18 RCACCHTV   25 (25)
T ss_pred             ECCccCcC
Confidence            49999963


No 74 
>COG3043 NapB Nitrate reductase cytochrome c-type subunit [Energy production and conversion]
Probab=53.33  E-value=11  Score=23.56  Aligned_cols=8  Identities=38%  Similarity=1.207  Sum_probs=5.6

Q ss_pred             hcccccCC
Q psy14949         13 ACAQCHTA   20 (102)
Q Consensus        13 ~C~~CH~~   20 (102)
                      .|.+||+.
T Consensus        88 ~CLsCH~~   95 (155)
T COG3043          88 RCLSCHSV   95 (155)
T ss_pred             hhhhccCH
Confidence            48888864


No 75 
>PF12162 STAT1_TAZ2bind:  STAT1 TAZ2 binding domain;  InterPro: IPR022752 This entry represents the C-terminal domain of STAT1, which selectively binds the TAZ2 domain of CRB (CREB-binding protein) []. This group of eukaryotic proteins is approximately 20 amino acids in length, and is found in association with PF02865 from PFAM, PF00017 from PFAM, PF01017 from PFAM, PF02864 from PFAM. By binding to CRB, it becomes a transcriptional activator and can initiate transcription of certain genes. ; GO: 0003700 sequence-specific DNA binding transcription factor activity; PDB: 2KA6_B.
Probab=53.20  E-value=18  Score=15.12  Aligned_cols=18  Identities=17%  Similarity=0.200  Sum_probs=10.0

Q ss_pred             CCccCCCCCCCHHHHHHHHHHH
Q psy14949         77 GTKMVFPGLRKEKDREDLIAYL   98 (102)
Q Consensus        77 ~~~m~~~~~ls~~e~~~l~~yl   98 (102)
                      .++||    ||++|..+|-.++
T Consensus         5 dnmmP----MSPddy~~l~~~V   22 (23)
T PF12162_consen    5 DNMMP----MSPDDYDELERMV   22 (23)
T ss_dssp             TS-------S-HHHHHHHHHHH
T ss_pred             hcccC----CCHHHHHHHHHhh
Confidence            35566    5788888887664


No 76 
>PF09722 DUF2384:  Protein of unknown function (DUF2384);  InterPro: IPR024467 This domain is found predominantly in proteobacterial proteins. Its function in unknown.
Probab=52.81  E-value=11  Score=18.86  Aligned_cols=41  Identities=22%  Similarity=0.401  Sum_probs=26.7

Q ss_pred             cHHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHHHHHhhc
Q psy14949         60 SASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        60 ~~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~~yl~sl  101 (102)
                      +.+....|+..|.....+- -|..-+.|+..+..|..||..+
T Consensus        10 d~~~a~~Wl~~p~~~l~g~-~Plel~~t~~G~~~V~~~L~~~   50 (54)
T PF09722_consen   10 DEDKARRWLRTPNPALGGR-TPLELLRTEAGAERVLDYLDRI   50 (54)
T ss_pred             CHHHHHHHHHChHHHhCCC-CHHHHHcChHHHHHHHHHHHHH
Confidence            4677889999888654331 1111122578888999998764


No 77 
>PF13822 ACC_epsilon:  Acyl-CoA carboxylase epsilon subunit
Probab=52.55  E-value=15  Score=19.21  Aligned_cols=16  Identities=19%  Similarity=0.241  Sum_probs=13.5

Q ss_pred             CCHHHHHHHHHHHhhc
Q psy14949         86 RKEKDREDLIAYLSTL  101 (102)
Q Consensus        86 ls~~e~~~l~~yl~sl  101 (102)
                      -|++|+.+|++-|.++
T Consensus        11 Pt~eElAAL~aVlaa~   26 (62)
T PF13822_consen   11 PTDEELAALTAVLAAR   26 (62)
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            4899999999988764


No 78 
>cd07321 Extradiol_Dioxygenase_3A_like Subunit A of Class III extradiol dioxygenases. Extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings.  There are two major groups of dioxygenases according to the cleavage site of the aromatic ring. Intradiol enzymes cleave the aromatic ring between two hydroxyl groups, whereas extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes are evolutionary related and show sequence similarity, with the two domain class II enzymes evolving from the class I enzyme through gene duplication. Class III enzymes are different in sequence and structure and usually have two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents subunit A of c
Probab=52.22  E-value=7.7  Score=21.30  Aligned_cols=31  Identities=13%  Similarity=0.310  Sum_probs=21.7

Q ss_pred             cHHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHHH
Q psy14949         60 SASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLIA   96 (102)
Q Consensus        60 ~~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~~   96 (102)
                      +++...+|+.+|.++..    . .+ ||++|+.+|.+
T Consensus        15 ~~~~re~f~~dp~a~~~----~-~~-Lt~eE~~al~~   45 (77)
T cd07321          15 KPEVKERFKADPEAVLA----E-YG-LTPEEKAALLA   45 (77)
T ss_pred             CHHHHHHHHhCHHHHHH----H-cC-CCHHHHHHHHc
Confidence            46678888888776543    1 23 48999998864


No 79 
>COG3445 Acid-induced glycyl radical enzyme [General function prediction only]
Probab=52.09  E-value=18  Score=21.09  Aligned_cols=38  Identities=29%  Similarity=0.477  Sum_probs=27.9

Q ss_pred             cccHHHHHHHHhCCCCCCC------CCccCCCCCCCHHHHHHHHH
Q psy14949         58 TWSASTLDIYLQNPKKYIP------GTKMVFPGLRKEKDREDLIA   96 (102)
Q Consensus        58 ~~~~~~l~~~~~~~~~~~~------~~~m~~~~~ls~~e~~~l~~   96 (102)
                      ....+.|.+.+++|.++..      |....|+.+ ++++-+++++
T Consensus        77 vl~retledav~~pekypqltirvsgyavrfnsl-tpeqqrdvi~  120 (127)
T COG3445          77 VLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSL-TPEQQRDVIA  120 (127)
T ss_pred             eeehhhHHHHhhCcccCCceEEEEeeEEEEeccC-CHHHhhhHHH
Confidence            3567889999999997653      344457766 7888888876


No 80 
>TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein. Members of this family represent a set of proteins related to, yet architecturally different from, the activating protein for the glycine radical-containing, oxygen-sensitive ribonucleoside-triphosphate reductase (RNR) as described in model TIGR02491. Members of this family are found paired with members of a similarly divergent set of anaerobic ribonucleoside-triphosphate reductases. Identification of this protein as an RNR activitating protein is partly from pairing with a candidate RNR. It is further supported by our finding that upstream of these operons are examples of a conserved regulatory element (described Rodionov and Gelfand) that is found in nearly all bacteria and that occurs specifically upstream of operons for all three classes of RNR genes.
Probab=51.18  E-value=36  Score=20.97  Aligned_cols=9  Identities=33%  Similarity=1.139  Sum_probs=7.1

Q ss_pred             hcccccCCC
Q psy14949         13 ACAQCHTAN   21 (102)
Q Consensus        13 ~C~~CH~~~   21 (102)
                      .|..||...
T Consensus        28 rC~~C~n~~   36 (147)
T TIGR02826        28 GCKGCHSPE   36 (147)
T ss_pred             CCCCCCChH
Confidence            599999754


No 81 
>PHA02902 putative IMV membrane protein; Provisional
Probab=50.61  E-value=20  Score=19.13  Aligned_cols=20  Identities=15%  Similarity=0.125  Sum_probs=15.7

Q ss_pred             CCCCCCCHHHHHHHHHHHhh
Q psy14949         81 VFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~s  100 (102)
                      .|...|+++|++++=.++-+
T Consensus        49 ~F~D~lTpDQirAlHrlvT~   68 (70)
T PHA02902         49 LFKDSLTPDQIKALHRLVSL   68 (70)
T ss_pred             hhhccCCHHHHHHHHHHHhc
Confidence            47778899999998877643


No 82 
>PF14769 CLAMP:  Flagellar C1a complex subunit C1a-32
Probab=50.30  E-value=47  Score=18.94  Aligned_cols=18  Identities=17%  Similarity=0.348  Sum_probs=15.1

Q ss_pred             CCCCCHHHHHHHHHHHhh
Q psy14949         83 PGLRKEKDREDLIAYLST  100 (102)
Q Consensus        83 ~~~ls~~e~~~l~~yl~s  100 (102)
                      .++.|.+|+++|++|+.+
T Consensus        61 ~~iFs~~~~~~i~~y~~~   78 (101)
T PF14769_consen   61 IGIFSVDQVKAIIDYFHN   78 (101)
T ss_pred             cCcCCHHHHHHHHHHHHH
Confidence            456799999999999864


No 83 
>PF04320 DUF469:  Protein with unknown function (DUF469);  InterPro: IPR007416 This entry represents a family of uncharacterised proteins which are predicted to function as phosphotransferases.
Probab=49.27  E-value=25  Score=20.52  Aligned_cols=18  Identities=33%  Similarity=0.453  Sum_probs=15.1

Q ss_pred             CCCCHHHHHHHHHHHhhc
Q psy14949         84 GLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~sl  101 (102)
                      +..|++++.+|.+||++.
T Consensus        68 gs~tee~R~~v~~WL~~~   85 (101)
T PF04320_consen   68 GSCTEEDRAAVEAWLKAR   85 (101)
T ss_pred             CCCCHHHHHHHHHHHHhC
Confidence            345899999999999874


No 84 
>PRK11586 napB nitrate reductase cytochrome C550 subunit; Provisional
Probab=48.51  E-value=13  Score=23.09  Aligned_cols=6  Identities=67%  Similarity=1.630  Sum_probs=3.1

Q ss_pred             cccccC
Q psy14949         14 CAQCHT   19 (102)
Q Consensus        14 C~~CH~   19 (102)
                      |.+||.
T Consensus        83 CL~CH~   88 (149)
T PRK11586         83 CLQCHG   88 (149)
T ss_pred             CccCCC
Confidence            555554


No 85 
>cd07921 PCA_45_Doxase_A_like Subunit A of the Class III Extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, and similar enzymes. This subfamily includes the A subunit of protocatechuate (PCA) 4,5-dioxygenase (LigAB) and two subfamilies of unknown function. The A subunit is the smaller, non-catalytic subunit of LigAB. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds. PCA 4,5-dioxygenase is one of the aromatic ring opening dioxygenases which play key roles in the degradation of aromatic compounds. As members of the Class III extradiol dioxygenase family, the enzymes use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit.
Probab=47.67  E-value=11  Score=22.18  Aligned_cols=31  Identities=13%  Similarity=0.295  Sum_probs=21.9

Q ss_pred             cHHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHHH
Q psy14949         60 SASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLIA   96 (102)
Q Consensus        60 ~~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~~   96 (102)
                      ..+...+|+.+|.++..    . .+ ||+||+.+|.+
T Consensus        25 ~a~~Re~F~aD~eAy~~----~-~g-LTeEe~~AV~~   55 (106)
T cd07921          25 KAENREAFKADEEAYCD----K-FG-LTEEQKQAVLD   55 (106)
T ss_pred             CHHHHHHHHhCHHHHHH----H-cC-CCHHHHHHHHh
Confidence            56778888888876543    1 23 48999998864


No 86 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=46.45  E-value=6.6  Score=17.72  Aligned_cols=9  Identities=56%  Similarity=1.139  Sum_probs=7.0

Q ss_pred             hcccccCCC
Q psy14949         13 ACAQCHTAN   21 (102)
Q Consensus        13 ~C~~CH~~~   21 (102)
                      .|+.||.++
T Consensus        21 rCs~C~~vt   29 (31)
T TIGR01053        21 RCALCQTVN   29 (31)
T ss_pred             ECCCCCeEe
Confidence            599999764


No 87 
>PHA02119 hypothetical protein
Probab=46.40  E-value=14  Score=20.02  Aligned_cols=10  Identities=40%  Similarity=0.953  Sum_probs=8.2

Q ss_pred             HHHHHHHhhc
Q psy14949         92 EDLIAYLSTL  101 (102)
Q Consensus        92 ~~l~~yl~sl  101 (102)
                      ++|+.||++|
T Consensus        57 ~divdylr~l   66 (87)
T PHA02119         57 KDIVDYLRSL   66 (87)
T ss_pred             HHHHHHHHHc
Confidence            4789999986


No 88 
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development. The PB1 domain of Map2k5 interacts with the PB1 domain of another members of kinase cascade MEKK2 (or MEKK3).  A canonical PB1-PB1 interaction, involving heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The Map2k5 protein contains a type I PB1 domain.
Probab=44.57  E-value=21  Score=20.01  Aligned_cols=15  Identities=13%  Similarity=0.594  Sum_probs=12.5

Q ss_pred             CCHHHHHHHHHHHhh
Q psy14949         86 RKEKDREDLIAYLST  100 (102)
Q Consensus        86 ls~~e~~~l~~yl~s  100 (102)
                      -||+|++++++|.-+
T Consensus        57 RSDeEm~AMlsyy~~   71 (91)
T cd06395          57 RSDEEMKAMLSYYCS   71 (91)
T ss_pred             cchHHHHHHHHHHHH
Confidence            379999999999644


No 89 
>COG3303 NrfA Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit [Inorganic ion transport and metabolism]
Probab=44.53  E-value=8.2  Score=27.94  Aligned_cols=14  Identities=43%  Similarity=0.975  Sum_probs=10.1

Q ss_pred             HHHHHhcccccCCC
Q psy14949          8 KIFTRACAQCHTAN   21 (102)
Q Consensus         8 ~lf~~~C~~CH~~~   21 (102)
                      .-|.+-|+.||.-+
T Consensus       327 ~~f~stCanCH~Qs  340 (501)
T COG3303         327 DNFASTCANCHTQS  340 (501)
T ss_pred             HHHHHHHhhhhhhh
Confidence            34667799999643


No 90 
>PF14522 Cytochrome_C7:  Cytochrome c7; PDB: 3OV0_A 3OUQ_A 3H4N_A 3BXU_B 1OS6_A 2LDO_A 3OUE_A 3H33_A 1RWJ_A 1LM2_A ....
Probab=44.07  E-value=9.2  Score=19.51  Aligned_cols=9  Identities=44%  Similarity=1.128  Sum_probs=7.2

Q ss_pred             HhcccccCC
Q psy14949         12 RACAQCHTA   20 (102)
Q Consensus        12 ~~C~~CH~~   20 (102)
                      ..|..||+.
T Consensus        13 ~~C~~CH~~   21 (65)
T PF14522_consen   13 VNCASCHSD   21 (65)
T ss_dssp             TCGCCTSTT
T ss_pred             CChhhhCCC
Confidence            369999974


No 91 
>PF03892 NapB:  Nitrate reductase cytochrome c-type subunit (NapB);  InterPro: IPR005591 The napB gene encodes a dihaem cytochrome c, the small subunit of a heterodimeric periplasmic nitrate reductase [].; PDB: 3O5A_B 3ML1_B 1OGY_L 1JNI_A.
Probab=43.94  E-value=12  Score=22.87  Aligned_cols=7  Identities=43%  Similarity=1.417  Sum_probs=3.7

Q ss_pred             cccccCC
Q psy14949         14 CAQCHTA   20 (102)
Q Consensus        14 C~~CH~~   20 (102)
                      |.+||..
T Consensus        72 Cl~CH~~   78 (133)
T PF03892_consen   72 CLSCHSP   78 (133)
T ss_dssp             CHHHHST
T ss_pred             CcccCCc
Confidence            5555543


No 92 
>COG3184 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=43.12  E-value=12  Score=24.14  Aligned_cols=19  Identities=11%  Similarity=0.378  Sum_probs=16.1

Q ss_pred             CCCCCCHHHHHHHHHHHhh
Q psy14949         82 FPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        82 ~~~~ls~~e~~~l~~yl~s  100 (102)
                      |....|++|+.+|.+|..|
T Consensus       104 Ya~~FT~eEl~ai~aFY~S  122 (183)
T COG3184         104 YAKIFTEEELNAITAFYGS  122 (183)
T ss_pred             HHHhcCHHHHHHHHHHHcC
Confidence            5566799999999999865


No 93 
>PF11256 DUF3055:  Protein of unknown function (DUF3055);  InterPro: IPR021415  This family of proteins with unknown function appear to be restricted to Firmicutes. 
Probab=42.52  E-value=30  Score=19.31  Aligned_cols=15  Identities=33%  Similarity=0.578  Sum_probs=13.4

Q ss_pred             CHHHHHHHHHHHhhc
Q psy14949         87 KEKDREDLIAYLSTL  101 (102)
Q Consensus        87 s~~e~~~l~~yl~sl  101 (102)
                      +++|..+|.+||..+
T Consensus        67 ~~eea~eL~~fl~~~   81 (81)
T PF11256_consen   67 SEEEAEELREFLYEL   81 (81)
T ss_pred             CHHHHHHHHHHHhhC
Confidence            899999999999764


No 94 
>PF07128 DUF1380:  Protein of unknown function (DUF1380);  InterPro: IPR009811 This family consists of several hypothetical bacterial proteins of around 140 residues in length. Members of this family seem to be specific to Enterobacteria. The function of this family is unknown.
Probab=41.49  E-value=69  Score=19.83  Aligned_cols=33  Identities=9%  Similarity=0.333  Sum_probs=21.8

Q ss_pred             ccccHHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHHHHHhh
Q psy14949         57 ITWSASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        57 ~~~~~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~~yl~s  100 (102)
                      +.|+.+.+..... +....          +|++|+..|..+|-.
T Consensus        25 lIWT~eDV~~~a~-gme~~----------lTd~E~~aVL~~I~~   57 (139)
T PF07128_consen   25 LIWTREDVRALAD-GMEYN----------LTDDEARAVLARIGD   57 (139)
T ss_pred             EEecHHHHHHHHh-cCCCC----------CCHHHHHHHHHHHhc
Confidence            4688888776644 22111          378899998888754


No 95 
>PHA02681 ORF089 virion membrane protein; Provisional
Probab=41.04  E-value=31  Score=19.39  Aligned_cols=20  Identities=10%  Similarity=0.187  Sum_probs=15.8

Q ss_pred             CCCCCCCHHHHHHHHHHHhh
Q psy14949         81 VFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~s  100 (102)
                      .|...||++|++++=.++-+
T Consensus        47 ~F~D~lTpDQVrAlHRlvTs   66 (92)
T PHA02681         47 SFEDKMTDDQVRAFHALVTS   66 (92)
T ss_pred             hhhccCCHHHHHHHHHHHhC
Confidence            47778899999998877643


No 96 
>PF14537 Cytochrom_c3_2:  Cytochrome c3; PDB: 1D4C_A 1D4E_A 1D4D_A 2K3V_A 1QO8_D 2P0B_A 2OZY_A 1M64_A 1JRX_A 1QJD_A ....
Probab=40.95  E-value=14  Score=19.54  Aligned_cols=8  Identities=38%  Similarity=1.203  Sum_probs=6.5

Q ss_pred             hcccccCC
Q psy14949         13 ACAQCHTA   20 (102)
Q Consensus        13 ~C~~CH~~   20 (102)
                      .|..||+.
T Consensus         8 ~C~~CH~~   15 (80)
T PF14537_consen    8 NCVDCHGP   15 (80)
T ss_dssp             TGGGTSSS
T ss_pred             ChhHhCCC
Confidence            69999963


No 97 
>PF13435 Cytochrome_C554:  Cytochrome c554 and c-prime; PDB: 1BVB_A 1FT5_A 1FT6_A 1SP3_A.
Probab=39.51  E-value=13  Score=21.11  Aligned_cols=9  Identities=44%  Similarity=1.261  Sum_probs=7.4

Q ss_pred             hcccccCCC
Q psy14949         13 ACAQCHTAN   21 (102)
Q Consensus        13 ~C~~CH~~~   21 (102)
                      .|..||...
T Consensus        50 ~C~~CH~~~   58 (130)
T PF13435_consen   50 SCTSCHTPG   58 (130)
T ss_dssp             CCGGGSCCT
T ss_pred             cccccCCCc
Confidence            599999755


No 98 
>COG3005 TorC Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit [Energy production and conversion]
Probab=39.28  E-value=12  Score=24.30  Aligned_cols=10  Identities=30%  Similarity=0.962  Sum_probs=8.1

Q ss_pred             HhcccccCCC
Q psy14949         12 RACAQCHTAN   21 (102)
Q Consensus        12 ~~C~~CH~~~   21 (102)
                      ..|..||..+
T Consensus       135 ~eCr~CH~~~  144 (190)
T COG3005         135 AECRNCHNFD  144 (190)
T ss_pred             hhhhhccchh
Confidence            4599999876


No 99 
>PRK11702 hypothetical protein; Provisional
Probab=38.92  E-value=41  Score=19.86  Aligned_cols=18  Identities=22%  Similarity=0.235  Sum_probs=15.0

Q ss_pred             CCCCHHHHHHHHHHHhhc
Q psy14949         84 GLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~sl  101 (102)
                      +..|++++.+|.+||++.
T Consensus        75 gs~tEe~R~~V~~WL~~r   92 (108)
T PRK11702         75 GKCTEEHRALVKKWLEGR   92 (108)
T ss_pred             CCCCHHHHHHHHHHHHhC
Confidence            345899999999999863


No 100
>PF06252 DUF1018:  Protein of unknown function (DUF1018);  InterPro: IPR009363 This family consists of several bacterial and phage proteins, related to Gp16 of phage Mu, of unknown function.
Probab=38.90  E-value=34  Score=20.15  Aligned_cols=13  Identities=8%  Similarity=0.046  Sum_probs=7.5

Q ss_pred             CHHHHHHHHHHHh
Q psy14949         87 KEKDREDLIAYLS   99 (102)
Q Consensus        87 s~~e~~~l~~yl~   99 (102)
                      +..++..|.+-..
T Consensus        56 ~~~q~~KI~aLw~   68 (119)
T PF06252_consen   56 TSAQLRKIRALWK   68 (119)
T ss_pred             chHHHHHHHHHHH
Confidence            4566666655544


No 101
>CHL00037 petA cytochrome f
Probab=38.79  E-value=10  Score=26.38  Aligned_cols=8  Identities=75%  Similarity=1.539  Sum_probs=6.6

Q ss_pred             cccccCCC
Q psy14949         14 CAQCHTAN   21 (102)
Q Consensus        14 C~~CH~~~   21 (102)
                      |+.||-..
T Consensus        56 CANCHLA~   63 (320)
T CHL00037         56 CANCHLAN   63 (320)
T ss_pred             eecccccc
Confidence            99999654


No 102
>PRK02693 apocytochrome f; Reviewed
Probab=37.87  E-value=11  Score=26.05  Aligned_cols=8  Identities=63%  Similarity=1.410  Sum_probs=6.6

Q ss_pred             cccccCCC
Q psy14949         14 CAQCHTAN   21 (102)
Q Consensus        14 C~~CH~~~   21 (102)
                      |+.||-..
T Consensus        49 CANCHLA~   56 (312)
T PRK02693         49 CANCHLAQ   56 (312)
T ss_pred             eecccccc
Confidence            99999654


No 103
>PF07102 DUF1364:  Protein of unknown function (DUF1364);  InterPro: IPR010774 This entry is represented by Bacteriophage 82, YbcO. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several bacterial and phage proteins of around 95 residues in length. The function of this family is unknown.; PDB: 3G27_A.
Probab=37.19  E-value=8.4  Score=22.16  Aligned_cols=8  Identities=50%  Similarity=1.344  Sum_probs=5.5

Q ss_pred             hcccccCC
Q psy14949         13 ACAQCHTA   20 (102)
Q Consensus        13 ~C~~CH~~   20 (102)
                      .|++||..
T Consensus        53 aCs~CHd~   60 (94)
T PF07102_consen   53 ACSACHDE   60 (94)
T ss_dssp             E-HHHHHH
T ss_pred             hHHHHHHH
Confidence            49999964


No 104
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=36.98  E-value=11  Score=17.77  Aligned_cols=8  Identities=25%  Similarity=0.845  Sum_probs=6.2

Q ss_pred             hcccccCC
Q psy14949         13 ACAQCHTA   20 (102)
Q Consensus        13 ~C~~CH~~   20 (102)
                      .|.+|||+
T Consensus        21 ~C~~C~G~   28 (41)
T PF13453_consen   21 VCPSCGGI   28 (41)
T ss_pred             ECCCCCeE
Confidence            59999964


No 105
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=36.61  E-value=32  Score=17.58  Aligned_cols=15  Identities=27%  Similarity=0.479  Sum_probs=12.4

Q ss_pred             CHHHHHHHHHHHhhc
Q psy14949         87 KEKDREDLIAYLSTL  101 (102)
Q Consensus        87 s~~e~~~l~~yl~sl  101 (102)
                      ..+.+..|+.|||+.
T Consensus        12 ~~e~L~~l~~YLR~~   26 (55)
T PF13821_consen   12 PEERLDKLLSYLREE   26 (55)
T ss_pred             HHHHHHHHHHHHHhh
Confidence            478899999999873


No 106
>TIGR02161 napC_nirT periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family. Nearly every member of this subfamily is NapC, a predicted membrane-anchored four-heme c-type cytochrome that forms one component of the periplasmic nitrate reductase along with NapA, NapB, NapD, NapE, and NapF subunits. A single known exception at this time is NirT, which is instead a component of a nitrite reductase. This family excludes TorC subunits of trimethylamine N-oxide (TMAO) reductases.
Probab=36.16  E-value=15  Score=23.76  Aligned_cols=10  Identities=30%  Similarity=0.866  Sum_probs=7.8

Q ss_pred             HhcccccCCC
Q psy14949         12 RACAQCHTAN   21 (102)
Q Consensus        12 ~~C~~CH~~~   21 (102)
                      +.|..||+.+
T Consensus       136 ~~C~~CH~~~  145 (185)
T TIGR02161       136 LECRNCHNFE  145 (185)
T ss_pred             hhchhhcCcc
Confidence            4799999844


No 107
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=36.16  E-value=14  Score=18.88  Aligned_cols=10  Identities=30%  Similarity=0.946  Sum_probs=8.3

Q ss_pred             hcccccCCCC
Q psy14949         13 ACAQCHTANE   22 (102)
Q Consensus        13 ~C~~CH~~~~   22 (102)
                      .|..||..+|
T Consensus        24 IC~~C~~hNG   33 (54)
T PF10058_consen   24 ICSKCFSHNG   33 (54)
T ss_pred             ECcccchhhc
Confidence            5999998774


No 108
>smart00386 HAT HAT (Half-A-TPR) repeats. Present in several RNA-binding proteins. Structurally and sequentially thought to be similar to TPRs.
Probab=36.11  E-value=31  Score=14.20  Aligned_cols=18  Identities=28%  Similarity=0.456  Sum_probs=13.4

Q ss_pred             CcHHhHHHHHHHhccccc
Q psy14949          1 MSVENGKKIFTRACAQCH   18 (102)
Q Consensus         1 ~d~~~G~~lf~~~C~~CH   18 (102)
                      ++.+..+.+|.+.+..|+
T Consensus         1 ~~~~~~r~i~e~~l~~~~   18 (33)
T smart00386        1 GDIERARKIYERALEKFP   18 (33)
T ss_pred             CcHHHHHHHHHHHHHHCC
Confidence            466778889987766665


No 109
>cd08168 Cytochrom_C3 Heme-binding domain of the class III cytochrome C family and related proteins. This alignment models heme binding core motifs as encountered in the cytochrome C3 family and related proteins. Cytochrome C3 is a tetraheme protein found in sulfate-reducing bacteria which use either thiosulfate or sulfate as the ultimate electron acceptors. C3 is an integral part of a complex electron transfer chain. The model also contains triheme cytochromes C7 which function in electron transfer during Fe(III) respiration by Geobacter sulfurreducens (PpcA, PpcB, PpcC, PpcD, and PpcE) and four repeated core motifs as found in the 16-heme cytochrome C HmcA of Desulfovibrio vulgaris Hildenborough which plays a role in electron transfer through the membrane following periplasmic oxidation of hydrogen (resulting in sulfate reduction in the cytoplasm).
Probab=35.76  E-value=13  Score=20.31  Aligned_cols=14  Identities=29%  Similarity=0.783  Sum_probs=9.7

Q ss_pred             HHHHHhcccccCCC
Q psy14949          8 KIFTRACAQCHTAN   21 (102)
Q Consensus         8 ~lf~~~C~~CH~~~   21 (102)
                      ..|-..|..||...
T Consensus        55 ~a~H~~C~~CH~~~   68 (85)
T cd08168          55 DAFHNSCIGCHKEM   68 (85)
T ss_pred             HHHHHhHHHHHHHH
Confidence            34445799999754


No 110
>PF03264 Cytochrom_NNT:  NapC/NirT cytochrome c family, N-terminal region;  InterPro: IPR005126 Within the NapC/NirT family of cytochrome c proteins, some members, such as NapC P33932 from SWISSPROT and NirT P24038 from SWISSPROT, bind four haem groups, while others, such as TorC P33226 from SWISSPROT, bind five haems. This family aligns the common N-terminal region that contains four haem-binding C-X(2)-CH motifs.; PDB: 2VR0_F 2J7A_C.
Probab=35.56  E-value=19  Score=22.67  Aligned_cols=16  Identities=31%  Similarity=0.638  Sum_probs=10.6

Q ss_pred             HHHHHHHh----cccccCCC
Q psy14949          6 GKKIFTRA----CAQCHTAN   21 (102)
Q Consensus         6 G~~lf~~~----C~~CH~~~   21 (102)
                      ....+..+    |..||...
T Consensus       115 ~~~~~~~~~~~~C~~CH~~~  134 (173)
T PF03264_consen  115 SWKRFKANDDSTCLNCHSDL  134 (173)
T ss_dssp             HHHHHHHH---HHHHHCHHH
T ss_pred             HHHHHHhhhcccCcccCCCc
Confidence            44555544    99999754


No 111
>PF02085 Cytochrom_CIII:  Class III cytochrome C family;  InterPro: IPR020942 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes []. Ambler [] recognised four classes of cytC. Class III comprises the low redox potential multiple haem cytochromes: cyt C7 (trihaem), C3 (tetrahaem), and high-molecular-weight cytC, HMC (hexadecahaem), with only 30-40 residues per haem group. The haem c groups, all bis-histidinyl coordinated, are structurally and functionally nonequivalent and present different redox potentials in the range 0 to -400 mV []. The 3D structures of a number of cyt C3 proteins have been determined. The proteins consist of 4-5 alpha-helices and 2 beta-strands wrapped around a compact core of four non-parallel haems, which present a relatively high degree of exposure to the solvent. The overall protein architecture, haem plane orientations and iron-iron distances are highly conserved [].; GO: 0009055 electron carrier activity, 0020037 heme binding; PDB: 1AQE_A 1CZJ_A 1H29_B 1GWS_A 2CVC_A 2KMY_A 1DUW_A 1UPD_A 1I77_A 1GMB_A ....
Probab=35.29  E-value=15  Score=20.91  Aligned_cols=9  Identities=33%  Similarity=0.973  Sum_probs=7.1

Q ss_pred             hcccccCCC
Q psy14949         13 ACAQCHTAN   21 (102)
Q Consensus        13 ~C~~CH~~~   21 (102)
                      .|.+||...
T Consensus        78 ~C~~CH~~~   86 (102)
T PF02085_consen   78 SCMGCHKEM   86 (102)
T ss_dssp             HHHHHHHHH
T ss_pred             hHHHHHHHH
Confidence            799999643


No 112
>cd07922 CarBa CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and   subsequent ring-opening of 2-aminophenyl-2,3-diol. CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol. 2-aminophenol 1,6-dioxygenase is a key enzyme in the carbazole degradation pathway isolated from bacterial strains with carbazole degradation ability. The enzyme is a heterotetramer composed of two A and two B subunits. CarB belongs to the class III extradiol dioxygenase family, composed of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Although the enzyme was originally isolated as a meta-cleavage enzyme for 2'-aminobiphenyl-2,3-diol involved in carbazole degradation, the enzyme has also shown high specificity for 2,3-dihydroxybiphenyl.
Probab=33.61  E-value=22  Score=19.81  Aligned_cols=31  Identities=13%  Similarity=0.234  Sum_probs=20.8

Q ss_pred             cHHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHHH
Q psy14949         60 SASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLIA   96 (102)
Q Consensus        60 ~~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~~   96 (102)
                      .++...+|+.+|.+...     -.+ ||++|+.+|..
T Consensus        16 dp~~rerF~~DPea~~~-----~~g-Lt~eE~~aL~~   46 (81)
T cd07922          16 DPGLIERFQDDPSAVFE-----EYG-LTPAERAALRE   46 (81)
T ss_pred             CHHHHHHHHHCHHHHHH-----HcC-CCHHHHHHHHc
Confidence            56677888888775432     123 48999888753


No 113
>KOG3507|consensus
Probab=33.52  E-value=17  Score=19.02  Aligned_cols=9  Identities=33%  Similarity=0.962  Sum_probs=7.4

Q ss_pred             hcccccCCC
Q psy14949         13 ACAQCHTAN   21 (102)
Q Consensus        13 ~C~~CH~~~   21 (102)
                      .|+.||+.+
T Consensus        22 iCgdC~~en   30 (62)
T KOG3507|consen   22 ICGDCGQEN   30 (62)
T ss_pred             Eeccccccc
Confidence            499999865


No 114
>PF08263 LRRNT_2:  Leucine rich repeat N-terminal domain;  InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []. LRRs occur in proteins ranging from viruses to eukaryotes, and appear to provide a structural framework for the formation of protein-protein interactions [, ].Proteins containing LRRs include tyrosine kinase receptors, cell-adhesion molecules, virulence factors, and extracellular matrix-binding glycoproteins, and are involved in a variety of biological processes, including signal transduction, cell adhesion, DNA repair, recombination, transcription, RNA processing, disease resistance, apoptosis, and the immune response []. Sequence analyses of LRR proteins suggested the existence of several different subfamilies of LRRs. The significance of this classification is that repeats from different subfamilies never occur simultaneously and have most probably evolved independently. It is, however, now clear that all major classes of LRR have curved horseshoe structures with a parallel beta sheet on the concave side and mostly helical elements on the convex side. At least six families of LRR proteins, characterised by different lengths and consensus sequences of the repeats, have been identified. Eleven-residue segments of the LRRs (LxxLxLxxN/CxL), corresponding to the beta-strand and adjacent loop regions, are conserved in LRR proteins, whereas the remaining parts of the repeats (herein termed variable) may be very different. Despite the differences, each of the variable parts contains two half-turns at both ends and a "linear" segment (as the chain follows a linear path overall), usually formed by a helix, in the middle. The concave face and the adjacent loops are the most common protein interaction surfaces on LRR proteins. 3D structure of some LRR proteins-ligand complexes show that the concave surface of LRR domain is ideal for interaction with alpha-helix, thus supporting earlier conclusions that the elongated and curved LRR structure provides an outstanding framework for achieving diverse protein-protein interactions []. Molecular modeling suggests that the conserved pattern LxxLxL, which is shorter than the previously proposed LxxLxLxxN/CxL is sufficient to impart the characteristic horseshoe curvature to proteins with 20- to 30-residue repeats [].  This domain is often found at the N terminus of tandem leucine rich repeats.; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1OGQ_A.
Probab=33.17  E-value=54  Score=15.30  Aligned_cols=14  Identities=36%  Similarity=0.738  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHhhc
Q psy14949         88 EKDREDLIAYLSTL  101 (102)
Q Consensus        88 ~~e~~~l~~yl~sl  101 (102)
                      ++|+.+|++|-+++
T Consensus         2 ~~d~~aLl~~k~~l   15 (43)
T PF08263_consen    2 NQDRQALLAFKKSL   15 (43)
T ss_dssp             HHHHHHHHHHHHCT
T ss_pred             cHHHHHHHHHHHhc
Confidence            57888999887765


No 115
>PF13986 DUF4224:  Domain of unknown function (DUF4224)
Probab=33.11  E-value=26  Score=17.25  Aligned_cols=13  Identities=15%  Similarity=0.524  Sum_probs=9.8

Q ss_pred             CCCHHHHHHHHHH
Q psy14949         85 LRKEKDREDLIAY   97 (102)
Q Consensus        85 ~ls~~e~~~l~~y   97 (102)
                      .||++|+..|-.|
T Consensus         2 fLT~~El~elTG~   14 (47)
T PF13986_consen    2 FLTDEELQELTGY   14 (47)
T ss_pred             CCCHHHHHHHHCC
Confidence            4688898888655


No 116
>PF02335 Cytochrom_C552:  Cytochrome c552;  InterPro: IPR003321 The enzyme cytochrome c nitrite reductase (c552) catalyses the six-electron reduction of nitrite to ammonia as one of the key steps in the biological nitrogen cycle, where it participates in the anaerobic energy metabolism of dissimilatory nitrate ammonification. Cytochrome c nitrite reductase from Sulfurospirillum deleyianum is a functional dimer, with 10 close-packed haem groups of type c and an unusual lysine-coordinated high-spin haem at the active site [].; GO: 0006807 nitrogen compound metabolic process, 0055114 oxidation-reduction process; PDB: 1QDB_B 3TTB_B 3BNJ_A 3BNG_A 1FS8_A 2E80_A 3BNH_A 1FS7_A 2E81_A 3BNF_A ....
Probab=32.77  E-value=20  Score=26.30  Aligned_cols=9  Identities=33%  Similarity=1.169  Sum_probs=7.3

Q ss_pred             HHhcccccC
Q psy14949         11 TRACAQCHT   19 (102)
Q Consensus        11 ~~~C~~CH~   19 (102)
                      .+.|..||.
T Consensus       272 ~~sC~~CH~  280 (434)
T PF02335_consen  272 ENSCQTCHS  280 (434)
T ss_dssp             HHCTTTTST
T ss_pred             hhHHhhhcC
Confidence            357999997


No 117
>TIGR03092 SASP_sspI small, acid-soluble spore protein I. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. It is a minor SASP (small, acid-soluble spore protein) designated SspI. The gene in Bacillus subtilis previously was designated ysfA.
Probab=32.65  E-value=46  Score=17.78  Aligned_cols=41  Identities=15%  Similarity=0.356  Sum_probs=24.8

Q ss_pred             cHHHHHHHHhCCC-----CCCCC--Ccc-CCCCCCCHHHHHHHHHHHhh
Q psy14949         60 SASTLDIYLQNPK-----KYIPG--TKM-VFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        60 ~~~~l~~~~~~~~-----~~~~~--~~m-~~~~~ls~~e~~~l~~yl~s  100 (102)
                      +.+.+..+|.+..     ...||  ..+ .++.-++++|...++..|..
T Consensus        14 s~~elk~~I~daI~sgEEk~LPGLGVlFE~~W~~~~~~ek~~m~~~l~~   62 (65)
T TIGR03092        14 TKEQLEATIVDAIQSGEEKMLPGLGVLFEAIWKHANEQEKDEMLETLEQ   62 (65)
T ss_pred             CHHHHHHHHHHHHhccchhcCCccHHHHHHHHHhcCHHHHHHHHHHHHH
Confidence            4566666665433     23444  222 23444589999999998865


No 118
>PF11829 DUF3349:  Protein of unknown function (DUF3349);  InterPro: IPR021784  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 99 to 124 amino acids in length. ; PDB: 2KVC_A 3OL3_B 3OL4_A 2LKY_A.
Probab=32.37  E-value=50  Score=19.08  Aligned_cols=16  Identities=13%  Similarity=0.150  Sum_probs=12.3

Q ss_pred             CCCCHHHHHHHHHHHh
Q psy14949         84 GLRKEKDREDLIAYLS   99 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~   99 (102)
                      ..||++|+.+|+.-|.
T Consensus        34 r~Ltd~ev~~Va~~L~   49 (96)
T PF11829_consen   34 RRLTDDEVAEVAAELA   49 (96)
T ss_dssp             TTS-HHHHHHHHHHHH
T ss_pred             ccCCHHHHHHHHHHHH
Confidence            3479999999998874


No 119
>KOG1200|consensus
Probab=31.69  E-value=59  Score=21.78  Aligned_cols=20  Identities=15%  Similarity=0.386  Sum_probs=15.2

Q ss_pred             CCCCCCCHHHHHHHHHHHhh
Q psy14949         81 VFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~s  100 (102)
                      |...+-..||+.+++.||.+
T Consensus       218 Pmgr~G~~EevA~~V~fLAS  237 (256)
T KOG1200|consen  218 PMGRLGEAEEVANLVLFLAS  237 (256)
T ss_pred             CccccCCHHHHHHHHHHHhc
Confidence            33344468999999999986


No 120
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=31.61  E-value=13  Score=20.50  Aligned_cols=13  Identities=31%  Similarity=0.618  Sum_probs=10.6

Q ss_pred             CCHHHHHHHHHHH
Q psy14949         86 RKEKDREDLIAYL   98 (102)
Q Consensus        86 ls~~e~~~l~~yl   98 (102)
                      ||++|+++|+.|=
T Consensus        32 Lt~eEr~dmI~~~   44 (76)
T PF10955_consen   32 LTPEERQDMISYD   44 (76)
T ss_pred             CCHHHHhhheEEc
Confidence            5899999998763


No 121
>TIGR03152 cyto_c552_HCOOH formate-dependent cytochrome c nitrite reductase, c552 subunit. Members of this protein family are cytochrome c552, a component of cytochrome c nitrite reductase, which is known more formally as nitrite reductase (cytochrome; ammonia-forming) (EC 1.7.2.2). Nitrate can be reduced by several enzymes. EC 1.7.2.2 reduces nitrite all the way to ammonia, rather than to ammonium hydroxide (nitrite reductase (NAD(P)H), EC 1.7.1.4) or nitric oxide (nitrite reductase (NO-forming), EC 1.7.2.1). Some examples of EC 1.7.2.2 occur in a seven gene system that enables formate-dependent nitrite reduction, but is also found in simpler contexts. Members of this protein family, however, belong to the formate-dependent system.
Probab=31.51  E-value=18  Score=26.65  Aligned_cols=11  Identities=55%  Similarity=1.262  Sum_probs=8.2

Q ss_pred             HHHhcccccCC
Q psy14949         10 FTRACAQCHTA   20 (102)
Q Consensus        10 f~~~C~~CH~~   20 (102)
                      +...|.+||+.
T Consensus       273 ~~~aC~~CH~~  283 (439)
T TIGR03152       273 FDDTCANCHTQ  283 (439)
T ss_pred             HHHHHHhCCCC
Confidence            44579999974


No 122
>PF06883 RNA_pol_Rpa2_4:  RNA polymerase I, Rpa2 specific domain ;  InterPro: IPR009674 This domain is found between domain 3 and domain 5, but shows no homology to domain 4 of Rpb2. The external domains in multisubunit RNA polymerase (those most distant from the active site) are known to demonstrate more sequence variability [].; GO: 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0005634 nucleus
Probab=30.28  E-value=46  Score=17.23  Aligned_cols=17  Identities=18%  Similarity=0.235  Sum_probs=13.2

Q ss_pred             CCHHHHHHHHHHHhhcC
Q psy14949         86 RKEKDREDLIAYLSTLH  102 (102)
Q Consensus        86 ls~~e~~~l~~yl~sl~  102 (102)
                      .++++...+++.|+.+|
T Consensus         4 ~~~~~a~~~~~~LR~~K   20 (58)
T PF06883_consen    4 VSPEEAEQIADQLRYLK   20 (58)
T ss_pred             ecHHHHHHHHHHHHHHH
Confidence            46788889999888654


No 123
>cd07923 Gallate_dioxygenase_C The C-terminal domain of Gallate Dioxygenase, which catalyzes the oxidization and subsequent ring-opening of gallate. Gallate Dioxygenase catalyzes the oxidization and subsequent ring-opening of gallate, an intermediate in the degradation of the aromatic compound, syringate. The reaction product of gallate dioxygenase is 4-oxalomesaconate. The amino acid sequence of the N-terminal and C-terminal regions of gallate dioxygenase exhibits homology with the sequence of the PCA 4,5-dioxygenase B (catalytic) and A subunits, respectively. This model represents the C-terminal domain, which is similar to the A subunit of PCA 4,5-dioxygenase (or LigAB). The enzyme is estimated to be a homodimer according to the Escherichia coli enzyme. Since enzymes in this subfamily have fused A and B subunits, the dimer interface may resemble the tetramer interface of classical LigAB enzymes. This enzyme belongs to the class III extradiol dioxygenase family, composed of enzymes whi
Probab=30.23  E-value=26  Score=20.13  Aligned_cols=31  Identities=16%  Similarity=0.326  Sum_probs=20.9

Q ss_pred             cHHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHHH
Q psy14949         60 SASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLIA   96 (102)
Q Consensus        60 ~~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~~   96 (102)
                      ..+...+|+.+|.+++.     -.+ ||+||+.+|.+
T Consensus        17 ~a~~RerF~~D~ea~~~-----e~g-Lt~Ee~~av~~   47 (94)
T cd07923          17 EPAHRERFLEDPEALFD-----EAG-LTEEERTLIRN   47 (94)
T ss_pred             CHHHHHHHHhCHHHHHH-----HcC-CCHHHHHHHHc
Confidence            45677788888776543     123 48999988864


No 124
>PRK10617 cytochrome c-type protein NapC; Provisional
Probab=30.09  E-value=20  Score=23.50  Aligned_cols=10  Identities=30%  Similarity=1.032  Sum_probs=7.7

Q ss_pred             HhcccccCCC
Q psy14949         12 RACAQCHTAN   21 (102)
Q Consensus        12 ~~C~~CH~~~   21 (102)
                      +.|.+||+.+
T Consensus       145 ~~Cr~CH~~~  154 (200)
T PRK10617        145 QECRNCHNFD  154 (200)
T ss_pred             ccchhhcCcc
Confidence            4699999843


No 125
>CHL00136 rpl31 ribosomal protein L31; Validated
Probab=29.79  E-value=21  Score=19.24  Aligned_cols=8  Identities=13%  Similarity=0.098  Sum_probs=6.3

Q ss_pred             HhcccccC
Q psy14949         12 RACAQCHT   19 (102)
Q Consensus        12 ~~C~~CH~   19 (102)
                      ..|+.||-
T Consensus        36 dv~s~~HP   43 (68)
T CHL00136         36 DIWSGNHP   43 (68)
T ss_pred             EeCCCCCc
Confidence            35999994


No 126
>TIGR03631 bact_S13 30S ribosomal protein S13. This model describes bacterial ribosomal protein S13, to the exclusion of the homologous archaeal S13P and eukaryotic ribosomal protein S18. This model identifies some (but not all) instances of chloroplast and mitochondrial S13, which is of bacterial type.
Probab=29.73  E-value=61  Score=19.15  Aligned_cols=17  Identities=6%  Similarity=0.003  Sum_probs=14.1

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      +.|+++|+..|..+|.+
T Consensus        44 ~~L~~~qi~~l~~~l~~   60 (113)
T TIGR03631        44 KDLTEEELNAIREEIEA   60 (113)
T ss_pred             ccCCHHHHHHHHHHHHh
Confidence            45699999999999953


No 127
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=29.37  E-value=55  Score=20.34  Aligned_cols=36  Identities=28%  Similarity=0.366  Sum_probs=22.2

Q ss_pred             cHHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHHHHHhh
Q psy14949         60 SASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        60 ~~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~~yl~s  100 (102)
                      +...|..++...+...     .-.+-||.+|+..|.+||+.
T Consensus        12 ~~~~L~~~le~a~e~~-----~~~~elT~eEl~lv~~ylkR   47 (146)
T PF07295_consen   12 SEEELQEALEKAKEYL-----VAAGELTREELALVSAYLKR   47 (146)
T ss_pred             CHHHHHHHHHHHHHHH-----HHHhhcCHHHHHHHHHHHHH
Confidence            3455666665433221     11234589999999999975


No 128
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=28.97  E-value=20  Score=24.19  Aligned_cols=8  Identities=38%  Similarity=1.149  Sum_probs=6.4

Q ss_pred             hcccccCC
Q psy14949         13 ACAQCHTA   20 (102)
Q Consensus        13 ~C~~CH~~   20 (102)
                      .|++||-.
T Consensus       199 ~C~GC~m~  206 (239)
T COG1579         199 VCGGCHMK  206 (239)
T ss_pred             cccCCeee
Confidence            49999953


No 129
>COG0099 RpsM Ribosomal protein S13 [Translation, ribosomal structure and biogenesis]
Probab=28.90  E-value=63  Score=19.49  Aligned_cols=17  Identities=24%  Similarity=0.251  Sum_probs=14.1

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      +-||++|+..|..++.+
T Consensus        46 ~eLteeei~~ir~~i~~   62 (121)
T COG0099          46 GELTEEEIERLRDAIQN   62 (121)
T ss_pred             ccCCHHHHHHHHHHHHh
Confidence            34699999999999874


No 130
>TIGR03146 cyt_nit_nrfB cytochrome c nitrite reductase, pentaheme subunit. Members of this protein family contain five copies of the CXXCH heme-binding motif, and are the NrfB component of the multisubunit enzyme, cytochrome c nitrite reductase.
Probab=28.84  E-value=19  Score=22.07  Aligned_cols=8  Identities=38%  Similarity=1.207  Sum_probs=6.9

Q ss_pred             hcccccCC
Q psy14949         13 ACAQCHTA   20 (102)
Q Consensus        13 ~C~~CH~~   20 (102)
                      .|+.||+.
T Consensus        42 ~C~~CH~~   49 (145)
T TIGR03146        42 TCVNCHGN   49 (145)
T ss_pred             chhhcCCc
Confidence            69999984


No 131
>CHL00137 rps13 ribosomal protein S13; Validated
Probab=28.84  E-value=65  Score=19.36  Aligned_cols=17  Identities=6%  Similarity=-0.019  Sum_probs=14.1

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      +.|+++|+..|..+|..
T Consensus        46 ~~Lt~~qi~~l~~~i~~   62 (122)
T CHL00137         46 KDLTDEQISALREIIEE   62 (122)
T ss_pred             ccCCHHHHHHHHHHHHH
Confidence            34699999999999963


No 132
>PRK00019 rpmE 50S ribosomal protein L31; Reviewed
Probab=28.55  E-value=22  Score=19.34  Aligned_cols=8  Identities=38%  Similarity=1.310  Sum_probs=6.3

Q ss_pred             HhcccccC
Q psy14949         12 RACAQCHT   19 (102)
Q Consensus        12 ~~C~~CH~   19 (102)
                      ..|+.||-
T Consensus        36 di~s~~HP   43 (72)
T PRK00019         36 DVCSKCHP   43 (72)
T ss_pred             EeCCCCCC
Confidence            45999994


No 133
>PF14098 SSPI:  Small, acid-soluble spore protein I
Probab=28.29  E-value=68  Score=17.14  Aligned_cols=41  Identities=20%  Similarity=0.328  Sum_probs=24.2

Q ss_pred             cHHHHHHHHhCCC-----CCCCC--Ccc-CCCCCCCHHHHHHHHHHHhh
Q psy14949         60 SASTLDIYLQNPK-----KYIPG--TKM-VFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        60 ~~~~l~~~~~~~~-----~~~~~--~~m-~~~~~ls~~e~~~l~~yl~s  100 (102)
                      +.+.+..+|.+..     ...||  ..+ -++.-++++|...++.+|..
T Consensus        15 s~~el~~~I~daI~sgEE~~LPGLGVlFE~~W~~~~~~ek~~m~~~l~~   63 (65)
T PF14098_consen   15 SKEELKDTIEDAIQSGEEKALPGLGVLFEVIWKNSDESEKQEMVNTLEQ   63 (65)
T ss_pred             CHHHHHHHHHHHHhccchhcCCchHHHHHHHHHhCCHHHHHHHHHHHHh
Confidence            4566666665433     23444  122 12334489999999999875


No 134
>PF07757 AdoMet_MTase:  Predicted AdoMet-dependent methyltransferase;  InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [].; GO: 0008168 methyltransferase activity
Probab=28.21  E-value=36  Score=20.24  Aligned_cols=13  Identities=38%  Similarity=0.537  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHhhcC
Q psy14949         89 KDREDLIAYLSTLH  102 (102)
Q Consensus        89 ~e~~~l~~yl~sl~  102 (102)
                      ||+ +|++||-.||
T Consensus        38 EDl-aIAAyLi~LW   50 (112)
T PF07757_consen   38 EDL-AIAAYLIELW   50 (112)
T ss_pred             HHH-HHHHHHHHHH
Confidence            565 8999998764


No 135
>PF05927 Penaeidin:  Penaeidin;  InterPro: IPR009226 This family consists of several isoforms of the penaeidin protein, which is specific to shrimps. Penaeidins, a unique family of antimicrobial peptides (AMPs) with both proline and cysteine-rich domains, were initially identified in the hemolymph of the Pacific white shrimp, Penaeus vannamei [].; GO: 0008061 chitin binding, 0005737 cytoplasm; PDB: 1UEO_A 1XV3_A.
Probab=27.90  E-value=27  Score=18.82  Aligned_cols=10  Identities=20%  Similarity=0.660  Sum_probs=7.2

Q ss_pred             HhcccccCCC
Q psy14949         12 RACAQCHTAN   21 (102)
Q Consensus        12 ~~C~~CH~~~   21 (102)
                      ..|.+||++.
T Consensus        44 ~~C~sC~~i~   53 (73)
T PF05927_consen   44 PVCNSCYRIS   53 (73)
T ss_dssp             SSTTTTTTS-
T ss_pred             cccccccccC
Confidence            3599999764


No 136
>PF11293 DUF3094:  Protein of unknown function (DUF3094);  InterPro: IPR021444  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=27.64  E-value=77  Score=16.30  Aligned_cols=16  Identities=19%  Similarity=0.320  Sum_probs=13.5

Q ss_pred             CCCHHHHHHHHHHHhh
Q psy14949         85 LRKEKDREDLIAYLST  100 (102)
Q Consensus        85 ~ls~~e~~~l~~yl~s  100 (102)
                      .|++||-+.|-+||.+
T Consensus         3 rL~pEDQ~~Vd~yL~a   18 (55)
T PF11293_consen    3 RLNPEDQQRVDEYLQA   18 (55)
T ss_pred             CCCHHHHHHHHHHHhC
Confidence            4689999999999976


No 137
>cd04860 AE_Prim_S AE_Prim_S: primase domain similar to that found in the small subunit of archaeal and eukaryotic (A/E) DNA primases. Primases are DNA-dependent RNA polymerases which synthesis the short RNA primers required for DNA replication. In addition to its catalytic role in replication, DNA primase may play a role in coupling replication to DNA damage repair and in checkpoint control during S phase. In eukaryotes, this small catalytically active primase subunit (p50) and a larger primase subunit (p60), referred to jointly as the core primase, associate with the B subunit and the DNA polymerase alpha subunit in a complex, called Pol alpha-pri. The function of the larger primase subunit is unclear. Included in this group are Pfu41 and Pfu46, these two proteins comprise the primase complex of the archaea Pyrococcus furiosus; Pfu41 and Pfu46 have sequence identity to the eukaryotic p50 and p60 primase proteins respectively. Pfu41 preferentially uses dNTPs as substrate. Pfu46 regulat
Probab=27.33  E-value=59  Score=21.76  Aligned_cols=16  Identities=19%  Similarity=0.513  Sum_probs=13.9

Q ss_pred             CCCHHHHHHHHHHHhh
Q psy14949         85 LRKEKDREDLIAYLST  100 (102)
Q Consensus        85 ~ls~~e~~~l~~yl~s  100 (102)
                      .|+.+++.+|+.||.-
T Consensus       150 ~L~~~~R~~Iv~Yl~~  165 (232)
T cd04860         150 KLDSDERREIVDYLNG  165 (232)
T ss_pred             hCCHHHHHHHHHHHHH
Confidence            4589999999999974


No 138
>TIGR03823 FliZ flagellar regulatory protein FliZ. FliZ is involved in the regulation of flagellar assembly and possibly also the down-regulation of the motile phenotype. FliZ interacts with the flagellar translational activator FlhCD complex.
Probab=26.96  E-value=19  Score=22.72  Aligned_cols=9  Identities=33%  Similarity=1.080  Sum_probs=7.2

Q ss_pred             HhcccccCC
Q psy14949         12 RACAQCHTA   20 (102)
Q Consensus        12 ~~C~~CH~~   20 (102)
                      .+|+.||..
T Consensus        23 thCshC~K~   31 (168)
T TIGR03823        23 THCSHCHKL   31 (168)
T ss_pred             chhhhhcch
Confidence            379999964


No 139
>PF09695 YtfJ_HI0045:  Bacterial protein of unknown function (YtfJ_HI0045);  InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ. 
Probab=26.93  E-value=74  Score=20.18  Aligned_cols=17  Identities=24%  Similarity=0.356  Sum_probs=14.5

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      +.||++|+..+++-|+.
T Consensus       143 G~Ls~~Ev~qVi~Ll~~  159 (160)
T PF09695_consen  143 GALSPAEVQQVIALLKK  159 (160)
T ss_pred             CCCCHHHHHHHHHHHhc
Confidence            56799999999998864


No 140
>PF13099 DUF3944:  Domain of unknown function (DUF3944)
Probab=26.67  E-value=81  Score=14.66  Aligned_cols=14  Identities=29%  Similarity=0.375  Sum_probs=11.2

Q ss_pred             CCCHHHHHHHHHHH
Q psy14949         85 LRKEKDREDLIAYL   98 (102)
Q Consensus        85 ~ls~~e~~~l~~yl   98 (102)
                      ..|.+|+..|+..|
T Consensus        12 ~cs~edL~~L~~~L   25 (35)
T PF13099_consen   12 ECSNEDLKDLVDIL   25 (35)
T ss_pred             HCCHHHHHHHHHHH
Confidence            35789999998876


No 141
>PRK05179 rpsM 30S ribosomal protein S13; Validated
Probab=26.53  E-value=75  Score=19.07  Aligned_cols=17  Identities=0%  Similarity=0.032  Sum_probs=14.2

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      +.|+++|+..|..+|..
T Consensus        46 ~~L~~~qi~~l~~~i~~   62 (122)
T PRK05179         46 KDLTDEELDKIREEIDK   62 (122)
T ss_pred             ccCCHHHHHHHHHHHHh
Confidence            35699999999999964


No 142
>PF12123 Amidase02_C:  N-acetylmuramoyl-l-alanine amidase;  InterPro: IPR021976  This domain is found in bacteria and viruses. This domain is about 50 amino acids in length. This domain is classified with the enzyme classification code 3.5.1.28 from EC. This domain is the C-terminal of the enzyme which hydrolyses the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides. ; PDB: 2L48_B.
Probab=26.51  E-value=81  Score=15.51  Aligned_cols=17  Identities=12%  Similarity=0.276  Sum_probs=11.6

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      +-+|+.|++++-+||..
T Consensus        22 ~~~s~~~L~k~~~wld~   38 (45)
T PF12123_consen   22 DPLSDAELDKFTAWLDE   38 (45)
T ss_dssp             ----HHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHh
Confidence            34589999999999865


No 143
>PRK11659 cytochrome c nitrite reductase pentaheme subunit; Provisional
Probab=26.45  E-value=22  Score=22.82  Aligned_cols=9  Identities=33%  Similarity=0.988  Sum_probs=7.2

Q ss_pred             hcccccCCC
Q psy14949         13 ACAQCHTAN   21 (102)
Q Consensus        13 ~C~~CH~~~   21 (102)
                      .|..||+.-
T Consensus        74 ~C~~CH~~~   82 (183)
T PRK11659         74 TCTNCHGNI   82 (183)
T ss_pred             chhhhCccc
Confidence            599999843


No 144
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain. This domain is related to domains found in FCP1-like phosphatases (TIGR02250), and together both are detected by the Pfam model pfam03031.
Probab=26.34  E-value=80  Score=19.54  Aligned_cols=22  Identities=23%  Similarity=0.382  Sum_probs=18.1

Q ss_pred             CCCCCCCHHHHHHHHHHHhhcC
Q psy14949         81 VFPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      +|.+-.+|.++..|+.||.+|.
T Consensus       137 ~f~~~~~D~~L~~l~~~L~~l~  158 (162)
T TIGR02251       137 SWFGDPNDTELLNLIPFLEGLR  158 (162)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHh
Confidence            5666668999999999998863


No 145
>PRK02955 small acid-soluble spore protein SspI; Provisional
Probab=26.06  E-value=68  Score=17.29  Aligned_cols=41  Identities=20%  Similarity=0.340  Sum_probs=24.6

Q ss_pred             cHHHHHHHHhCCC-----CCCCC--Ccc-CCCCCCCHHHHHHHHHHHhh
Q psy14949         60 SASTLDIYLQNPK-----KYIPG--TKM-VFPGLRKEKDREDLIAYLST  100 (102)
Q Consensus        60 ~~~~l~~~~~~~~-----~~~~~--~~m-~~~~~ls~~e~~~l~~yl~s  100 (102)
                      +.+.+..+|.+..     ...||  ..+ .++.-++++|...++..|..
T Consensus        17 s~eel~~~I~daIqsgEEk~LPGLGVlFE~~W~~~~~~ek~~m~~~l~~   65 (68)
T PRK02955         17 SKEELEGTIVDAIQSGEEKMLPGLGVLFEVIWKNADENEKDEMLETLEQ   65 (68)
T ss_pred             CHHHHHHHHHHHHhccchhcCCcchhHHHHHHHhcCHHHHHHHHHHHHH
Confidence            4566666665433     23444  222 23444589999999998865


No 146
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only]
Probab=25.78  E-value=19  Score=24.15  Aligned_cols=7  Identities=43%  Similarity=1.512  Sum_probs=6.1

Q ss_pred             cccccCC
Q psy14949         14 CAQCHTA   20 (102)
Q Consensus        14 C~~CH~~   20 (102)
                      |..||+.
T Consensus       135 CGRCh~~  141 (255)
T COG1365         135 CGRCHSM  141 (255)
T ss_pred             cchHHHH
Confidence            9999973


No 147
>PF09601 DUF2459:  Protein of unknown function (DUF2459);  InterPro: IPR011727 This conserved hypothetical protein of unknown function is predominantly found in proteobacteria. Its function is unknown and its genome context is not well-conserved. It is found amid urease genes in at least one species.
Probab=25.76  E-value=69  Score=20.40  Aligned_cols=15  Identities=20%  Similarity=0.403  Sum_probs=13.7

Q ss_pred             CCHHHHHHHHHHHhh
Q psy14949         86 RKEKDREDLIAYLST  100 (102)
Q Consensus        86 ls~~e~~~l~~yl~s  100 (102)
                      +|+++.+.|++||++
T Consensus        98 ls~~~y~~L~~~I~~  112 (173)
T PF09601_consen   98 LSEAQYRRLVAFIRA  112 (173)
T ss_pred             cCHHHHHHHHHHHHH
Confidence            589999999999976


No 148
>PF12408 DUF3666:  Ribose-5-phosphate isomerase ;  InterPro: IPR022133  This domain family is found in bacteria, and is approximately 50 amino acids in length. The family is found in association with PF02502 from PFAM. There are two completely conserved residues (D and F) that may be functionally important. ; PDB: 3ONO_A 3C5Y_N 2PPW_A.
Probab=25.73  E-value=53  Score=16.43  Aligned_cols=12  Identities=33%  Similarity=0.692  Sum_probs=6.9

Q ss_pred             HHHHHHHHHhhc
Q psy14949         90 DREDLIAYLSTL  101 (102)
Q Consensus        90 e~~~l~~yl~sl  101 (102)
                      +-..|++|++++
T Consensus        37 qd~eI~~yvk~l   48 (48)
T PF12408_consen   37 QDEEIAAYVKEL   48 (48)
T ss_dssp             --HHHHHHHHCC
T ss_pred             CcHHHHHHHHcC
Confidence            445677887764


No 149
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=25.59  E-value=29  Score=23.53  Aligned_cols=20  Identities=30%  Similarity=0.370  Sum_probs=13.1

Q ss_pred             CCCCCCCHHHHHHHHHHHhhc
Q psy14949         81 VFPGLRKEKDREDLIAYLSTL  101 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~sl  101 (102)
                      |+.++ +..++..|...|+.+
T Consensus       199 PtsgL-D~~~~~~l~~~L~~l  218 (261)
T cd03271         199 PTTGL-HFHDVKKLLEVLQRL  218 (261)
T ss_pred             CCCCC-CHHHHHHHHHHHHHH
Confidence            34444 777888777777653


No 150
>PRK01397 50S ribosomal protein L31; Provisional
Probab=25.57  E-value=27  Score=19.33  Aligned_cols=8  Identities=13%  Similarity=-0.035  Sum_probs=6.4

Q ss_pred             HhcccccC
Q psy14949         12 RACAQCHT   19 (102)
Q Consensus        12 ~~C~~CH~   19 (102)
                      ..|+.||-
T Consensus        35 di~s~~HP   42 (78)
T PRK01397         35 DVDFRKHP   42 (78)
T ss_pred             EeCCCCCC
Confidence            45999994


No 151
>TIGR03629 arch_S13P archaeal ribosomal protein S13P. This model describes exclusively the archaeal ribosomal protein S13P. It excludes the homologous eukaryotic 40S ribosomal protein S18 and bacterial 30S ribosomal protein S13.
Probab=25.53  E-value=79  Score=19.58  Aligned_cols=17  Identities=18%  Similarity=0.292  Sum_probs=14.4

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      +.||++|+..|..+|..
T Consensus        50 ~~Lt~~qi~~l~~~i~~   66 (144)
T TIGR03629        50 GYLDDEEIEKLEEAVEN   66 (144)
T ss_pred             ccCCHHHHHHHHHHHHh
Confidence            34699999999999975


No 152
>PRK11125 nrfA cytochrome c nitrite reductase subunit c552; Provisional
Probab=25.46  E-value=27  Score=26.06  Aligned_cols=10  Identities=60%  Similarity=1.454  Sum_probs=7.8

Q ss_pred             HHHhcccccC
Q psy14949         10 FTRACAQCHT   19 (102)
Q Consensus        10 f~~~C~~CH~   19 (102)
                      +.+.|..||.
T Consensus       311 ~~~~C~~CH~  320 (480)
T PRK11125        311 FDQTCANCHT  320 (480)
T ss_pred             HHHHHHhCCC
Confidence            3457999996


No 153
>KOG1605|consensus
Probab=25.25  E-value=1.3e+02  Score=20.68  Aligned_cols=22  Identities=14%  Similarity=0.234  Sum_probs=17.1

Q ss_pred             CCCCCCCHHHHHHHHHHHhhcC
Q psy14949         81 VFPGLRKEKDREDLIAYLSTLH  102 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl~sl~  102 (102)
                      +|..-.+|.|+-.|+-||++|.
T Consensus       226 sw~~d~~D~eLL~LlpfLe~L~  247 (262)
T KOG1605|consen  226 SWFDDPTDTELLKLLPFLEALA  247 (262)
T ss_pred             ccccCCChHHHHHHHHHHHHhc
Confidence            4444457999999999999863


No 154
>PF09343 DUF2460:  Conserved hypothetical protein 2217 (DUF2460);  InterPro: IPR011740 The entry represents a number of conserved hypothetical proteins. Their genes are often, though not always, encoded in apparent phage-derived regions of bacterial chromosomes. The Rhodobacter capsulatus sequence is apparently part of the gene transfer agent [see Fig.1, in ].
Probab=25.15  E-value=84  Score=20.58  Aligned_cols=17  Identities=35%  Similarity=0.528  Sum_probs=14.5

Q ss_pred             CCCHHHHHHHHHHHhhc
Q psy14949         85 LRKEKDREDLIAYLSTL  101 (102)
Q Consensus        85 ~ls~~e~~~l~~yl~sl  101 (102)
                      +++.+|+.+|++|++..
T Consensus        50 ~~s~~~l~~l~~FF~ar   66 (198)
T PF09343_consen   50 VRSLEDLEALIAFFEAR   66 (198)
T ss_pred             CCCHHHHHHHHHHHHHh
Confidence            45899999999999864


No 155
>PRK11032 hypothetical protein; Provisional
Probab=25.11  E-value=74  Score=20.14  Aligned_cols=17  Identities=6%  Similarity=0.057  Sum_probs=14.1

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      +-||.+|+..|.+||+.
T Consensus        41 ~elT~dEl~lv~~ylkR   57 (160)
T PRK11032         41 GELTRDEVDLITRAVRR   57 (160)
T ss_pred             HhcCHHHHHHHHHHHHH
Confidence            34589999999999974


No 156
>PF09383 NIL:  NIL domain;  InterPro: IPR018449 This domain is found at the C terminus of ABC transporter proteins involved in D-methionine transport as well as a number of ferredoxin-like proteins. This domain is likely to act as a substrate binding domain. The domain has been named after a conserved sequence in some members of the family. ; PDB: 2QRR_A 3CED_A 2QSW_A 3TUZ_D 3TUJ_D 3DHX_B 3TUI_H 3DHW_D.
Probab=25.00  E-value=81  Score=16.67  Aligned_cols=15  Identities=33%  Similarity=0.532  Sum_probs=12.3

Q ss_pred             CHHHHHHHHHHHhhc
Q psy14949         87 KEKDREDLIAYLSTL  101 (102)
Q Consensus        87 s~~e~~~l~~yl~sl  101 (102)
                      +++++.+.++||++.
T Consensus        55 ~~~~~~~a~~~L~~~   69 (76)
T PF09383_consen   55 DDEEIEKAIAYLREQ   69 (76)
T ss_dssp             -HHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHHC
Confidence            578899999999874


No 157
>PRK11582 flagella biosynthesis protein FliZ; Provisional
Probab=24.62  E-value=22  Score=22.48  Aligned_cols=9  Identities=33%  Similarity=0.929  Sum_probs=7.1

Q ss_pred             HhcccccCC
Q psy14949         12 RACAQCHTA   20 (102)
Q Consensus        12 ~~C~~CH~~   20 (102)
                      .+|+.||..
T Consensus        23 thCshC~K~   31 (169)
T PRK11582         23 THCAHCRKL   31 (169)
T ss_pred             cchhhhccc
Confidence            379999964


No 158
>PF13709 DUF4159:  Domain of unknown function (DUF4159)
Probab=24.57  E-value=73  Score=20.82  Aligned_cols=16  Identities=19%  Similarity=0.324  Sum_probs=13.9

Q ss_pred             CCCHHHHHHHHHHHhh
Q psy14949         85 LRKEKDREDLIAYLST  100 (102)
Q Consensus        85 ~ls~~e~~~l~~yl~s  100 (102)
                      .+|++|++.|-+||+.
T Consensus        66 ~~s~~e~~~Lr~Yl~~   81 (207)
T PF13709_consen   66 PLSDEEIANLRRYLEN   81 (207)
T ss_pred             CCCHHHHHHHHHHHHc
Confidence            4689999999999974


No 159
>COG0633 Fdx Ferredoxin [Energy production and conversion]
Probab=24.25  E-value=27  Score=20.06  Aligned_cols=8  Identities=38%  Similarity=1.086  Sum_probs=6.5

Q ss_pred             hcccccCC
Q psy14949         13 ACAQCHTA   20 (102)
Q Consensus        13 ~C~~CH~~   20 (102)
                      .|+.||..
T Consensus        44 ~C~TC~v~   51 (102)
T COG0633          44 ACGTCRVK   51 (102)
T ss_pred             ccCccEEE
Confidence            59999963


No 160
>PF15332 LIME1:  Lck-interacting transmembrane adapter 1
Probab=24.04  E-value=29  Score=22.86  Aligned_cols=8  Identities=38%  Similarity=1.319  Sum_probs=6.7

Q ss_pred             cccccCCC
Q psy14949         14 CAQCHTAN   21 (102)
Q Consensus        14 C~~CH~~~   21 (102)
                      |..||..+
T Consensus         2 CtaC~R~d    9 (228)
T PF15332_consen    2 CTACHRPD    9 (228)
T ss_pred             cccccCch
Confidence            99999865


No 161
>PTZ00134 40S ribosomal protein S18; Provisional
Probab=23.60  E-value=87  Score=19.70  Aligned_cols=17  Identities=12%  Similarity=0.333  Sum_probs=14.4

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      +.||++|+..|..+|..
T Consensus        59 ~~Lt~~qi~~l~~~i~~   75 (154)
T PTZ00134         59 GELTAEEIEKIVEIIAN   75 (154)
T ss_pred             ccCCHHHHHHHHHHHhc
Confidence            45699999999999974


No 162
>TIGR00778 ahpD_dom alkylhydroperoxidase AhpD family core domain. Members of the family include the alkylhydroperoxidase AhpD of Mycobacterium tuberculosis, a macrophage infectivity potentiator peptide of Legionella pneumophila, and an uncharacterized peptide in the tetrachloroethene reductive dehalogenase operon of Dehalospirillum multivorans. We suggest that many peptides containing this domain may have alkylhydroperoxidase or related antioxidant activity.
Probab=23.52  E-value=82  Score=14.96  Aligned_cols=11  Identities=9%  Similarity=0.383  Sum_probs=9.1

Q ss_pred             CHHHHHHHHHH
Q psy14949         87 KEKDREDLIAY   97 (102)
Q Consensus        87 s~~e~~~l~~y   97 (102)
                      +++|+.+++.|
T Consensus        38 ~~~ei~~v~~~   48 (50)
T TIGR00778        38 TAEELAEALAW   48 (50)
T ss_pred             CHHHHHHHHHh
Confidence            78889888876


No 163
>PF14053 DUF4248:  Domain of unknown function (DUF4248)
Probab=23.23  E-value=79  Score=16.94  Aligned_cols=18  Identities=11%  Similarity=0.062  Sum_probs=14.6

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q psy14949         81 VFPGLRKEKDREDLIAYL   98 (102)
Q Consensus        81 ~~~~~ls~~e~~~l~~yl   98 (102)
                      +....+|+.|+.-|+.||
T Consensus        49 ~~~r~~TP~QV~lIv~~L   66 (69)
T PF14053_consen   49 PRQRSFTPRQVRLIVRYL   66 (69)
T ss_pred             CCCEecCHHHHHHHHHHc
Confidence            344567999999999997


No 164
>TIGR00105 L31 ribosomal protein L31. This family consists exclusively of bacterial (and organellar) 50S ribosomal protein L31. In some species, such as Bacillus subtilis, this protein exists in two forms (RpmE and YtiA), one of which (RpmE) contains a pair of motifs, CXC and CXXC, for binding zinc.
Probab=23.07  E-value=32  Score=18.39  Aligned_cols=8  Identities=38%  Similarity=1.273  Sum_probs=6.2

Q ss_pred             HhcccccC
Q psy14949         12 RACAQCHT   19 (102)
Q Consensus        12 ~~C~~CH~   19 (102)
                      ..|+.||-
T Consensus        36 di~s~~HP   43 (68)
T TIGR00105        36 DICSKCHP   43 (68)
T ss_pred             EECCCCcc
Confidence            35999994


No 165
>PF15161 Neuropep_like:  Neuropeptide-like
Probab=22.98  E-value=27  Score=18.18  Aligned_cols=16  Identities=31%  Similarity=0.744  Sum_probs=9.7

Q ss_pred             hHHHHHHH--hcccccCC
Q psy14949          5 NGKKIFTR--ACAQCHTA   20 (102)
Q Consensus         5 ~G~~lf~~--~C~~CH~~   20 (102)
                      .|..+-.+  -|..||..
T Consensus         5 ~gs~iPaesRPCVDCHAF   22 (65)
T PF15161_consen    5 SGSVIPAESRPCVDCHAF   22 (65)
T ss_pred             CCCcccCCCCCchhhHHH
Confidence            34444443  49999963


No 166
>PRK13696 hypothetical protein; Provisional
Probab=22.98  E-value=25  Score=18.64  Aligned_cols=19  Identities=26%  Similarity=0.300  Sum_probs=14.0

Q ss_pred             CCccCCCCCCCHHHHHHHH
Q psy14949         77 GTKMVFPGLRKEKDREDLI   95 (102)
Q Consensus        77 ~~~m~~~~~ls~~e~~~l~   95 (102)
                      ...|-+.+.++++|...+.
T Consensus        41 ~~l~~~~Gil~dee~~e~~   59 (62)
T PRK13696         41 DKLMKAFGILSEEEAEELK   59 (62)
T ss_pred             HHHHHHHCCCCHHHHHHHH
Confidence            3456677788999988775


No 167
>PF04270 Strep_his_triad:  Streptococcal histidine triad protein ;  InterPro: IPR006270 This entry represents a repeated sequence region that includes a His-X-X-His-X-His (histidine triad) motif, which is found in family of Streptococcal proteins. Members of the family are suggested to cleave human complement component 3, and family member PhpA has been shown in vaccine studies to be a protective antigen in mice []. ; PDB: 2CS7_C.
Probab=22.92  E-value=1e+02  Score=15.72  Aligned_cols=17  Identities=18%  Similarity=0.137  Sum_probs=12.4

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      ..||+.|+++--+||+.
T Consensus        36 ~dLs~~E~~aA~~~~~~   52 (53)
T PF04270_consen   36 SDLSASELKAAQAYLAG   52 (53)
T ss_dssp             GGS-HHHHHHHHHHHH-
T ss_pred             hhCCHHHHHHHHHHHhc
Confidence            34589999999999874


No 168
>PRK00528 rpmE 50S ribosomal protein L31; Reviewed
Probab=22.82  E-value=33  Score=18.55  Aligned_cols=8  Identities=13%  Similarity=0.007  Sum_probs=6.4

Q ss_pred             HhcccccC
Q psy14949         12 RACAQCHT   19 (102)
Q Consensus        12 ~~C~~CH~   19 (102)
                      ..|..||-
T Consensus        38 dv~s~~HP   45 (71)
T PRK00528         38 DIDSGNHP   45 (71)
T ss_pred             EECCCCCc
Confidence            45999994


No 169
>PF13447 Multi-haem_cyto:  Seven times multi-haem cytochrome CxxCH; PDB: 1FGJ_B.
Probab=22.76  E-value=46  Score=22.81  Aligned_cols=12  Identities=33%  Similarity=1.032  Sum_probs=8.1

Q ss_pred             HHHHHhcccccC
Q psy14949          8 KIFTRACAQCHT   19 (102)
Q Consensus         8 ~lf~~~C~~CH~   19 (102)
                      .-....|..||+
T Consensus       210 ~~m~~vC~~CHS  221 (267)
T PF13447_consen  210 DKMKKVCSQCHS  221 (267)
T ss_dssp             HHHHHHHTTTS-
T ss_pred             HHHHHhhhccCC
Confidence            344557999996


No 170
>PF01197 Ribosomal_L31:  Ribosomal protein L31;  InterPro: IPR002150 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L31 is one of the proteins from the large ribosomal subunit. L31 is a protein of 66 to 97 amino-acid residues which has only been found so far in bacteria and in some plant and algal chloroplasts.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3D5D_4 3PYO_1 3D5B_4 3PYV_1 3PYT_1 3MRZ_1 3MS1_1 3PYR_1 3F1F_4 3F1H_4 ....
Probab=22.49  E-value=34  Score=18.33  Aligned_cols=9  Identities=33%  Similarity=1.017  Sum_probs=6.7

Q ss_pred             HhcccccCC
Q psy14949         12 RACAQCHTA   20 (102)
Q Consensus        12 ~~C~~CH~~   20 (102)
                      ..|+.||-.
T Consensus        37 di~s~~HPf   45 (69)
T PF01197_consen   37 DICSNCHPF   45 (69)
T ss_dssp             CSCSSSSCT
T ss_pred             eecCCCCEE
Confidence            359999943


No 171
>PRK04053 rps13p 30S ribosomal protein S13P; Reviewed
Probab=22.40  E-value=1e+02  Score=19.27  Aligned_cols=17  Identities=18%  Similarity=0.294  Sum_probs=14.1

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      +.||++|+..|..||.+
T Consensus        54 ~~Lt~~qi~~l~~~i~~   70 (149)
T PRK04053         54 GYLSDEEIEKIEEALED   70 (149)
T ss_pred             CcCCHHHHHHHHHHHHh
Confidence            35699999999999963


No 172
>PRK01678 rpmE2 50S ribosomal protein L31 type B; Reviewed
Probab=22.29  E-value=34  Score=19.37  Aligned_cols=8  Identities=13%  Similarity=0.285  Sum_probs=6.4

Q ss_pred             HhcccccC
Q psy14949         12 RACAQCHT   19 (102)
Q Consensus        12 ~~C~~CH~   19 (102)
                      ..|+.||-
T Consensus        49 di~S~~HP   56 (87)
T PRK01678         49 EISSASHP   56 (87)
T ss_pred             EeCCCCCC
Confidence            46999994


No 173
>PF11116 DUF2624:  Protein of unknown function (DUF2624);  InterPro: IPR020277 This entry contains proteins with no known function.
Probab=22.22  E-value=1.3e+02  Score=16.92  Aligned_cols=15  Identities=20%  Similarity=0.237  Sum_probs=11.9

Q ss_pred             CCHHHHHHHHHHHhh
Q psy14949         86 RKEKDREDLIAYLST  100 (102)
Q Consensus        86 ls~~e~~~l~~yl~s  100 (102)
                      +|+++.+.|+.+|+.
T Consensus        31 it~~QA~~I~~~lr~   45 (85)
T PF11116_consen   31 ITKKQAEQIANILRG   45 (85)
T ss_pred             CCHHHHHHHHHHHhc
Confidence            478888888888875


No 174
>PF09286 Pro-kuma_activ:  Pro-kumamolisin, activation domain ;  InterPro: IPR015366 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain is found at the N terminus of peptidases belonging to MEROPS peptidase family S53 (sedolisin, clan SB). The domain adopts a ferredoxin-like fold, with an alpha+beta sandwich. Cleavage of the domain results in activation of the peptidase []. ; GO: 0008236 serine-type peptidase activity; PDB: 1T1E_A 3EDY_A 3EE6_A.
Probab=21.83  E-value=87  Score=18.82  Aligned_cols=14  Identities=14%  Similarity=0.328  Sum_probs=11.6

Q ss_pred             CHHHHHHHHHHHhh
Q psy14949         87 KEKDREDLIAYLST  100 (102)
Q Consensus        87 s~~e~~~l~~yl~s  100 (102)
                      +++++.+|.+||++
T Consensus        60 ~~~~v~~V~~wL~~   73 (143)
T PF09286_consen   60 SPEDVAAVKSWLKS   73 (143)
T ss_dssp             -HHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHH
Confidence            58889999999986


No 175
>cd07347 harmonin_N_like N-terminal protein-binding module of harmonin and similar domains. This domain is found in harmonin, and similar proteins such as delphilin, and whirlin. These are postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold proteins. Harmonin and whirlin are organizers of the Usher protein network of the inner ear and the retina, delphilin is found at the cerebellar parallel fiber-Purkinje cell synapses. This harmonin_N_like domain is found in either one or two copies. Harmonin contains a single copy, which is found at its N-terminus and binds specifically to a short internal peptide fragment of the cadherin 23 cytoplasmic domain; cadherin 23 is a component of the Usher protein network. Whirlin contains two copies of the harmonin_N_like domain; the first of these has been assayed for interaction with the cytoplasmic domain of cadherin 23 and no interaction could be detected.
Probab=21.44  E-value=98  Score=17.11  Aligned_cols=17  Identities=24%  Similarity=0.337  Sum_probs=13.9

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy14949         84 GLRKEKDREDLIAYLST  100 (102)
Q Consensus        84 ~~ls~~e~~~l~~yl~s  100 (102)
                      .+|++.|...+..||+.
T Consensus        14 ~LL~~~Er~~~~~~L~~   30 (78)
T cd07347          14 HLLTDAEREQVTRALER   30 (78)
T ss_pred             HHCCHHHHHHHHHHHHH
Confidence            35689999999998875


No 176
>TIGR03507 decahem_SO1788 decaheme c-type cytochrome, OmcA/MtrC family. The protein SO_1778 (MtrC) of Shewanella oneidensis MR-1, and its paralog SO_1779 (OmcA), with which it intteracts, are large decaheme proteins, about 900 amino acids in length, involved in the use of manganese [Mn(III/IV)] and iron [Fe(III)] as terminal electron acceptors. This model represents these and similar decaheme proteins, found also in Rhodoferax ferrireducens DSM 15236, Aeromonas hydrophila ATCC7966, and a few other bacterial species.
Probab=21.37  E-value=37  Score=26.40  Aligned_cols=10  Identities=50%  Similarity=1.135  Sum_probs=7.8

Q ss_pred             HhcccccCCC
Q psy14949         12 RACAQCHTAN   21 (102)
Q Consensus        12 ~~C~~CH~~~   21 (102)
                      ..|++||+..
T Consensus       294 ~~C~~CH~~~  303 (664)
T TIGR03507       294 TQCAACHNAG  303 (664)
T ss_pred             CchhhccCCC
Confidence            4699999754


No 177
>PF14317 YcxB:  YcxB-like protein
Probab=21.25  E-value=95  Score=15.08  Aligned_cols=15  Identities=20%  Similarity=0.468  Sum_probs=11.9

Q ss_pred             CCCHHHHHHHHHHHh
Q psy14949         85 LRKEKDREDLIAYLS   99 (102)
Q Consensus        85 ~ls~~e~~~l~~yl~   99 (102)
                      .++++|..++.+||+
T Consensus        48 ~f~~~e~~~f~~~lk   62 (62)
T PF14317_consen   48 AFSEEEKEEFREFLK   62 (62)
T ss_pred             HCCHhHHHHHHHHhC
Confidence            456889999998875


No 178
>PF06648 DUF1160:  Protein of unknown function (DUF1160);  InterPro: IPR010594 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf75; it is a family of uncharacterised viral proteins.
Probab=20.70  E-value=66  Score=19.42  Aligned_cols=14  Identities=21%  Similarity=0.266  Sum_probs=12.3

Q ss_pred             CCHHHHHHHHHHHh
Q psy14949         86 RKEKDREDLIAYLS   99 (102)
Q Consensus        86 ls~~e~~~l~~yl~   99 (102)
                      ++++|+..|+.||-
T Consensus        99 l~dddi~~ls~FLV  112 (122)
T PF06648_consen   99 LTDDDISYLSEFLV  112 (122)
T ss_pred             CCcccHHHHHHHHH
Confidence            58999999999984


No 179
>PF09966 DUF2200:  Uncharacterized protein conserved in bacteria (DUF2200);  InterPro: IPR014580 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.; PDB: 3C9P_A.
Probab=20.61  E-value=95  Score=18.37  Aligned_cols=13  Identities=15%  Similarity=0.555  Sum_probs=11.0

Q ss_pred             CHHHHHHHHHHHh
Q psy14949         87 KEKDREDLIAYLS   99 (102)
Q Consensus        87 s~~e~~~l~~yl~   99 (102)
                      |.+|+..|+.||-
T Consensus        24 t~~Evd~vi~WLT   36 (111)
T PF09966_consen   24 TKEEVDQVIRWLT   36 (111)
T ss_dssp             -HHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHh
Confidence            7899999999984


No 180
>PF15614 WHIM3:  WSTF, HB1, Itc1p, MBD9 motif 3
Probab=20.24  E-value=1.2e+02  Score=15.05  Aligned_cols=12  Identities=17%  Similarity=0.426  Sum_probs=10.4

Q ss_pred             CHHHHHHHHHHH
Q psy14949         87 KEKDREDLIAYL   98 (102)
Q Consensus        87 s~~e~~~l~~yl   98 (102)
                      +++|+.+|+.+|
T Consensus         6 ~~e~ld~L~~aL   17 (46)
T PF15614_consen    6 DPEELDELLKAL   17 (46)
T ss_pred             CHHHHHHHHHHH
Confidence            688999999888


No 181
>PF07746 LigA:  Aromatic-ring-opening dioxygenase LigAB, LigA subunit;  InterPro: IPR011986  Dioxygenases catalyse the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms. Cleavage of aromatic rings is one of the most important functions of dioxygenases, which play key roles in the degradation of aromatic compounds. The substrates of ring-cleavage dioxygenases can be classified into two groups according to the mode of scission of the aromatic ring. Intradiol enzymes (IPR000627 from INTERPRO) use a non-haem Fe(III) to cleave the aromatic ring between two hydroxyl groups (ortho-cleavage), whereas extradiol enzymes use a non-haem Fe(II) to cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon (meta-cleavage) [, ]. These two subfamilies differ in sequence, structural fold, iron ligands, and the orientation of second sphere active site amino acid residues. Extradiol dioxygenases are usually homo-multimeric, bind one atom of ferrous ion per subunit and have a subunit size of about 33 kDa. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes (IPR000486 from INTERPRO) show sequence similarity, with the two-domain class II enzymes having evolved from a class I enzyme through gene duplication. Class III enzymes are different in sequence and structure, but they do share several common active-site characteristics with the class II enzymes, in particular the coordination sphere and the disposition of the putative catalytic base are very similar. Class III enzymes usually have two subunits, designated A (IPR004183 from INTERPRO) and B (IPR004183 from INTERPRO). LigAB is a protocatechuate 4,5-dioxygenase (1.13.11.8 from EC) that belongs to the extradiol class III enzyme family. The LigA subunit of this enzyme is multi-helical, containing a compact array of 6 short helices [].; PDB: 1BOU_A 1B4U_A.
Probab=20.17  E-value=31  Score=19.50  Aligned_cols=31  Identities=19%  Similarity=0.500  Sum_probs=18.8

Q ss_pred             cHHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHHH
Q psy14949         60 SASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLIA   96 (102)
Q Consensus        60 ~~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~~   96 (102)
                      +.+...+|+.+|.++..    . .+ ||++|+.+|.+
T Consensus        10 ~~~~r~~F~~D~~a~~~----~-~~-Lt~eer~av~~   40 (88)
T PF07746_consen   10 DPENRERFLADPEAYLD----E-YG-LTEEERQAVLD   40 (88)
T ss_dssp             SHHHHHHHHH-HHHHHH----C-CT---HHHHHHHHC
T ss_pred             CHHHHHHHHHCHHHHHH----H-cC-CCHHHHHHHHc
Confidence            46677888888775443    1 23 48999988753


No 182
>COG5204 SPT4 Transcription elongation factor SPT4 [Transcription]
Probab=20.12  E-value=1.5e+02  Score=17.25  Aligned_cols=36  Identities=22%  Similarity=0.048  Sum_probs=19.0

Q ss_pred             cHHHHHHHHhCCCCCCCCCccCCCCCCCHHHHHHHH
Q psy14949         60 SASTLDIYLQNPKKYIPGTKMVFPGLRKEKDREDLI   95 (102)
Q Consensus        60 ~~~~l~~~~~~~~~~~~~~~m~~~~~ls~~e~~~l~   95 (102)
                      +..++.+|.+=......-..|...+.|+++=+++|-
T Consensus        62 t~SWVakWqrid~f~~GlYA~~V~G~L~edvve~L~   97 (112)
T COG5204          62 TNSWVAKWQRIDEFRKGLYAMVVEGALSEDVVEDLE   97 (112)
T ss_pred             cHHHHHHHhhhcccccceeEEEEcccCCHHHHHHHH
Confidence            456677776533222222345556777766555553


No 183
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=20.11  E-value=39  Score=16.99  Aligned_cols=7  Identities=43%  Similarity=1.383  Sum_probs=5.8

Q ss_pred             hcccccC
Q psy14949         13 ACAQCHT   19 (102)
Q Consensus        13 ~C~~CH~   19 (102)
                      .|.+||-
T Consensus        24 ~C~gC~~   30 (56)
T PF02591_consen   24 TCSGCHM   30 (56)
T ss_pred             ccCCCCE
Confidence            5999994


Done!