Query         psy14956
Match_columns 147
No_of_seqs    135 out of 200
Neff          4.2 
Searched_HMMs 46136
Date          Fri Aug 16 16:47:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14956.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14956hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2301|consensus               99.1 1.2E-10 2.6E-15  116.8   4.4   73    1-74   1473-1547(1592)
  2 PF00612 IQ:  IQ calmodulin-bin  96.2  0.0061 1.3E-07   32.9   2.8   18   55-72      2-19  (21)
  3 smart00015 IQ Short calmodulin  95.4   0.015 3.3E-07   32.6   2.3   21   53-73      2-22  (26)
  4 PF15157 IQ-like:  IQ-like       93.0   0.072 1.6E-06   39.6   2.1   18   56-73     49-66  (97)
  5 KOG0162|consensus               87.4     0.6 1.3E-05   46.0   3.5   19   54-72    696-714 (1106)
  6 KOG0377|consensus               84.3     1.1 2.4E-05   42.0   3.6   21   52-72     15-35  (631)
  7 PF08763 Ca_chan_IQ:  Voltage g  83.9     1.3 2.8E-05   27.6   2.6   19   54-72      9-27  (35)
  8 PF10613 Lig_chan-Glu_bd:  Liga  45.1      15 0.00033   25.1   1.6   13    2-14     21-33  (65)
  9 KOG4427|consensus               42.8      25 0.00053   35.3   3.2   22   51-72     27-48  (1096)
 10 PTZ00014 myosin-A; Provisional  41.2      30 0.00065   34.1   3.5   17   56-72    779-795 (821)
 11 PTZ00014 myosin-A; Provisional  40.9      32  0.0007   33.8   3.7   20   53-72    799-818 (821)
 12 PTZ00447 apical membrane antig  35.6      11 0.00024   34.7  -0.3   15  129-144   267-281 (508)
 13 PRK15321 putative type III sec  33.4 1.1E+02  0.0024   23.5   4.8   57    4-67     16-76  (120)
 14 KOG1419|consensus               31.2      29 0.00062   33.5   1.6   21   51-71    337-357 (654)
 15 PF04959 ARS2:  Arsenite-resist  23.3      12 0.00026   31.3  -2.1   14  130-143    73-86  (214)
 16 PF08110 Antimicrobial15:  Ocel  21.7      65  0.0014   17.5   1.3   14    4-17      2-15  (19)
 17 PF11807 DUF3328:  Domain of un  20.4      46 0.00099   25.2   0.7    7    2-8     165-171 (217)

No 1  
>KOG2301|consensus
Probab=99.05  E-value=1.2e-10  Score=116.76  Aligned_cols=73  Identities=30%  Similarity=0.449  Sum_probs=65.8

Q ss_pred             CchHHHHHHHHhHHhcCCC--CccchhhhhhHhhhcCCCCCCCccchhhHHHHHHHHHHHHHHHHHHHHHHhhcCC
Q psy14956          1 MFCVDILDALTKDFFARKG--NPIEETGDLVAEVNTRPDEAGYDPVSSTLWRQREEYCARLIQHAWRKHKQCRAGG   74 (147)
Q Consensus         1 IHClDIL~ALtKrVLG~~~--~~l~~~~e~~~f~~~~P~k~~yepIsTTl~rkrEe~AA~vIQRA~R~~~l~r~~~   74 (147)
                      |||.|||+||++++||.++  +.++..+++ +++.++|+++.|+||.+|+.+++++.+|.+||+|||.|++++...
T Consensus      1473 V~f~d~L~aL~~r~l~i~~~~~~~~~~q~e-~~~~~~~~~i~~~~i~~~l~~l~~~~~a~~i~~~y~~~~~~~~~~ 1547 (1592)
T KOG2301|consen 1473 VHCLDILFALTKRVLGIKKELDKVRELQEE-EFLASIPSKISYEPITTTLKRLQEPLSATIIQRAYRGYLLRDSDK 1547 (1592)
T ss_pred             eehhhHHHHHHHHhhcccccccHHHHHHHH-HHHhhcchhhccchHHHHHHhhccchhhHHHHHHHHHHHHHHHHh
Confidence            7999999999999999877  445666677 899999999999999999999999999999999999999877643


No 2  
>PF00612 IQ:  IQ calmodulin-binding motif;  InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K. The IQ motif, which can be present in one or more copies, serves as a binding site for different EF-hand proteins including the essential and regulatory myosin light chains, calmodulin (CaM), and CaM-like proteins [, ].Many IQ motifs are protein kinase C (PKC) phosphorylation sites [, ]. Resolution of the 3D structure of scallop myosin has shown that the IQ motif forms a basic amphipathic helix []. Some proteins known to contain an IQ motif are listed below:  A number of conventional and unconventional myosins. Neuromodulin (GAP-43). This protein is associated with nerve growth. It is a major component of the motile "growth cones" that form the tips of elongating axons. Neurogranin (NG/p17). Acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Sperm surface protein Sp17. Ras GTPase-activating-like protein IQGAP1. IQGAP1 contains 4 IQ motifs.   This entry covers the entire IQ motif.; GO: 0005515 protein binding; PDB: 2DFS_A 2IX7_C 1OE9_A 1W7J_A 1W7I_A 1KQM_A 1KK7_A 1WDC_A 1DFL_A 1B7T_A ....
Probab=96.21  E-value=0.0061  Score=32.87  Aligned_cols=18  Identities=28%  Similarity=0.348  Sum_probs=15.9

Q ss_pred             HHHHHHHHHHHHHHHhhc
Q psy14956         55 YCARLIQHAWRKHKQCRA   72 (147)
Q Consensus        55 ~AA~vIQRA~R~~~l~r~   72 (147)
                      .||.+||+.||.|+.++.
T Consensus         2 ~aai~iQ~~~R~~~~Rk~   19 (21)
T PF00612_consen    2 KAAIIIQSYWRGYLARKR   19 (21)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHh
Confidence            589999999999998764


No 3  
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues. Calmodulin-binding motif.
Probab=95.40  E-value=0.015  Score=32.64  Aligned_cols=21  Identities=29%  Similarity=0.257  Sum_probs=18.1

Q ss_pred             HHHHHHHHHHHHHHHHHhhcC
Q psy14956         53 EEYCARLIQHAWRKHKQCRAG   73 (147)
Q Consensus        53 Ee~AA~vIQRA~R~~~l~r~~   73 (147)
                      ++.||.+||..||.|+.++..
T Consensus         2 ~~~aa~~IQa~~Rg~~~r~~y   22 (26)
T smart00015        2 LTRAAIIIQAAWRGYLARKRY   22 (26)
T ss_pred             HHHHHHHHHHHHHHHHHHHhh
Confidence            567999999999999988753


No 4  
>PF15157 IQ-like:  IQ-like
Probab=93.00  E-value=0.072  Score=39.55  Aligned_cols=18  Identities=33%  Similarity=0.527  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHhhcC
Q psy14956         56 CARLIQHAWRKHKQCRAG   73 (147)
Q Consensus        56 AA~vIQRA~R~~~l~r~~   73 (147)
                      -++|||||||.|+.+...
T Consensus        49 kvkiiqrawre~lq~qd~   66 (97)
T PF15157_consen   49 KVKIIQRAWREYLQRQDP   66 (97)
T ss_pred             HHHHHHHHHHHHHHhcCC
Confidence            367999999999987653


No 5  
>KOG0162|consensus
Probab=87.35  E-value=0.6  Score=46.02  Aligned_cols=19  Identities=42%  Similarity=0.599  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHhhc
Q psy14956         54 EYCARLIQHAWRKHKQCRA   72 (147)
Q Consensus        54 e~AA~vIQRA~R~~~l~r~   72 (147)
                      +--|++||||||+|+.||.
T Consensus       696 d~~A~~IQkAWRrfv~rrk  714 (1106)
T KOG0162|consen  696 DGMARRIQKAWRRFVARRK  714 (1106)
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            4468899999999998776


No 6  
>KOG0377|consensus
Probab=84.35  E-value=1.1  Score=41.97  Aligned_cols=21  Identities=29%  Similarity=0.224  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHHHHHHHHhhc
Q psy14956         52 REEYCARLIQHAWRKHKQCRA   72 (147)
Q Consensus        52 rEe~AA~vIQRA~R~~~l~r~   72 (147)
                      +...||.+||++||+|..|.+
T Consensus        15 raikaAilIQkWYRr~~ARle   35 (631)
T KOG0377|consen   15 RAIKAAILIQKWYRRYEARLE   35 (631)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            578899999999999986554


No 7  
>PF08763 Ca_chan_IQ:  Voltage gated calcium channel IQ domain;  InterPro: IPR014873 Ca2+ ions are unique in that they not only carry charge but they are also the most widely used of diffusible second messengers. Voltage-dependent Ca2+ channels (VDCC) are a family of molecules that allow cells to couple electrical activity to intracellular Ca2+ signalling. The opening and closing of these channels by depolarizing stimuli, such as action potentials, allows Ca2+ ions to enter neurons down a steep electrochemical gradient, producing transient intracellular Ca2+ signals. Many of the processes that occur in neurons, including transmitter release, gene transcription and metabolism are controlled by Ca2+ influx occurring simultaneously at different cellular locales. The pore is formed by the alpha-1 subunit which incorporates the conduction pore, the voltage sensor and gating apparatus, and the known sites of channel regulation by second messengers, drugs, and toxins []. The activity of this pore is modulated by 4 tightly-coupled subunits: an intracellular beta subunit; a transmembrane gamma subunit; and a disulphide-linked complex of alpha-2 and delta subunits, which are proteolytically cleaved from the same gene product. Properties of the protein including gating voltage-dependence, G protein modulation and kinase susceptibility can be influenced by these subunits. Voltage-gated calcium channels are classified as T, L, N, P, Q and R, and are distinguished by their sensitivity to pharmacological blocks, single-channel conductance kinetics, and voltage-dependence. On the basis of their voltage activation properties, the voltage-gated calcium classes can be further divided into two broad groups: the low (T-type) and high (L, N, P, Q and R-type) threshold-activated channels. The voltage-gated calcium channel alpha 1 subunit contains an IQ domain, named for its isoleucine-glutamine (IQ) motif, which interacts with hydrophobic pockets of Ca2+/calmodulin []. The interaction regulates two self-regulatory calcium dependent feedback mechanisms, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF). ; PDB: 3OXQ_F 2F3Z_B 3G43_E 2F3Y_B 2BE6_D 3DVM_B 3BXK_D 2VAY_B 3DVK_B 3BXL_B ....
Probab=83.88  E-value=1.3  Score=27.57  Aligned_cols=19  Identities=32%  Similarity=0.467  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHHHHHhhc
Q psy14956         54 EYCARLIQHAWRKHKQCRA   72 (147)
Q Consensus        54 e~AA~vIQRA~R~~~l~r~   72 (147)
                      .+||-+||..||+|+.++.
T Consensus         9 ~YAt~lI~dyfr~~K~rk~   27 (35)
T PF08763_consen    9 FYATLLIQDYFRQFKKRKE   27 (35)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            5899999999999998765


No 8  
>PF10613 Lig_chan-Glu_bd:  Ligated ion channel L-glutamate- and glycine-binding site;  InterPro: IPR019594  This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ]. It is found in association with IPR001320 from INTERPRO. ; GO: 0004970 ionotropic glutamate receptor activity, 0005234 extracellular-glutamate-gated ion channel activity, 0016020 membrane; PDB: 4E0W_A 3S9E_A 3QXM_B 2F34_A 3C34_B 3S2V_A 3GBB_B 2F36_D 4E0X_A 1TXF_A ....
Probab=45.13  E-value=15  Score=25.15  Aligned_cols=13  Identities=31%  Similarity=1.137  Sum_probs=11.0

Q ss_pred             chHHHHHHHHhHH
Q psy14956          2 FCVDILDALTKDF   14 (147)
Q Consensus         2 HClDIL~ALtKrV   14 (147)
                      +|+|+|.+|.+.+
T Consensus        21 yciDll~~la~~l   33 (65)
T PF10613_consen   21 YCIDLLEELAEEL   33 (65)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             EHHHHHHHHHHHc
Confidence            6999999997763


No 9  
>KOG4427|consensus
Probab=42.81  E-value=25  Score=35.33  Aligned_cols=22  Identities=27%  Similarity=0.252  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhc
Q psy14956         51 QREEYCARLIQHAWRKHKQCRA   72 (147)
Q Consensus        51 krEe~AA~vIQRA~R~~~l~r~   72 (147)
                      +|.|.||..||+.||.|+-|+.
T Consensus        27 rrr~~aa~~iq~~lrsyl~Rkk   48 (1096)
T KOG4427|consen   27 RRREAAALFIQRVLRSYLVRKK   48 (1096)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3456799999999999998766


No 10 
>PTZ00014 myosin-A; Provisional
Probab=41.16  E-value=30  Score=34.07  Aligned_cols=17  Identities=18%  Similarity=0.118  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHHHHhhc
Q psy14956         56 CARLIQHAWRKHKQCRA   72 (147)
Q Consensus        56 AA~vIQRA~R~~~l~r~   72 (147)
                      +|.+||++||.|+.|+.
T Consensus       779 ~~~~iq~~~r~~~~r~~  795 (821)
T PTZ00014        779 LVSVLEALILKIKKKRK  795 (821)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45556666666655543


No 11 
>PTZ00014 myosin-A; Provisional
Probab=40.87  E-value=32  Score=33.83  Aligned_cols=20  Identities=20%  Similarity=0.057  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHHHHHHHhhc
Q psy14956         53 EEYCARLIQHAWRKHKQCRA   72 (147)
Q Consensus        53 Ee~AA~vIQRA~R~~~l~r~   72 (147)
                      ...|+.+||+.||.|+.++.
T Consensus       799 ~~~~~~~iQ~~~R~~l~~~~  818 (821)
T PTZ00014        799 NIKSLVRIQAHLRRHLVIAE  818 (821)
T ss_pred             HHHHHHHHHHHHHHHHHHhc
Confidence            35689999999999998765


No 12 
>PTZ00447 apical membrane antigen 1-like protein; Provisional
Probab=35.57  E-value=11  Score=34.69  Aligned_cols=15  Identities=53%  Similarity=1.371  Sum_probs=12.2

Q ss_pred             CcchHHHHhHhhcCCc
Q psy14956        129 SMGKWAYLCLLCGKNR  144 (147)
Q Consensus       129 ~~~~~~~~~~~~~~~~  144 (147)
                      -||.| +||.||-|+.
T Consensus       267 imgew-flcflcfk~~  281 (508)
T PTZ00447        267 IMGEW-FLCFLCFKDG  281 (508)
T ss_pred             Hhhhh-hheeeeecCC
Confidence            48999 6899998764


No 13 
>PRK15321 putative type III secretion system effector protein OrgC; Provisional
Probab=33.39  E-value=1.1e+02  Score=23.51  Aligned_cols=57  Identities=21%  Similarity=0.251  Sum_probs=40.0

Q ss_pred             HHHHHHHHhHHhcCCC----CccchhhhhhHhhhcCCCCCCCccchhhHHHHHHHHHHHHHHHHHHHH
Q psy14956          4 VDILDALTKDFFARKG----NPIEETGDLVAEVNTRPDEAGYDPVSSTLWRQREEYCARLIQHAWRKH   67 (147)
Q Consensus         4 lDIL~ALtKrVLG~~~----~~l~~~~e~~~f~~~~P~k~~yepIsTTl~rkrEe~AA~vIQRA~R~~   67 (147)
                      +|+-+||..+++.-++    +++++.+-  +.|.+|.+..+-+|---|+..+-     .+||.+..+-
T Consensus        16 vdlydAF~Q~l~~LP~la~S~~~KD~I~--q~m~~F~dp~~G~pAF~s~~QQ~-----~mlq~~l~k~   76 (120)
T PRK15321         16 VDLYDAFYQRLLALPESASSETLKDSIY--QEMNAFKDPNSGDSAFVSFEQQT-----AMLQNMLAKV   76 (120)
T ss_pred             chHHHHHHHHHHhCCcccCcHHHHHHHH--HHHHHhCCCCCCCcccccHHHHH-----HHHHHHHHhc
Confidence            6999999999998665    35555544  35667777777788777776553     3678776553


No 14 
>KOG1419|consensus
Probab=31.17  E-value=29  Score=33.50  Aligned_cols=21  Identities=38%  Similarity=0.480  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHhh
Q psy14956         51 QREEYCARLIQHAWRKHKQCR   71 (147)
Q Consensus        51 krEe~AA~vIQRA~R~~~l~r   71 (147)
                      +|..-||.+||=|||-|..-.
T Consensus       337 rrr~pAA~LIQc~WR~yaa~~  357 (654)
T KOG1419|consen  337 RRRNPAASLIQCAWRYYAAEN  357 (654)
T ss_pred             hhcchHHHHHHHHHHHHhccc
Confidence            456679999999999998654


No 15 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=23.29  E-value=12  Score=31.27  Aligned_cols=14  Identities=36%  Similarity=0.646  Sum_probs=9.0

Q ss_pred             cchHHHHhHhhcCC
Q psy14956        130 MGKWAYLCLLCGKN  143 (147)
Q Consensus       130 ~~~~~~~~~~~~~~  143 (147)
                      .++|-|+|.+|||-
T Consensus        73 ~~~~K~~C~lc~Kl   86 (214)
T PF04959_consen   73 EDEDKWRCPLCGKL   86 (214)
T ss_dssp             SSSEEEEE-SSS-E
T ss_pred             HcCCEECCCCCCcc
Confidence            35667899999983


No 16 
>PF08110 Antimicrobial15:  Ocellatin family;  InterPro: IPR012518 This family consists of the ocellatin family of antimicrobial peptides. Ocellatins are produced from the electrical-stimulated skin secretions of the South American frog, Leptodactylus ocellatus (Argus frog). The family consists of three structurally related peptides, ocellatin 1, ocellatin 2 and ocellatin 3. These peptides present haemolytic activity against human erythrocytes and are also active against Escherichia coli [].; GO: 0019836 hemolysis by symbiont of host erythrocytes, 0005576 extracellular region
Probab=21.72  E-value=65  Score=17.55  Aligned_cols=14  Identities=43%  Similarity=0.710  Sum_probs=12.4

Q ss_pred             HHHHHHHHhHHhcC
Q psy14956          4 VDILDALTKDFFAR   17 (147)
Q Consensus         4 lDIL~ALtKrVLG~   17 (147)
                      +|||.--.|+++|.
T Consensus         2 lDIlK~AaK~l~~H   15 (19)
T PF08110_consen    2 LDILKGAAKDLLAH   15 (19)
T ss_pred             hHHHHhHHHHHHHH
Confidence            79999999999885


No 17 
>PF11807 DUF3328:  Domain of unknown function (DUF3328);  InterPro: IPR021765  This family of proteins are functionally uncharacterised. This family is only found in eukaryotes. 
Probab=20.37  E-value=46  Score=25.15  Aligned_cols=7  Identities=43%  Similarity=0.994  Sum_probs=5.5

Q ss_pred             chHHHHH
Q psy14956          2 FCVDILD    8 (147)
Q Consensus         2 HClDIL~    8 (147)
                      ||+|.|.
T Consensus       165 HC~d~LR  171 (217)
T PF11807_consen  165 HCLDYLR  171 (217)
T ss_pred             HHHHHHH
Confidence            8888875


Done!