BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy14970
         (137 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1FFT|A Chain A, The Structure Of Ubiquinol Oxidase From Escherichia Coli
 pdb|1FFT|F Chain F, The Structure Of Ubiquinol Oxidase From Escherichia Coli
          Length = 663

 Score = 27.3 bits (59), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 30/70 (42%), Gaps = 3/70 (4%)

Query: 33  NICSQPSGIRDLSPCKHGAPAYLSF---PHFYQGDPSYSNAVRGLSPNKSQHEFSIVLEK 89
           ++   P G R L       P + +F   PH ++ D  +    +G +  K  H   I + K
Sbjct: 528 DLTGDPWGGRTLEWATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKKPDHYEEIHMPK 587

Query: 90  NTGIPLQVNA 99
           N+G  + + A
Sbjct: 588 NSGAGIVIAA 597


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.136    0.415 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,343,298
Number of Sequences: 62578
Number of extensions: 174379
Number of successful extensions: 267
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 265
Number of HSP's gapped (non-prelim): 5
length of query: 137
length of database: 14,973,337
effective HSP length: 89
effective length of query: 48
effective length of database: 9,403,895
effective search space: 451386960
effective search space used: 451386960
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 46 (22.3 bits)