BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy14970
(137 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1FFT|A Chain A, The Structure Of Ubiquinol Oxidase From Escherichia Coli
pdb|1FFT|F Chain F, The Structure Of Ubiquinol Oxidase From Escherichia Coli
Length = 663
Score = 27.3 bits (59), Expect = 2.7, Method: Composition-based stats.
Identities = 17/70 (24%), Positives = 30/70 (42%), Gaps = 3/70 (4%)
Query: 33 NICSQPSGIRDLSPCKHGAPAYLSF---PHFYQGDPSYSNAVRGLSPNKSQHEFSIVLEK 89
++ P G R L P + +F PH ++ D + +G + K H I + K
Sbjct: 528 DLTGDPWGGRTLEWATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKKPDHYEEIHMPK 587
Query: 90 NTGIPLQVNA 99
N+G + + A
Sbjct: 588 NSGAGIVIAA 597
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.136 0.415
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,343,298
Number of Sequences: 62578
Number of extensions: 174379
Number of successful extensions: 267
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 265
Number of HSP's gapped (non-prelim): 5
length of query: 137
length of database: 14,973,337
effective HSP length: 89
effective length of query: 48
effective length of database: 9,403,895
effective search space: 451386960
effective search space used: 451386960
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 46 (22.3 bits)