Diaphorina citri psyllid: psy14970


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MVHDLSGTLFVADKSVFDNGTQCPDSSCYCPNNICSQPSGIRDLSPCKHGAPAYLSFPHFYQGDPSYSNAVRGLSPNKSQHEFSIVLEKNTGIPLQVNARLQINILLRKIKDLEGLTEGTVTLGSYRPEIGERRKTG
ccccCEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEECcccccEEEEEEEEEEEEEEEccccccccccEEEcEEEccCCccCCccc
MVHDLSGTLFVADKSVFDNGTQCPDSSCYCPNNICSQPSGIRDLSPCKHGAPAYLSFPHFYQGDPSYSNAVRGLSPNKSQHEFSIVLEKNTGIPLQVNARLQINILLRKIKDLEGLTEGTVTLGSYRPEIGE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVHDLSGTLFVADKSVFDNGTQCPDSSCYCPNNICSQPSGIRDLSPCKHGAPAYLSFPHFYQGDPSYSNAVRGLSPNKSQHEFSIVLEKNTGIPLQVNARLQINILLRKIKDLEGLTEGTVTLGSYRPEIGERRKTG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006909 [BP]phagocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0008289 [MF]lipid bindingprobableGO:0003674, GO:0005488
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0071813 [MF]lipoprotein particle bindingprobableGO:0003674, GO:0071814, GO:0005488
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0006869 [BP]lipid transportprobableGO:0051234, GO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0051179, GO:0044699
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted