Diaphorina citri psyllid: psy1498


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MSLPLDILLSNPYQVYQHKIGRSSEKPIDFIVLDTLQAGVDHKNMASTISRFACRILCNRKTLECRVFAAGFDSSSNIFLGIGRSSEKPIDFIVLDTLQAGVDHKNMASTISRSKISSFVLN
cccccEEEECccccccEEEEcccccccccEEEEcccccccccccccccHHHHEEEEEEccccccEEEEEEcccccccEEEccccccccccccEEcccccccccccccccccccccccccccc
***PLDILLSNPYQVYQHKIGRSSEKPIDFIVLDTLQAGV*****ASTISRFACRILCNRKTLECRVFAAGFDSSSNIFLGIGRSSEKPIDFIVLDTLQAGVDHKNMASTISRSKISSFVLN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLPLDILLSNPYQVYQHKIGRSSEKPIDFIVLDTLQAGVDHKNMASTISRFACRILCNRKTLECRVFAAGFDSSSNIFLGIGRSSEKPIDFIVLDTLQAGVDHKNMASTISRSKISSFVLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein pellino Scaffold protein involved in the Toll signaling pathway via its interaction with pelle/pll kinase.confidentO77237
E3 ubiquitin-protein ligase pellino homolog 1 E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation.confidentQ96FA3
E3 ubiquitin-protein ligase pellino homolog 1 E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation.confidentQ8C669

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070936 [BP]protein K48-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0043123 [BP]positive regulation of I-kappaB kinase/NF-kappaB cascadeprobableGO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043122, GO:0048522
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0002684 [BP]positive regulation of immune system processprobableGO:0048518, GO:0065007, GO:0002682, GO:0050789, GO:0008150
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0043410 [BP]positive regulation of MAPK cascadeprobableGO:0023051, GO:0010646, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0010627, GO:0050789, GO:0043408
GO:0016020 [CC]membraneprobableGO:0005575
GO:0006955 [BP]immune responseprobableGO:0002376, GO:0050896, GO:0008150
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0001934 [BP]positive regulation of protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EGA, chain A
Confidence level:very confident
Coverage over the Query: 14-102
View the alignment between query and template
View the model in PyMOL