Query         psy15007
Match_columns 68
No_of_seqs    150 out of 1034
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 18:03:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15007.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15007hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2349|consensus               99.4 4.8E-14   1E-18  106.9   0.0   53   15-68      8-60  (585)
  2 PRK09395 actP acetate permease  99.4 4.6E-13   1E-17   99.7   4.2   57    9-68     28-84  (551)
  3 PRK12488 acetate permease; Pro  99.3 1.3E-12 2.9E-17   97.4   4.6   57    9-68     26-82  (549)
  4 PRK15419 proline:sodium sympor  99.3 1.4E-12 3.1E-17   96.0   4.6   53   13-68      3-55  (502)
  5 PRK09442 panF sodium/panthothe  99.3 3.7E-12   8E-17   93.1   5.3   55   14-68      2-56  (483)
  6 TIGR02121 Na_Pro_sym sodium/pr  99.2   8E-12 1.7E-16   91.7   4.3   50   16-68      2-51  (487)
  7 TIGR02711 symport_actP cation/  99.2   2E-11 4.4E-16   91.1   5.0   56   10-68     27-82  (549)
  8 PRK10484 putative transporter;  99.2 2.2E-11 4.8E-16   90.1   4.5   52   16-68      2-53  (523)
  9 TIGR02119 panF sodium/pantothe  99.1 4.9E-11 1.1E-15   86.8   4.7   54   15-68      1-55  (471)
 10 TIGR03648 Na_symport_lg probab  99.1   4E-11 8.6E-16   89.3   1.1   46   18-68      2-47  (552)
 11 COG0591 PutP Na+/proline sympo  98.9 8.8E-10 1.9E-14   81.6   4.1   52   14-68      2-53  (493)
 12 COG4145 PanF Na+/panthothenate  98.3 2.1E-07 4.6E-12   68.9   1.4   50   19-68      5-54  (473)
 13 COG4146 Predicted symporter [G  97.2  0.0004 8.7E-09   52.2   3.7   48   20-67      5-54  (571)
 14 COG4147 DhlC Predicted symport  96.3  0.0012 2.7E-08   50.2   0.5   48   18-68      9-56  (529)
 15 KOG3761|consensus               93.5   0.037   8E-07   41.5   1.3   50   18-67      7-64  (591)
 16 PF12273 RCR:  Chitin synthesis  87.8    0.36 7.8E-06   30.1   1.6   22   17-38      4-25  (130)
 17 PF05545 FixQ:  Cbb3-type cytoc  78.3     3.4 7.4E-05   21.6   2.8   23   16-38     10-32  (49)
 18 PF15102 TMEM154:  TMEM154 prot  66.2     6.6 0.00014   25.7   2.5   15   22-36     68-82  (146)
 19 PF01102 Glycophorin_A:  Glycop  62.2      12 0.00026   23.7   3.1   21   16-36     69-89  (122)
 20 cd01324 cbb3_Oxidase_CcoQ Cyto  61.2      15 0.00032   19.5   2.9   23   16-38     11-33  (48)
 21 COG3115 ZipA Cell division pro  59.3      13 0.00028   27.2   3.2   27   12-38      3-29  (324)
 22 PRK01741 cell division protein  54.2      11 0.00025   27.6   2.2   26   13-38      3-28  (332)
 23 PF14283 DUF4366:  Domain of un  51.7     9.5  0.0002   26.2   1.4   13   30-42    175-187 (218)
 24 PF13295 DUF4077:  Domain of un  51.4     9.2  0.0002   24.9   1.3   40   14-65     20-59  (175)
 25 PF15330 SIT:  SHP2-interacting  47.2      21 0.00046   21.9   2.4   25   18-42      4-28  (107)
 26 PF14991 MLANA:  Protein melan-  46.8     6.5 0.00014   24.9   0.0   20   19-38     30-49  (118)
 27 PF03601 Cons_hypoth698:  Conse  46.3      64  0.0014   23.0   5.0   33   29-65    221-253 (305)
 28 PHA00726 hypothetical protein   45.7      32 0.00069   20.8   2.9   17   50-66     38-54  (89)
 29 PF13493 DUF4118:  Domain of un  44.7      40 0.00086   19.4   3.2   26   13-38     77-102 (105)
 30 COG2855 Predicted membrane pro  43.9      38 0.00082   24.9   3.6   35   29-66    230-264 (334)
 31 TIGR01478 STEVOR variant surfa  42.8      11 0.00025   27.2   0.7   32   11-42    256-287 (295)
 32 TIGR02205 septum_zipA cell div  42.7      23  0.0005   25.3   2.3   11   28-38     17-27  (284)
 33 PTZ00370 STEVOR; Provisional    42.5      10 0.00022   27.5   0.4   27   11-37    252-278 (296)
 34 PF08693 SKG6:  Transmembrane a  41.6      33 0.00072   17.8   2.2   10   29-38     28-37  (40)
 35 TIGR02736 cbb3_Q_epsi cytochro  41.5      31 0.00068   19.2   2.2   14   25-38     10-23  (56)
 36 PF01299 Lamp:  Lysosome-associ  39.9      56  0.0012   22.9   3.9   14   24-37    283-296 (306)
 37 PF07010 Endomucin:  Endomucin;  36.6      56  0.0012   23.2   3.3   26   14-39    191-216 (259)
 38 PF12670 DUF3792:  Protein of u  35.7      46   0.001   20.2   2.6   25   14-38     37-61  (116)
 39 PF02060 ISK_Channel:  Slow vol  35.7      22 0.00047   22.9   1.1   19   18-36     46-64  (129)
 40 PRK04561 tatA twin arginine tr  34.3      55  0.0012   19.2   2.6   19   11-29      2-20  (75)
 41 PF05393 Hum_adeno_E3A:  Human   34.1      31 0.00068   21.0   1.6   23   15-37     32-54  (94)
 42 PRK03427 cell division protein  33.8      57  0.0012   24.0   3.2   18   22-39     14-31  (333)
 43 COG3763 Uncharacterized protei  33.8      61  0.0013   18.8   2.7   20   18-37      7-26  (71)
 44 TIGR03062 pip_yhgE_Cterm YhgE/  33.7      62  0.0013   20.7   3.1   23   15-37    182-204 (208)
 45 PF11022 DUF2611:  Protein of u  33.5      26 0.00056   20.2   1.1   21   47-67      4-24  (71)
 46 PF05753 TRAP_beta:  Translocon  33.3      53  0.0012   21.8   2.8   26   11-36    144-169 (181)
 47 PRK10574 putative major pilin   33.3      79  0.0017   20.3   3.5   25    9-33      3-27  (146)
 48 PF05814 DUF843:  Baculovirus p  33.1      78  0.0017   18.9   3.2   25   12-36     22-46  (83)
 49 PRK14762 membrane protein; Pro  33.0      62  0.0013   15.3   2.5   21   14-34      2-23  (27)
 50 PRK02958 tatA twin arginine tr  32.3      62  0.0013   18.8   2.6   19   11-29      2-20  (73)
 51 PF01708 Gemini_mov:  Geminivir  30.8 1.3E+02  0.0027   18.3   3.8   18   37-54     66-83  (91)
 52 PF06667 PspB:  Phage shock pro  30.6      60  0.0013   18.8   2.4   13   22-34     11-23  (75)
 53 PF14221 DUF4330:  Domain of un  30.5      26 0.00057   22.9   0.9   23   11-33     12-34  (168)
 54 TIGR03867 MprA_tail MprA prote  30.2      35 0.00076   16.3   1.1   16   51-66      2-17  (27)
 55 COG3295 Uncharacterized protei  30.1      53  0.0011   22.8   2.4   38   16-65    166-203 (213)
 56 PF10260 SAYSvFN:  Uncharacteri  30.1      77  0.0017   18.2   2.7   26   23-48     21-47  (71)
 57 COG1826 TatA Sec-independent p  30.0      60  0.0013   19.1   2.4   18   12-29      3-20  (94)
 58 PRK14780 lipoprotein signal pe  30.0      75  0.0016   22.7   3.2   27   11-37    198-226 (263)
 59 PRK00720 tatA twin arginine tr  29.8      73  0.0016   18.7   2.6   20   11-30      2-21  (78)
 60 PF12955 DUF3844:  Domain of un  29.7 1.2E+02  0.0026   18.7   3.7   26   11-36     66-91  (103)
 61 PF11982 DUF3483:  Domain of un  29.5      87  0.0019   21.9   3.3   47   14-64     92-140 (224)
 62 PF01299 Lamp:  Lysosome-associ  29.1      80  0.0017   22.1   3.2   34   14-48    270-303 (306)
 63 PRK00220 putative glycerol-3-p  28.7      82  0.0018   21.2   3.1   35   19-56      8-42  (198)
 64 PRK01844 hypothetical protein;  28.6      83  0.0018   18.3   2.7   19   19-37      8-26  (72)
 65 TIGR00023 acyl-phosphate glyce  27.5      90   0.002   21.0   3.1   36   18-56      7-42  (196)
 66 TIGR01433 CyoA cytochrome o ub  26.7 1.1E+02  0.0023   20.9   3.4    7   50-56     71-77  (226)
 67 PF09451 ATG27:  Autophagy-rela  26.2   1E+02  0.0023   21.3   3.4   29   11-39    198-228 (268)
 68 PF07069 PRRSV_2b:  Porcine rep  26.0 1.1E+02  0.0023   17.6   2.8   21   14-34     25-45  (73)
 69 PF05454 DAG1:  Dystroglycan (D  25.9      23 0.00049   25.5   0.0   12   30-41    164-175 (290)
 70 PRK14473 F0F1 ATP synthase sub  25.3 1.2E+02  0.0025   19.2   3.2   26    9-34      2-28  (164)
 71 PF11014 DUF2852:  Protein of u  25.2      44 0.00096   21.0   1.2   10   57-66     22-31  (115)
 72 PF13268 DUF4059:  Protein of u  25.1      97  0.0021   18.0   2.5    7   40-46     35-41  (72)
 73 TIGR01167 LPXTG_anchor LPXTG-m  25.1      87  0.0019   14.5   3.2    7   30-36     23-29  (34)
 74 PRK10845 colicin V production   24.6 1.2E+02  0.0026   19.5   3.2   21   13-34      1-21  (162)
 75 MTH00260 ATP8 ATP synthase F0   24.6 1.3E+02  0.0028   16.2   3.1   26   11-36      2-30  (53)
 76 PF11346 DUF3149:  Protein of u  24.2 1.2E+02  0.0025   15.8   2.5   22   16-37     14-35  (42)
 77 PF11770 GAPT:  GRB2-binding ad  23.7      69  0.0015   21.3   2.0   22   17-38     13-34  (158)
 78 PF04971 Lysis_S:  Lysis protei  23.2 1.1E+02  0.0025   17.5   2.6   16   28-43     48-63  (68)
 79 PRK00442 tatA twin arginine tr  22.5 1.1E+02  0.0023   18.6   2.5   19   11-29      2-20  (92)
 80 PRK14794 lipoprotein signal pe  22.5 1.5E+02  0.0032   18.8   3.3   19   10-28     99-117 (136)
 81 COG4682 Predicted membrane pro  22.5      83  0.0018   20.2   2.1   36   12-51     11-46  (128)
 82 PF10095 DUF2333:  Uncharacteri  22.4      71  0.0015   23.6   2.0   24   15-38     14-37  (336)
 83 PF07019 Rab5ip:  Rab5-interact  22.2      43 0.00093   19.0   0.7   34   17-52     25-58  (81)
 84 PF10661 EssA:  WXG100 protein   22.2      83  0.0018   20.2   2.1   15   23-37    126-140 (145)
 85 PF03672 UPF0154:  Uncharacteri  22.2      64  0.0014   18.3   1.4   16   22-37      4-19  (64)
 86 MTH00158 ATP8 ATP synthase F0   22.1 1.1E+02  0.0024   14.6   3.1   19   11-29      2-20  (32)
 87 PF00003 7tm_3:  7 transmembran  22.0 1.1E+02  0.0025   19.8   2.8   29   13-41    146-174 (238)
 88 PF11137 DUF2909:  Protein of u  21.9 1.6E+02  0.0035   16.5   3.0   22   19-40      6-27  (63)
 89 PRK15066 inner membrane transp  21.6 1.4E+02   0.003   20.0   3.2   23   15-37    228-250 (257)
 90 PRK14857 tatA twin arginine tr  21.5 1.1E+02  0.0025   18.2   2.5   22    8-29      1-22  (90)
 91 PRK11677 hypothetical protein;  21.4 1.1E+02  0.0024   19.5   2.6   21   18-38      3-23  (134)
 92 PF09973 DUF2208:  Predicted me  21.2 1.3E+02  0.0028   21.0   3.0   21   18-38     26-46  (233)
 93 COG4708 Predicted membrane pro  21.0      59  0.0013   21.7   1.2   36   12-52     69-104 (169)
 94 PRK04335 cell division protein  20.9 1.1E+02  0.0023   22.4   2.6   16   23-38     14-29  (313)
 95 PRK14393 membrane protein; Pro  20.7 1.3E+02  0.0029   20.2   2.9   34   19-56      7-40  (194)
 96 PRK10927 essential cell divisi  20.7 1.1E+02  0.0023   22.6   2.6   21   18-38     36-56  (319)
 97 PF14316 DUF4381:  Domain of un  20.5      83  0.0018   19.7   1.8   15   21-35     26-40  (146)
 98 KOG2348|consensus               20.1      65  0.0014   25.5   1.5   28   40-67     38-65  (667)

No 1  
>KOG2349|consensus
Probab=99.39  E-value=4.8e-14  Score=106.87  Aligned_cols=53  Identities=36%  Similarity=0.593  Sum_probs=50.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         15 IPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        15 ~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      +.||.|+++|++++.+||+|+.++++++ +.+|||+|||+|+|||+|+|++|||
T Consensus         8 ~~d~~v~~l~~~~~~~ig~~~~~~~~~~-t~~~y~l~gr~m~~~Pv~~SL~aS~   60 (585)
T KOG2349|consen    8 AADYSVFVLYFLLVMAIGLWFGFRTKRG-TVEEYFLGGRSMVWLPVAASLFASN   60 (585)
T ss_pred             ccchhHHHHHHHHhhhheeeEEEEcCCc-cHhhhhhcCCcceEEEeehhhhhhh
Confidence            8999999999999999999999886555 9999999999999999999999996


No 2  
>PRK09395 actP acetate permease; Provisional
Probab=99.37  E-value=4.6e-13  Score=99.68  Aligned_cols=57  Identities=14%  Similarity=0.306  Sum_probs=52.2

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007          9 LDNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus         9 ~~~~~~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      |+..+++.|+.++++|+++++++|+|.+   ||+++.+|||+|||++|||++++|++||+
T Consensus        28 ~~~~~~~~~~~i~~~y~~~~l~iG~~~~---r~~~s~~df~~agr~l~~~~~~~si~At~   84 (551)
T PRK09395         28 EKQPTNWQAIIMFLIFVVFTLGITYWAA---KRTRSASDFYTAGGGITGFQNGLAIAGDY   84 (551)
T ss_pred             hhcCCcHHHHHHHHHHHHHHHHHHHHhh---cccCCHHHHhhcCCCCcHHHHHHHHHHHH
Confidence            5567889999999999999999999987   66789999999999999999999999974


No 3  
>PRK12488 acetate permease; Provisional
Probab=99.33  E-value=1.3e-12  Score=97.39  Aligned_cols=57  Identities=9%  Similarity=0.230  Sum_probs=51.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007          9 LDNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus         9 ~~~~~~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      ++..+++.|+.++++|+++++++|+|.+   ||+++.+|||+|||++|||++++|+.||+
T Consensus        26 ~~~~~~~~~i~i~~~y~~~~l~ig~~~~---r~~~s~~df~laGR~l~~~~~~~si~at~   82 (549)
T PRK12488         26 QRQPLNWTAIGMFMVFVLFTLGITRWAA---RRTRSASDFYTAGGGLTGMQNGLAIAGDM   82 (549)
T ss_pred             hhccccHHHHHHHHHHHHHHHHHHhhee---eccCChHHHeeeCCCCcHHHHHHHHHHHH
Confidence            3456788999999999999999999987   56789999999999999999999999874


No 4  
>PRK15419 proline:sodium symporter PutP; Provisional
Probab=99.33  E-value=1.4e-12  Score=95.97  Aligned_cols=53  Identities=28%  Similarity=0.451  Sum_probs=48.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         13 FTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        13 ~~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      .+..+++++++|+++++++|+|.+   ||+++.+|||+|||++|||++++|+.||+
T Consensus         3 ~~~~~~~~~~~y~~~~l~iG~~~~---r~~~s~~dy~lagr~l~~~~~~~s~~At~   55 (502)
T PRK15419          3 ISTPMLVTFCVYIFGMILIGFIAW---RSTKNFDDYILGGRSLGPFVTALSAGASD   55 (502)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHh---hcCCChhHheeeCCCccHHHHHHHHHHHH
Confidence            567889999999999999999987   56788999999999999999999999974


No 5  
>PRK09442 panF sodium/panthothenate symporter; Provisional
Probab=99.30  E-value=3.7e-12  Score=93.12  Aligned_cols=55  Identities=22%  Similarity=0.363  Sum_probs=47.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         14 TIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        14 ~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      ++.+++++++|+++++++|+|.+++.|+.++.+||++|||++|||++++|+.||+
T Consensus         2 ~~~~~~~i~~y~~~~~~ig~~~~r~~~~~~~~~dy~~agr~~~~~~~~~s~~at~   56 (483)
T PRK09442          2 NLEVILPLVIYLVLVFGISVYAYRKRQAGDFLNEYFLGNRSMGGFVLAMTLIATY   56 (483)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHhhcccCCCcccceeeeCCCccHHHHHHHHHHHH
Confidence            6778999999999999999998855444445799999999999999999999874


No 6  
>TIGR02121 Na_Pro_sym sodium/proline symporter. This family consists of the sodium/proline symporter (proline permease) from a number of Gram-negative and Gram-positive bacteria and from the archaeal genus Methanosarcina. Using the related pantothenate permease as an outgroup, candidate sequences from Bifidobacterium longum and several from archaea are found to be outside the clade defined by known proline permeases. These sequences, scoring between 570 and -40, define the range between trusted and noise cutoff scores.
Probab=99.24  E-value=8e-12  Score=91.65  Aligned_cols=50  Identities=34%  Similarity=0.500  Sum_probs=45.9

Q ss_pred             HHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         16 PDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        16 ~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      ++++++++|+++++++|+|.+   ||+++.||||+|||++|||++++|+.||+
T Consensus         2 ~~~~~~~~y~~~~l~iG~~~~---r~~~s~~df~lagr~~~~~~~~~s~~At~   51 (487)
T TIGR02121         2 EILITFGVYLIIMLLIGFYAY---KKTTNLSDYVLGGRSLGPFVTALSAGASD   51 (487)
T ss_pred             HHHHHHHHHHHHHHHHHHHHh---cccCchHHHeeeCCcccHHHHHHHHHHHH
Confidence            678899999999999999987   56778999999999999999999999873


No 7  
>TIGR02711 symport_actP cation/acetate symporter ActP. Members of this family belong to the Sodium:solute symporter family. Both members of this family and other close homologs tend to be encoded next to a member of Pfam family pfam04341, a set of uncharacterized membrane proteins. The characterized member from E. coli is encoded near and cotranscribed with the acetyl coenzyme A synthetase (acs) gene. Proximity to an acs gene was used as one criterion for determining the trusted cutoff for this model. Closely related proteins may differ in function and are excluded by the high cutoffs of this model; members of the family of phenylacetic acid transporter PhaJ can score as high as 1011 bits.
Probab=99.20  E-value=2e-11  Score=91.08  Aligned_cols=56  Identities=14%  Similarity=0.309  Sum_probs=49.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         10 DNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        10 ~~~~~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      +..+++..++++++|+++++.+|+|.+   ||+++.+|||+|||++|||++++|+.||+
T Consensus        27 ~~~~~~~~~~~~~~y~~~~l~ig~~~~---r~~~~~~dy~laGr~~~~~~~g~si~at~   82 (549)
T TIGR02711        27 RQPLNIQAIIMFLLFVGFTLYITYWAS---KKTRSRSDYYTAGGNITGFQNGLAIAGDY   82 (549)
T ss_pred             hccccHHHHHHHHHHHHHHHHHHHHhh---cccCCchhheeeCCCccHHHHHHHHHHHH
Confidence            344577888889999999999999987   66788999999999999999999999874


No 8  
>PRK10484 putative transporter; Provisional
Probab=99.18  E-value=2.2e-11  Score=90.10  Aligned_cols=52  Identities=17%  Similarity=0.251  Sum_probs=45.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         16 PDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        16 ~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      +|++++++|++++.++|++.++| +++++.||||+|||++|||++++|+.||+
T Consensus         2 ~~i~~~~~~~~~~~~ig~~~~r~-~~~~s~~dyflagR~l~~~~~~~sl~AT~   53 (523)
T PRK10484          2 LTILSFLGFTLLVAVISWWKTRK-TDTSSSDGYFLAGRSLTGPVIAGSLLLTN   53 (523)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHcc-CCCCCchhheecCCCCchHHHHHHHHHHH
Confidence            68999999999999999997732 23478999999999999999999999974


No 9  
>TIGR02119 panF sodium/pantothenate symporter. Pantothenate (vitamin B5) is a precursor of coenzyme A and is made from aspartate and 2-oxoisovalerate in most bacteria with completed genome sequences. However, some pathogens must import pantothenate. This model describes PanF, a sodium/pantothenate symporter, from a larger family of Sodium/substrate symporters (pfam00474). Several species that have this transporter appear to lack all enzymes of pantothenate biosynthesis, namely Haemophilus influenzae, Pasteurella multocida, Fusobacterium nucleatum, and Borrelia burgdorferi.
Probab=99.14  E-value=4.9e-11  Score=86.78  Aligned_cols=54  Identities=24%  Similarity=0.364  Sum_probs=45.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHhheeccCCcC-CccceeecCCCCCHHHHHhhhhhcC
Q psy15007         15 IPDYIVLLTMLVVSCAIGFFVGMCGEKQT-TSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        15 ~~D~~v~~~yl~~~~~iG~~~~~~~~~~~-s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      +.|++++++|+++++++|+|.++|.|+.+ +.|||++|||++|||++++|++||+
T Consensus         1 ~~~~~~~~~y~~~~~~ig~~~~r~~~~~~~~~~dy~~agr~l~~~~~~~s~~at~   55 (471)
T TIGR02119         1 WEVVIPLIIYLVTVFLIAIYASKRVQSTDSFLNEYFLGGRSMGGFVLAMTLVATY   55 (471)
T ss_pred             CchHHHHHHHHHHHHHHHHHHheeccCCCCCccceeEeCCcccHHHHHHHHHHHH
Confidence            46899999999999999999985433222 3579999999999999999999984


No 10 
>TIGR03648 Na_symport_lg probable sodium:solute symporter, VC_2705 subfamily. This family belongs to a larger family of transporters of the sodium:solute symporter superfamily, TC 2.A.21. Members of this strictly bacterial protein subfamily are found almost invariably immediately downstream from a member of family TIGR03647. Occasionally, the two genes are fused.
Probab=99.06  E-value=4e-11  Score=89.33  Aligned_cols=46  Identities=13%  Similarity=0.315  Sum_probs=41.3

Q ss_pred             HHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         18 YIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        18 ~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      |+++++|+++++++|+|.+     +++.+|||+|||++|||++++|++||+
T Consensus         2 ~~i~~~y~~~~l~iG~~~~-----~~s~~dy~laGr~l~~~~~~~s~~At~   47 (552)
T TIGR03648         2 YLFVGATFALYIGIGIWSR-----AGSTSEFYVAGRGVPPVANGMATAADW   47 (552)
T ss_pred             eEEehHHHHHHHHHHHhee-----cCchHHHeeeCCCCchHHHHHHHHHHH
Confidence            5688999999999999962     458999999999999999999999974


No 11 
>COG0591 PutP Na+/proline symporter [Amino acid transport and metabolism / General function prediction only]
Probab=98.94  E-value=8.8e-10  Score=81.63  Aligned_cols=52  Identities=33%  Similarity=0.526  Sum_probs=47.5

Q ss_pred             CHHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         14 TIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        14 ~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      ...|++++.+|++.++.+|+|.+   ||+++.|||++|||++++|+.++|..||+
T Consensus         2 ~~~~~ii~~iyli~~~~ig~~a~---~~~~~~~dy~~~gR~lg~~v~~ls~~as~   53 (493)
T COG0591           2 MLILLIIFLIYLILMLLIGLYAY---RKTKSLEDYFLGGRSLGPFVYALSAAASD   53 (493)
T ss_pred             cchhHHHHHHHHHHHHHHHHHHh---cccCchHHHhccCCcCChHHHHHHHHHHH
Confidence            35789999999999999999998   66679999999999999999999999874


No 12 
>COG4145 PanF Na+/panthothenate symporter [Coenzyme metabolism]
Probab=98.31  E-value=2.1e-07  Score=68.93  Aligned_cols=50  Identities=26%  Similarity=0.437  Sum_probs=44.9

Q ss_pred             HHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         19 IVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        19 ~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      +.++.|++++.++++|..+|++|.+-..|||+|+|+|+..+++++..|||
T Consensus         5 ~pli~YL~~v~~i~iy~~~k~~k~~fLneYylgnRsmgg~VlAmt~~aTY   54 (473)
T COG4145           5 LPLIGYLVVVFGIAIYAYRKRSKGSFLNEYYLGNRSMGGIVLAMTFTATY   54 (473)
T ss_pred             hhHHHHHHHHHHHHHHHHhhhccccchHHHHhccCcccceehhhHHHHHH
Confidence            56889999999999998776666777899999999999999999999986


No 13 
>COG4146 Predicted symporter [General function prediction only]
Probab=97.22  E-value=0.0004  Score=52.22  Aligned_cols=48  Identities=21%  Similarity=0.281  Sum_probs=31.5

Q ss_pred             HHHHHHHHHHHHHHhheeccCC--cCCccceeecCCCCCHHHHHhhhhhc
Q psy15007         20 VLLTMLVVSCAIGFFVGMCGEK--QTTSDDFLLGSSSMGTLPMALSLAAS   67 (68)
Q Consensus        20 v~~~yl~~~~~iG~~~~~~~~~--~~s~~dyflggr~m~~~~vglSl~AT   67 (68)
                      .++.|+.....+.+...+|.|+  -+|++.||+|||+++..++|-|++-|
T Consensus         5 ~i~sFl~~t~~Va~isW~Ktr~~Dl~ss~GYFLaGR~Lsg~VI~~SlvLT   54 (571)
T COG4146           5 TILSFLGVTLLVAIISWWKTRGTDLSSSKGYFLAGRSLSGLVIACSLVLT   54 (571)
T ss_pred             HHHHHHHHHHHHHheeeeeccCCccccccceEeccCcccchhheehhhhh
Confidence            3444444444444333333233  45789999999999999999998754


No 14 
>COG4147 DhlC Predicted symporter [General function prediction only]
Probab=96.31  E-value=0.0012  Score=50.21  Aligned_cols=48  Identities=8%  Similarity=0.332  Sum_probs=39.3

Q ss_pred             HHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         18 YIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        18 ~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      ..++++|+...+.+++|.+   +|.++..||+.|||++|...=|+.+.+.|
T Consensus         9 i~i~~l~v~~~l~i~~~~~---~R~~s~tdyYvAG~~i~~fqNGlAiagdy   56 (529)
T COG4147           9 IGIFVLFVLITLYITYWAS---KRTRSATDYYVAGGRITGFQNGLAIAGDY   56 (529)
T ss_pred             EehhHHHHHHHHhheeeee---cccccccceeecCCcccccccceehhccc
Confidence            4567788888888998887   77899999999999999988777765543


No 15 
>KOG3761|consensus
Probab=93.53  E-value=0.037  Score=41.54  Aligned_cols=50  Identities=12%  Similarity=0.335  Sum_probs=34.2

Q ss_pred             HHHHHHHHHHHHHHHHhheeccCCcCC--------ccceeecCCCCCHHHHHhhhhhc
Q psy15007         18 YIVLLTMLVVSCAIGFFVGMCGEKQTT--------SDDFLLGSSSMGTLPMALSLAAS   67 (68)
Q Consensus        18 ~~v~~~yl~~~~~iG~~~~~~~~~~~s--------~~dyflggr~m~~~~vglSl~AT   67 (68)
                      .+.+++|.++++.+|+|..||.|..++        +|+-.+|||+++-.+=++.+-||
T Consensus         7 iiaii~fyllillvgiwa~~kskns~~~e~~agaate~iil~grdig~lvg~ftmtat   64 (591)
T KOG3761|consen    7 IIAIIFFYLLILLVGIWAARKSKNSGEAEEEAGAATEAIILAGRDIGLLVGGFTMTAT   64 (591)
T ss_pred             hHHHHHHHHHHHHHHHHHhhcccCccchhhhccccchhheeccccceeeeeeEEEEEE
Confidence            344455556667899999876543332        36789999999877766666554


No 16 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=87.80  E-value=0.36  Score=30.11  Aligned_cols=22  Identities=0%  Similarity=0.070  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHHHHhheec
Q psy15007         17 DYIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        17 D~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      =++||++.++++++++.+.++|
T Consensus         4 l~~iii~~i~l~~~~~~~~~rR   25 (130)
T PF12273_consen    4 LFAIIIVAILLFLFLFYCHNRR   25 (130)
T ss_pred             eHHHHHHHHHHHHHHHHHHHHH
Confidence            3555555555555555555544


No 17 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=78.31  E-value=3.4  Score=21.65  Aligned_cols=23  Identities=13%  Similarity=-0.022  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHHHHHhheec
Q psy15007         16 PDYIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        16 ~D~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      .+.+..++++++.+++-+|..++
T Consensus        10 ~~~~~~v~~~~~F~gi~~w~~~~   32 (49)
T PF05545_consen   10 ARSIGTVLFFVFFIGIVIWAYRP   32 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcc
Confidence            45555666666666777776543


No 18 
>PF15102 TMEM154:  TMEM154 protein family
Probab=66.20  E-value=6.6  Score=25.73  Aligned_cols=15  Identities=20%  Similarity=0.162  Sum_probs=5.9

Q ss_pred             HHHHHHHHHHHHhhe
Q psy15007         22 LTMLVVSCAIGFFVG   36 (68)
Q Consensus        22 ~~yl~~~~~iG~~~~   36 (68)
                      ++.+++++++++...
T Consensus        68 LvlLLl~vV~lv~~~   82 (146)
T PF15102_consen   68 LVLLLLSVVCLVIYY   82 (146)
T ss_pred             HHHHHHHHHHheeEE
Confidence            333333334444433


No 19 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=62.15  E-value=12  Score=23.67  Aligned_cols=21  Identities=10%  Similarity=0.139  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhhe
Q psy15007         16 PDYIVLLTMLVVSCAIGFFVG   36 (68)
Q Consensus        16 ~D~~v~~~yl~~~~~iG~~~~   36 (68)
                      +-+.|++..++.+++|-++.+
T Consensus        69 Ii~gv~aGvIg~Illi~y~ir   89 (122)
T PF01102_consen   69 IIFGVMAGVIGIILLISYCIR   89 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHHHHH
Confidence            334444444333333433333


No 20 
>cd01324 cbb3_Oxidase_CcoQ Cytochrome cbb oxidase CcoQ.  Cytochrome cbb3 oxidase, the terminal oxidase in the respiratory chains of proteobacteria, is a multi-chain transmembrane protein located in the cell membrane. Like other cytochrome oxidases, it catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  Found exclusively in proteobacteria, cbb3 is believed to be a modern enzyme that has evolved independently to perform a specialized function in microaerobic energy metabolism. The cbb3 operon contains four genes (ccoNOQP or fixNOQP), with ccoN coding for subunit I.  Instead of a CuA-containing subunit II analogous to other cytochrome oxidases, cbb3 utilizes subunits ccoO and ccoP, which contain one and two hemes, respectively, to transfer electrons to the binuclear center.  ccoQ, the fourth subunit, is a single transmembrane helix protein.  It has been shown to protect the core complex from proteolytic degradation by serine proteases.  See cd00919, cd01322
Probab=61.17  E-value=15  Score=19.46  Aligned_cols=23  Identities=13%  Similarity=-0.035  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHHHhheec
Q psy15007         16 PDYIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        16 ~D~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      .|...++.++++.+++-+|..+.
T Consensus        11 a~~~~l~~~~~~Figiv~wa~~p   33 (48)
T cd01324          11 ADSWGLLYLALFFLGVVVWAFRP   33 (48)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhCC
Confidence            46666666666666666675543


No 21 
>COG3115 ZipA Cell division protein [Cell division and chromosome partitioning]
Probab=59.26  E-value=13  Score=27.21  Aligned_cols=27  Identities=11%  Similarity=0.084  Sum_probs=18.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHhheec
Q psy15007         12 HFTIPDYIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        12 ~~~~~D~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      .++.+=++|-++-++.+++-|+|.+||
T Consensus         3 dLr~ILIIvG~IAIiaLLvhGlWtsRk   29 (324)
T COG3115           3 DLRLILIIVGAIAIIALLVHGLWTSRK   29 (324)
T ss_pred             chhhHHHHHHHHHHHHHHHhhhhhcch
Confidence            455555556666777788899998754


No 22 
>PRK01741 cell division protein ZipA; Provisional
Probab=54.24  E-value=11  Score=27.62  Aligned_cols=26  Identities=19%  Similarity=0.119  Sum_probs=15.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHhheec
Q psy15007         13 FTIPDYIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        13 ~~~~D~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      ++++=++.=++-++++++-|+|..||
T Consensus         3 Ln~iliILg~lal~~Lv~hgiWsnRr   28 (332)
T PRK01741          3 LNTILIILGILALVALVAHGIWSNRR   28 (332)
T ss_pred             ceehHHHHHHHHHHHHHHhhhhhhhh
Confidence            44443333344555667899998843


No 23 
>PF14283 DUF4366:  Domain of unknown function (DUF4366)
Probab=51.72  E-value=9.5  Score=26.24  Aligned_cols=13  Identities=15%  Similarity=0.266  Sum_probs=5.5

Q ss_pred             HHHHhheeccCCc
Q psy15007         30 AIGFFVGMCGEKQ   42 (68)
Q Consensus        30 ~iG~~~~~~~~~~   42 (68)
                      +.++|+..+++|+
T Consensus       175 Ga~yYfK~~K~K~  187 (218)
T PF14283_consen  175 GAYYYFKFYKPKQ  187 (218)
T ss_pred             ceEEEEEEecccc
Confidence            3444444444443


No 24 
>PF13295 DUF4077:  Domain of unknown function (DUF4077)
Probab=51.45  E-value=9.2  Score=24.87  Aligned_cols=40  Identities=13%  Similarity=0.350  Sum_probs=31.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhh
Q psy15007         14 TIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLA   65 (68)
Q Consensus        14 ~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~   65 (68)
                      +.+-++.+..+++.++++|.|-            |..-.|.+..|+.|+|.+
T Consensus        20 hlllfiticsfflgiiaigyyg------------yifteraiafwvcgisvv   59 (175)
T PF13295_consen   20 HLLLFITICSFFLGIIAIGYYG------------YIFTERAIAFWVCGISVV   59 (175)
T ss_pred             cEeeHHHHHHHHHHHHHHhhhh------------eeehhHHHHHHhhchhhh
Confidence            3445667788899999999883            666678999999999875


No 25 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=47.18  E-value=21  Score=21.93  Aligned_cols=25  Identities=20%  Similarity=0.224  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHhheeccCCc
Q psy15007         18 YIVLLTMLVVSCAIGFFVGMCGEKQ   42 (68)
Q Consensus        18 ~~v~~~yl~~~~~iG~~~~~~~~~~   42 (68)
                      .+++++.|+++++..+...+.+||+
T Consensus         4 l~il~llLll~l~asl~~wr~~~rq   28 (107)
T PF15330_consen    4 LGILALLLLLSLAASLLAWRMKQRQ   28 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            3456666666666555544433333


No 26 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=46.75  E-value=6.5  Score=24.93  Aligned_cols=20  Identities=20%  Similarity=0.228  Sum_probs=0.4

Q ss_pred             HHHHHHHHHHHHHHHhheec
Q psy15007         19 IVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        19 ~v~~~yl~~~~~iG~~~~~~   38 (68)
                      .++++-|.+++.+|-|+.+|
T Consensus        30 GiL~VILgiLLliGCWYckR   49 (118)
T PF14991_consen   30 GILIVILGILLLIGCWYCKR   49 (118)
T ss_dssp             S-------------------
T ss_pred             eeHHHHHHHHHHHhheeeee
Confidence            35566677778899998754


No 27 
>PF03601 Cons_hypoth698:  Conserved hypothetical protein 698;  InterPro: IPR018383 This entry represents a family of uncharacterised multi-pass membrane proteins.; GO: 0016021 integral to membrane
Probab=46.30  E-value=64  Score=23.04  Aligned_cols=33  Identities=15%  Similarity=0.152  Sum_probs=18.3

Q ss_pred             HHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhh
Q psy15007         29 CAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLA   65 (68)
Q Consensus        29 ~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~   65 (68)
                      +.++++..++.++++..+.    ....||+++++=.+
T Consensus       221 ~~l~~~~~~~~~~~~~~~~----~~~~P~FvlgFl~~  253 (305)
T PF03601_consen  221 LVLALFWARRQEKSSGKSK----KVSFPWFVLGFLAA  253 (305)
T ss_pred             HHHHHHHHhhccccccccC----ccCcCHHHHHHHHH
Confidence            3456666543333322222    45799999986443


No 28 
>PHA00726 hypothetical protein
Probab=45.75  E-value=32  Score=20.78  Aligned_cols=17  Identities=29%  Similarity=0.296  Sum_probs=13.1

Q ss_pred             ecCCCCCHHHHHhhhhh
Q psy15007         50 LGSSSMGTLPMALSLAA   66 (68)
Q Consensus        50 lggr~m~~~~vglSl~A   66 (68)
                      +-.|.++|+.++-|+.|
T Consensus        38 ~~~r~iGyYlVissv~a   54 (89)
T PHA00726         38 LNHRSIGYYLVISSVLA   54 (89)
T ss_pred             CCCcceeeeeHHHHHHH
Confidence            34589999999888765


No 29 
>PF13493 DUF4118:  Domain of unknown function (DUF4118); PDB: 2KSF_A.
Probab=44.72  E-value=40  Score=19.37  Aligned_cols=26  Identities=23%  Similarity=0.502  Sum_probs=20.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHhheec
Q psy15007         13 FTIPDYIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        13 ~~~~D~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      .++-|+.-+++|+++-+.+|....+.
T Consensus        77 ~~~~~~~~~~~~l~va~v~g~l~~~~  102 (105)
T PF13493_consen   77 YDPQDWITFAVFLVVALVTGYLADRY  102 (105)
T ss_dssp             S-HHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cChhHHHHHHHHHHHHHHHHHHHHHH
Confidence            34568999999999999999987643


No 30 
>COG2855 Predicted membrane protein [Function unknown]
Probab=43.85  E-value=38  Score=24.95  Aligned_cols=35  Identities=9%  Similarity=0.040  Sum_probs=21.2

Q ss_pred             HHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhh
Q psy15007         29 CAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAA   66 (68)
Q Consensus        29 ~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~A   66 (68)
                      +.++++.+++++..++.+.   ....+||+++++=.+|
T Consensus       230 l~ls~~~~~~~~~~~~~~~---~~~~iPwFi~gFl~~a  264 (334)
T COG2855         230 LILSLILRRQSGAGSGSKG---LKITIPWFILGFLLVA  264 (334)
T ss_pred             HHHHHHHhhccccccCCCC---CCCCCCHHHHHHHHHH
Confidence            4466776643222223333   4678999999987665


No 31 
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=42.79  E-value=11  Score=27.23  Aligned_cols=32  Identities=9%  Similarity=0.213  Sum_probs=15.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhheeccCCc
Q psy15007         11 NHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQ   42 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~~~iG~~~~~~~~~~   42 (68)
                      ..|.+.-.+.+++.++.++.|=+|.+..+||+
T Consensus       256 aaF~Pcgiaalvllil~vvliiLYiWlyrrRK  287 (295)
T TIGR01478       256 STFLPYGIAALVLIILTVVLIILYIWLYRRRK  287 (295)
T ss_pred             HhhcccHHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            34555555555544444444545544333333


No 32 
>TIGR02205 septum_zipA cell division protein ZipA. This model represents the full length of bacterial cell division protein ZipA. The N-terminal hydrophobic stretch is an uncleaved signal-anchor sequence. This is followed by an unconserved, variable length, low complexity region, and then a conserved C-terminal region of about 140 amino acids (see pfam04354) that interacts with the tubulin-like cell division protein FtsZ.
Probab=42.72  E-value=23  Score=25.32  Aligned_cols=11  Identities=9%  Similarity=0.003  Sum_probs=8.0

Q ss_pred             HHHHHHhheec
Q psy15007         28 SCAIGFFVGMC   38 (68)
Q Consensus        28 ~~~iG~~~~~~   38 (68)
                      +++=|+|.+|+
T Consensus        17 Ll~hGlwt~Rk   27 (284)
T TIGR02205        17 LLFHGLWTSRK   27 (284)
T ss_pred             HHHcccccccc
Confidence            45569998865


No 33 
>PTZ00370 STEVOR; Provisional
Probab=42.51  E-value=10  Score=27.50  Aligned_cols=27  Identities=11%  Similarity=0.205  Sum_probs=13.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhhee
Q psy15007         11 NHFTIPDYIVLLTMLVVSCAIGFFVGM   37 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~~~iG~~~~~   37 (68)
                      ..|.+.-.+.+++.++.++.|=+|.+.
T Consensus       252 aaF~Pygiaalvllil~vvliilYiwl  278 (296)
T PTZ00370        252 SAFYPYGIAALVLLILAVVLIILYIWL  278 (296)
T ss_pred             HhhcccHHHHHHHHHHHHHHHHHHHHH
Confidence            345555555554444444444444433


No 34 
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=41.64  E-value=33  Score=17.75  Aligned_cols=10  Identities=10%  Similarity=-0.141  Sum_probs=4.7

Q ss_pred             HHHHHhheec
Q psy15007         29 CAIGFFVGMC   38 (68)
Q Consensus        29 ~~iG~~~~~~   38 (68)
                      +++.+++.||
T Consensus        28 l~~~l~~~~r   37 (40)
T PF08693_consen   28 LGAFLFFWYR   37 (40)
T ss_pred             HHHHhheEEe
Confidence            3445555443


No 35 
>TIGR02736 cbb3_Q_epsi cytochrome c oxidase, cbb3-type, CcoQ subunit, epsilon-Proteobacterial. Members of this protein family are restricted to the epsilon branch of the Proteobacteria. All members are found in operons containing the other three structural subunits of the cbb3 type of cytochrome c oxidase. These small proteins show remote sequence similarity to the CcoQ subunit in other cytochrome c oxidase systems, so this family is assumed to represent the epsilonproteobacterial variant of CcoQ.
Probab=41.45  E-value=31  Score=19.16  Aligned_cols=14  Identities=14%  Similarity=0.266  Sum_probs=7.5

Q ss_pred             HHHHHHHHHhheec
Q psy15007         25 LVVSCAIGFFVGMC   38 (68)
Q Consensus        25 l~~~~~iG~~~~~~   38 (68)
                      +++++..|.++...
T Consensus        10 ~lvv~LYgY~yhLY   23 (56)
T TIGR02736        10 LLVIFLYAYIYHLY   23 (56)
T ss_pred             HHHHHHHHHHHHhh
Confidence            34445567665543


No 36 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=39.86  E-value=56  Score=22.94  Aligned_cols=14  Identities=29%  Similarity=0.532  Sum_probs=6.2

Q ss_pred             HHHHHHHHHHhhee
Q psy15007         24 MLVVSCAIGFFVGM   37 (68)
Q Consensus        24 yl~~~~~iG~~~~~   37 (68)
                      -++++++|.+..+|
T Consensus       283 ~lvlivLiaYli~R  296 (306)
T PF01299_consen  283 GLVLIVLIAYLIGR  296 (306)
T ss_pred             HHHHHHHHhheeEe
Confidence            33334445544553


No 37 
>PF07010 Endomucin:  Endomucin;  InterPro: IPR010740 This family consists of several mammalian endomucin proteins. Endomucin is an early endothelial-specific antigen that is also expressed on putative hematopoietic progenitor cells.
Probab=36.59  E-value=56  Score=23.24  Aligned_cols=26  Identities=12%  Similarity=0.070  Sum_probs=18.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHhheecc
Q psy15007         14 TIPDYIVLLTMLVVSCAIGFFVGMCG   39 (68)
Q Consensus        14 ~~~D~~v~~~yl~~~~~iG~~~~~~~   39 (68)
                      .++-++++++-+.+++++|+|..+++
T Consensus       191 lpvvIaliVitl~vf~LvgLyr~C~k  216 (259)
T PF07010_consen  191 LPVVIALIVITLSVFTLVGLYRMCWK  216 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            34455666777777888999977643


No 38 
>PF12670 DUF3792:  Protein of unknown function (DUF3792);  InterPro: IPR023804  Members of this family of strongly hydrophobic putative transmembrane protein average about 125 amino acids in length and occur mostly, but not exclusively, in the Firmicutes. Members are quite diverse in sequence. Their function is unknown. 
Probab=35.71  E-value=46  Score=20.22  Aligned_cols=25  Identities=20%  Similarity=0.454  Sum_probs=20.2

Q ss_pred             CHHHHHHHHHHHHHHHHHHHhheec
Q psy15007         14 TIPDYIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        14 ~~~D~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      +.+.+.+.+++.+....-|++..++
T Consensus        37 ~~~~~~~~~i~~ls~~~GG~~a~~~   61 (116)
T PF12670_consen   37 SILPWLVVIIYILSVFIGGFYAGRK   61 (116)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4577888889999988889988754


No 39 
>PF02060 ISK_Channel:  Slow voltage-gated potassium channel;  InterPro: IPR000369 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. Two types of beta subunit (KCNE and KCNAB) are presently known to associate with voltage-gated alpha subunits (Kv, KCNQ and eag-like). However, not all combinations of alpha and beta subunits are possible. The KCNE family of K+ channel subunits are membrane glycoproteins that possess a single transmembrane (TM) domain. They share no structural relationship with the alpha subunit proteins, which possess pore forming domains. The subunits appear to have a regulatory function, modulating the kinetics and voltage dependence of the alpha subunits of voltage-dependent K+ channels. KCNE subunits are formed from short polypeptides of ~130 amino acids, and are divided into five subfamilies: KCNE1 (MinK/IsK), KCNE2 (MiRP1), KCNE3 (MiRP2), KCNE4 (MiRP3) and KCNE1L (AMMECR2). ; GO: 0005249 voltage-gated potassium channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2K21_A.
Probab=35.70  E-value=22  Score=22.89  Aligned_cols=19  Identities=16%  Similarity=0.412  Sum_probs=7.7

Q ss_pred             HHHHHHHHHHHHHHHHhhe
Q psy15007         18 YIVLLTMLVVSCAIGFFVG   36 (68)
Q Consensus        18 ~~v~~~yl~~~~~iG~~~~   36 (68)
                      |+.+++-+...+.+|+..+
T Consensus        46 YIL~vmgfFgff~~gImls   64 (129)
T PF02060_consen   46 YILVVMGFFGFFTVGIMLS   64 (129)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            3333333333344444433


No 40 
>PRK04561 tatA twin arginine translocase protein A; Provisional
Probab=34.29  E-value=55  Score=19.17  Aligned_cols=19  Identities=21%  Similarity=0.532  Sum_probs=13.3

Q ss_pred             CCCCHHHHHHHHHHHHHHH
Q psy15007         11 NHFTIPDYIVLLTMLVVSC   29 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~~   29 (68)
                      ..+++++|+|+++-.++++
T Consensus         2 gg~s~~ellIIlvIvlLlF   20 (75)
T PRK04561          2 GSFSIWHWLVVLVIVLLVF   20 (75)
T ss_pred             CCCcHHHHHHHHHHHHHHh
Confidence            4578889888877555543


No 41 
>PF05393 Hum_adeno_E3A:  Human adenovirus early E3A glycoprotein;  InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2.; GO: 0016021 integral to membrane
Probab=34.11  E-value=31  Score=20.99  Aligned_cols=23  Identities=4%  Similarity=-0.116  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhee
Q psy15007         15 IPDYIVLLTMLVVSCAIGFFVGM   37 (68)
Q Consensus        15 ~~D~~v~~~yl~~~~~iG~~~~~   37 (68)
                      .+|.-.+++.+++++.+=.|+.+
T Consensus        32 ~Lgm~~lvI~~iFil~VilwfvC   54 (94)
T PF05393_consen   32 NLGMWFLVICGIFILLVILWFVC   54 (94)
T ss_pred             ccchhHHHHHHHHHHHHHHHHHH
Confidence            34444555555544455556544


No 42 
>PRK03427 cell division protein ZipA; Provisional
Probab=33.83  E-value=57  Score=24.02  Aligned_cols=18  Identities=11%  Similarity=0.189  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHhheecc
Q psy15007         22 LTMLVVSCAIGFFVGMCG   39 (68)
Q Consensus        22 ~~yl~~~~~iG~~~~~~~   39 (68)
                      ++-++.+++=|+|.+||-
T Consensus        14 AIAIiAlL~HGlWtsRKe   31 (333)
T PRK03427         14 AIAIIALLVHGFWTSRKE   31 (333)
T ss_pred             HHHHHHHHHHhhhhcccc
Confidence            344555667899998653


No 43 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.76  E-value=61  Score=18.83  Aligned_cols=20  Identities=20%  Similarity=0.476  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHhhee
Q psy15007         18 YIVLLTMLVVSCAIGFFVGM   37 (68)
Q Consensus        18 ~~v~~~yl~~~~~iG~~~~~   37 (68)
                      .+.+++.+++=+..|+|.++
T Consensus         7 il~ivl~ll~G~~~G~fiar   26 (71)
T COG3763           7 ILLIVLALLAGLIGGFFIAR   26 (71)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            34555566666678888874


No 44 
>TIGR03062 pip_yhgE_Cterm YhgE/Pip C-terminal domain. This family contains the C-terminal domain of a family of multiple membrane-spanning proteins of Gram-positive bacteria. One member was shown to be a host protein essential for phage infection, so many members of this family are called "phage infection protein". A separate model, TIGR03061, represents the conserved N-terminal domain. The domains are separated by regions highly variable in both length and sequence, often containing extended heptad repeats as described in model TIGR03057.
Probab=33.71  E-value=62  Score=20.69  Aligned_cols=23  Identities=30%  Similarity=0.325  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhee
Q psy15007         15 IPDYIVLLTMLVVSCAIGFFVGM   37 (68)
Q Consensus        15 ~~D~~v~~~yl~~~~~iG~~~~~   37 (68)
                      +.|+.+++++.++...++.+..+
T Consensus       182 ~~~~~~L~~~~~v~~~la~~~~~  204 (208)
T TIGR03062       182 WQAVAVLLLILVVFLALSLLSAR  204 (208)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHh
Confidence            45778888888888788877653


No 45 
>PF11022 DUF2611:  Protein of unknown function (DUF2611);  InterPro: IPR021278  This family is conserved in the Dikarya of Fungi. The function is not known. 
Probab=33.49  E-value=26  Score=20.25  Aligned_cols=21  Identities=5%  Similarity=0.116  Sum_probs=17.6

Q ss_pred             ceeecCCCCCHHHHHhhhhhc
Q psy15007         47 DFLLGSSSMGTLPMALSLAAS   67 (68)
Q Consensus        47 dyflggr~m~~~~vglSl~AT   67 (68)
                      -|-+.||+++.-.++++.++|
T Consensus         4 ~Y~I~Gr~V~~H~LAi~tLg~   24 (71)
T PF11022_consen    4 AYTIFGRQVQSHYLAIATLGT   24 (71)
T ss_pred             eeeecccccccchhHHHHHHH
Confidence            488899999999999887664


No 46 
>PF05753 TRAP_beta:  Translocon-associated protein beta (TRAPB);  InterPro: IPR008856 This family consists of several eukaryotic translocon-associated protein beta (TRAPB) or signal sequence receptor beta subunit (SSR-beta) proteins. The normal translocation of nascent polypeptides into the lumen of the endoplasmic reticulum (ER) is thought to be aided in part by a translocon-associated protein (TRAP) complex consisting of 4 protein subunits. The association of mature proteins with the ER and Golgi, or other intracellular locales, such as lysosomes, depends on the initial targeting of the nascent polypeptide to the ER membrane. A similar scenario must also exist for proteins destined for secretion [].; GO: 0005783 endoplasmic reticulum, 0016021 integral to membrane
Probab=33.30  E-value=53  Score=21.78  Aligned_cols=26  Identities=12%  Similarity=0.073  Sum_probs=17.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhhe
Q psy15007         11 NHFTIPDYIVLLTMLVVSCAIGFFVG   36 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~~~iG~~~~   36 (68)
                      ...+..||..|++..+.++++-+...
T Consensus       144 f~~~~~~w~~f~~~~~~~~~~p~ll~  169 (181)
T PF05753_consen  144 FSSHVMDWGAFAIMTLPVLLIPYLLW  169 (181)
T ss_pred             hhhhHHHHHhHHHHHHHHHHHHHHhh
Confidence            34557999999887777766554433


No 47 
>PRK10574 putative major pilin subunit; Provisional
Probab=33.27  E-value=79  Score=20.28  Aligned_cols=25  Identities=24%  Similarity=0.557  Sum_probs=18.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHH
Q psy15007          9 LDNHFTIPDYIVLLTMLVVSCAIGF   33 (68)
Q Consensus         9 ~~~~~~~~D~~v~~~yl~~~~~iG~   33 (68)
                      .+..|+.+.+.|.++-+.++.++++
T Consensus         3 ~q~GFTLIELmIViaIigILaaiai   27 (146)
T PRK10574          3 KQRGFTLIELMVVIAIIAILSAIGI   27 (146)
T ss_pred             ccCceeHHHHHHHHHHHHHHHHHHH
Confidence            4568999999988887777665544


No 48 
>PF05814 DUF843:  Baculovirus protein of unknown function (DUF843);  InterPro: IPR008561 This family consists of several unidentified baculovirus proteins of around 85 residues long with no known function.
Probab=33.09  E-value=78  Score=18.89  Aligned_cols=25  Identities=12%  Similarity=0.283  Sum_probs=19.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHhhe
Q psy15007         12 HFTIPDYIVLLTMLVVSCAIGFFVG   36 (68)
Q Consensus        12 ~~~~~D~~v~~~yl~~~~~iG~~~~   36 (68)
                      .++-+-+.+++.++++.+.++.|+.
T Consensus        22 ~~s~li~~~LilfviF~~~L~~yy~   46 (83)
T PF05814_consen   22 GFSELIITLLILFVIFFCVLQVYYI   46 (83)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHc
Confidence            4566677788888888888999875


No 49 
>PRK14762 membrane protein; Provisional
Probab=32.99  E-value=62  Score=15.29  Aligned_cols=21  Identities=29%  Similarity=0.404  Sum_probs=13.0

Q ss_pred             CHHHHHHHHHHHHHHHH-HHHh
Q psy15007         14 TIPDYIVLLTMLVVSCA-IGFF   34 (68)
Q Consensus        14 ~~~D~~v~~~yl~~~~~-iG~~   34 (68)
                      .++-|++.++|++.++. .|.+
T Consensus         2 ki~lw~i~iifligllvvtgvf   23 (27)
T PRK14762          2 KIILWAVLIIFLIGLLVVTGVF   23 (27)
T ss_pred             eeHHHHHHHHHHHHHHHHHHHH
Confidence            34567777777776554 4443


No 50 
>PRK02958 tatA twin arginine translocase protein A; Provisional
Probab=32.27  E-value=62  Score=18.75  Aligned_cols=19  Identities=21%  Similarity=0.555  Sum_probs=13.4

Q ss_pred             CCCCHHHHHHHHHHHHHHH
Q psy15007         11 NHFTIPDYIVLLTMLVVSC   29 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~~   29 (68)
                      ..+++++++|+++-.++++
T Consensus         2 g~~g~~elliIl~IvlllF   20 (73)
T PRK02958          2 GSFSIWHWLIVLVIVVLVF   20 (73)
T ss_pred             CCccHHHHHHHHHHHHHHh
Confidence            3578888888876666554


No 51 
>PF01708 Gemini_mov:  Geminivirus putative movement protein ;  InterPro: IPR002621 This family consists of putative movement proteins from Maize streak virus and Wheat dwarf virus [].; GO: 0046740 spread of virus in host, cell to cell, 0016021 integral to membrane
Probab=30.82  E-value=1.3e+02  Score=18.32  Aligned_cols=18  Identities=11%  Similarity=0.433  Sum_probs=13.5

Q ss_pred             eccCCcCCccceeecCCC
Q psy15007         37 MCGEKQTTSDDFLLGSSS   54 (68)
Q Consensus        37 ~~~~~~~s~~dyflggr~   54 (68)
                      .|.||++++||-=.|++-
T Consensus        66 ~KAkrqrsTeEigFG~tp   83 (91)
T PF01708_consen   66 LKAKRQRSTEEIGFGNTP   83 (91)
T ss_pred             eeeccCCceeeeeeCCCC
Confidence            455889999998777653


No 52 
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=30.60  E-value=60  Score=18.84  Aligned_cols=13  Identities=8%  Similarity=0.340  Sum_probs=5.2

Q ss_pred             HHHHHHHHHHHHh
Q psy15007         22 LTMLVVSCAIGFF   34 (68)
Q Consensus        22 ~~yl~~~~~iG~~   34 (68)
                      +++++++..+-++
T Consensus        11 ivf~ifVap~WL~   23 (75)
T PF06667_consen   11 IVFMIFVAPIWLI   23 (75)
T ss_pred             HHHHHHHHHHHHH
Confidence            3344444334333


No 53 
>PF14221 DUF4330:  Domain of unknown function (DUF4330)
Probab=30.46  E-value=26  Score=22.88  Aligned_cols=23  Identities=26%  Similarity=0.426  Sum_probs=16.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHH
Q psy15007         11 NHFTIPDYIVLLTMLVVSCAIGF   33 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~~~iG~   33 (68)
                      ..++++|.+++++-+++..++.+
T Consensus        12 gkiniiDl~~~lvvl~v~~g~~~   34 (168)
T PF14221_consen   12 GKINIIDLLAILVVLAVVVGIFW   34 (168)
T ss_pred             eeEeHHHHHHHHHHHHHhheeEE
Confidence            45889999988887777544433


No 54 
>TIGR03867 MprA_tail MprA protease C-terminal sorting domain. This model describes a protein C-terminal domain that occurs in species of the genus Ralstonia and is predicted to play a role in protein targeting. This sequence, though limited to members of the MprA serine in species distribution, resembles C-terminal sorting sequences of the sortase and exosortase systems, as well as a Shewanella-type C-terminal sequence modeled by TIGR03501. For all such cases, member proteins have homologs in other species with essentially full-length homology, save for the lack of the domain modeled here. All members of the present family are predicted serine proteases
Probab=30.17  E-value=35  Score=16.28  Aligned_cols=16  Identities=38%  Similarity=0.439  Sum_probs=11.8

Q ss_pred             cCCCCCHHHHHhhhhh
Q psy15007         51 GSSSMGTLPMALSLAA   66 (68)
Q Consensus        51 ggr~m~~~~vglSl~A   66 (68)
                      ||..+++|..++-++|
T Consensus         2 GGGai~~~~A~Lll~a   17 (27)
T TIGR03867         2 GGGAIAPWLAALLLAA   17 (27)
T ss_pred             CCchhHHHHHHHHHHH
Confidence            5678888887776665


No 55 
>COG3295 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.08  E-value=53  Score=22.80  Aligned_cols=38  Identities=13%  Similarity=0.196  Sum_probs=24.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhh
Q psy15007         16 PDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLA   65 (68)
Q Consensus        16 ~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~   65 (68)
                      +|..-+++.++.+.++++|.-..  |+          |.+.|.++|+..+
T Consensus       166 iDl~AvallvlaLTgL~ll~lh~--k~----------R~~~W~lvGlGsv  203 (213)
T COG3295         166 IDLLAVALLVLALTGLALLVLHT--KR----------RRVGWPLVGLGSV  203 (213)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhc--Cc----------ccccceeecHHHH
Confidence            68877777777777788886422  22          5667777775443


No 56 
>PF10260 SAYSvFN:  Uncharacterized conserved domain (SAYSvFN);  InterPro: IPR019387  This domain of approximately 75 residues contains a highly conserved SATSv/iFN motif. The function is unknown but the domain is conserved from plants to humans. 
Probab=30.05  E-value=77  Score=18.24  Aligned_cols=26  Identities=12%  Similarity=0.192  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHhheecc-CCcCCccce
Q psy15007         23 TMLVVSCAIGFFVGMCG-EKQTTSDDF   48 (68)
Q Consensus        23 ~yl~~~~~iG~~~~~~~-~~~~s~~dy   48 (68)
                      +|++++....+|...++ |++...+-|
T Consensus        21 vf~i~s~f~~I~~Nl~~~r~~ge~SAY   47 (71)
T PF10260_consen   21 VFFILSGFYLIFTNLGTPRKPGELSAY   47 (71)
T ss_pred             HHHHHHHHHHHHHcCCCCCCCCCccch
Confidence            45555555556665544 444444444


No 57 
>COG1826 TatA Sec-independent protein secretion pathway components [Intracellular trafficking and secretion]
Probab=30.02  E-value=60  Score=19.15  Aligned_cols=18  Identities=6%  Similarity=0.274  Sum_probs=13.3

Q ss_pred             CCCHHHHHHHHHHHHHHH
Q psy15007         12 HFTIPDYIVLLTMLVVSC   29 (68)
Q Consensus        12 ~~~~~D~~v~~~yl~~~~   29 (68)
                      .+++.+|+|+++-.++++
T Consensus         3 ~ig~~elliIlvV~lllf   20 (94)
T COG1826           3 GIGWSELLIILVVALLVF   20 (94)
T ss_pred             CCCHHHHHHHHHHHHHhc
Confidence            378899988877666653


No 58 
>PRK14780 lipoprotein signal peptidase; Provisional
Probab=29.98  E-value=75  Score=22.73  Aligned_cols=27  Identities=19%  Similarity=0.296  Sum_probs=17.6

Q ss_pred             CCCCHHHHHHHHHHHH--HHHHHHHhhee
Q psy15007         11 NHFTIPDYIVLLTMLV--VSCAIGFFVGM   37 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~--~~~~iG~~~~~   37 (68)
                      ..|+..|..|.+...+  +...+|+...+
T Consensus       198 ~iFNlADi~I~~G~~llv~~~li~~~~~~  226 (263)
T PRK14780        198 SIINLFDVYIVVGVCVLVVILIISFIIKW  226 (263)
T ss_pred             ceeEHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            4688889888765543  33457877554


No 59 
>PRK00720 tatA twin arginine translocase protein A; Provisional
Probab=29.78  E-value=73  Score=18.72  Aligned_cols=20  Identities=15%  Similarity=0.486  Sum_probs=13.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHH
Q psy15007         11 NHFTIPDYIVLLTMLVVSCA   30 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~~~   30 (68)
                      ..+++++++|+++-.+++++
T Consensus         2 gg~g~~ellIIlvIvlllFG   21 (78)
T PRK00720          2 GSFSIWHWLIVLAVVLLLFG   21 (78)
T ss_pred             CCCcHHHHHHHHHHHHHHhC
Confidence            35788888887776655543


No 60 
>PF12955 DUF3844:  Domain of unknown function (DUF3844);  InterPro: IPR024382 This presumed domain is found in fungal species. It contains 8 largely conserved cysteine residues. This domain is found in proteins thought to be located in the endoplasmic reticulum.
Probab=29.66  E-value=1.2e+02  Score=18.66  Aligned_cols=26  Identities=19%  Similarity=0.276  Sum_probs=21.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhhe
Q psy15007         11 NHFTIPDYIVLLTMLVVSCAIGFFVG   36 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~~~iG~~~~   36 (68)
                      .+|..+=+..+++.+++..+|++.++
T Consensus        66 ~~F~L~~~~ti~lv~~~~~~I~lL~s   91 (103)
T PF12955_consen   66 VPFWLFAGFTIALVVLVAGAIGLLFS   91 (103)
T ss_pred             chhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            35777888888888888889999886


No 61 
>PF11982 DUF3483:  Domain of unknown function (DUF3483);  InterPro: IPR021872  This presumed domain is functionally uncharacterised. This domain is found in bacteria. This domain is about 230 amino acids in length. This domain is found associated with PF02754 from PFAM. 
Probab=29.54  E-value=87  Score=21.92  Aligned_cols=47  Identities=17%  Similarity=0.230  Sum_probs=26.8

Q ss_pred             CHHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCC--CCCHHHHHhhh
Q psy15007         14 TIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSS--SMGTLPMALSL   64 (68)
Q Consensus        14 ~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr--~m~~~~vglSl   64 (68)
                      .++||.++...++ ++ +|-.+-.++|+  +.-.=+-.|+  .+|+...+.|+
T Consensus        92 ~~L~w~ll~a~~~-m~-~Ga~fV~~RR~--~~P~RLS~G~w~rLP~sL~afa~  140 (224)
T PF11982_consen   92 RILDWLLLAAALA-MF-VGALFVARRRR--NPPARLSKGPWMRLPKSLLAFAL  140 (224)
T ss_pred             hHHHHHHHHHHHH-HH-HHHHHHHHHhc--CCCcccCCCChhHhHHHHHHHHH
Confidence            4689999888877 44 44443333233  3333344555  66776666654


No 62 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=29.10  E-value=80  Score=22.15  Aligned_cols=34  Identities=12%  Similarity=0.087  Sum_probs=25.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHHhheeccCCcCCccce
Q psy15007         14 TIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDF   48 (68)
Q Consensus        14 ~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dy   48 (68)
                      +.+--+++++-|+++++|.+....-+||+... .|
T Consensus       270 ~~~vPIaVG~~La~lvlivLiaYli~Rrr~~~-gY  303 (306)
T PF01299_consen  270 SDLVPIAVGAALAGLVLIVLIAYLIGRRRSRA-GY  303 (306)
T ss_pred             cchHHHHHHHHHHHHHHHHHHhheeEeccccc-cc
Confidence            44555678899999999999988887765544 55


No 63 
>PRK00220 putative glycerol-3-phosphate acyltransferase PlsY; Provisional
Probab=28.74  E-value=82  Score=21.18  Aligned_cols=35  Identities=26%  Similarity=0.394  Sum_probs=23.4

Q ss_pred             HHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCC
Q psy15007         19 IVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMG   56 (68)
Q Consensus        19 ~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~   56 (68)
                      .+++.|++.++-.|++..+. .+.++..++  |++|.+
T Consensus         8 ~~i~~YLlGsip~~~ii~k~-~~~~DiR~~--GSgN~G   42 (198)
T PRK00220          8 LILLAYLLGSIPFALLVGKL-FGLPDPREH--GSGNPG   42 (198)
T ss_pred             HHHHHHHHHhhhHHHHHHHH-hCCCChhhc--CCCCcc
Confidence            35678999999999998743 123455555  555543


No 64 
>PRK01844 hypothetical protein; Provisional
Probab=28.64  E-value=83  Score=18.28  Aligned_cols=19  Identities=37%  Similarity=0.676  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHHhhee
Q psy15007         19 IVLLTMLVVSCAIGFFVGM   37 (68)
Q Consensus        19 ~v~~~yl~~~~~iG~~~~~   37 (68)
                      ++.++.+++=+++|+|.++
T Consensus         8 ~l~I~~li~G~~~Gff~ar   26 (72)
T PRK01844          8 LVGVVALVAGVALGFFIAR   26 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3344555555678898873


No 65 
>TIGR00023 acyl-phosphate glycerol 3-phosphate acyltransferase. This model represents the full length of acylphosphate:glycerol 3-phosphate acyltransferase, and integral membrane protein about 200 amino acids in length, called PlsY in Streptococcus pneumoniae, YneS in Bacillus subtilis, and YgiH in E. coli. It is found in a single copy in a large number of bacteria, including the Mycoplasmas but not Mycobacteria or spirochetes, for example. Its partner is PlsX (see TIGR00182), and the pair can replace PlsB for synthesizing 1-acylglycerol-3-phosphate.
Probab=27.46  E-value=90  Score=21.01  Aligned_cols=36  Identities=25%  Similarity=0.465  Sum_probs=23.5

Q ss_pred             HHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCC
Q psy15007         18 YIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMG   56 (68)
Q Consensus        18 ~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~   56 (68)
                      ..+++.|++.++-.|++..+. .+.++..++  |++|.+
T Consensus         7 l~~~~~YLlGSip~~~~i~k~-~~g~DiR~~--GSgN~G   42 (196)
T TIGR00023         7 FLLLIGYLIGSIPFAYLVGKI-LKGIDIREH--GSGNPG   42 (196)
T ss_pred             HHHHHHHHHHhhHHHHHHHHH-hCCCCchhc--CCCCcc
Confidence            445668999999999998743 123455555  555543


No 66 
>TIGR01433 CyoA cytochrome o ubiquinol oxidase subunit II. This enzyme catalyzes the oxidation of ubiquinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. Subunit II is responsible for binding and oxidation of the ubiquinone substrate. This sequence is closely related to QoxA, which oxidizes quinol in gram positive bacteria but which is in complex with subunits which utilize cytochromes a in the reduction of molecular oxygen. Slightly more distantly related is subunit II of cytochrome c oxidase which uses cyt. c as the oxidant.
Probab=26.72  E-value=1.1e+02  Score=20.95  Aligned_cols=7  Identities=14%  Similarity=0.107  Sum_probs=3.3

Q ss_pred             ecCCCCC
Q psy15007         50 LGSSSMG   56 (68)
Q Consensus        50 lggr~m~   56 (68)
                      .+++.+-
T Consensus        71 ~~~~~lE   77 (226)
T TIGR01433        71 HHSTKIE   77 (226)
T ss_pred             cCCceee
Confidence            3455554


No 67 
>PF09451 ATG27:  Autophagy-related protein 27;  InterPro: IPR018939 Autophagy is a degradative transport pathway that delivers cytosolic proteins to the lysosome (vacuole) [] and is induced by starvation []. Cytosolic proteins appear inside the vacuole enclosed in autophagic vesicles. Autophagy significantly differs from other transport pathways by using double membrane layered transport intermediates, called autophagosomes [, ]. The breakdown of vesicular transport intermediates is a unique feature of autophagy []. Autophagy can also function in the elimination of invading bacteria and antigens []. There are more than 25 AuTophaGy-related (ATG) genes that are essential for autophagy, although it is still not known how the autophagosome is made. Atg9 is a potential membrane carrier to deliver lipids that are used to form the vesicle. Atg27 is another transmembrane protein, and is a cycling protein []. It acts as an effector of VPS34 phosphatidylinositol 3-phosphate kinase signalling and regulates the cytoplasm to vacuole transport (Cvt) vesicle formation. It is also required for autophagy-dependent cycling of ATG9. 
Probab=26.23  E-value=1e+02  Score=21.29  Aligned_cols=29  Identities=7%  Similarity=0.189  Sum_probs=16.5

Q ss_pred             CCCCHHHHHHHHHH--HHHHHHHHHhheecc
Q psy15007         11 NHFTIPDYIVLLTM--LVVSCAIGFFVGMCG   39 (68)
Q Consensus        11 ~~~~~~D~~v~~~y--l~~~~~iG~~~~~~~   39 (68)
                      ...+++-|++++++  +++-+.+|.|+.+++
T Consensus       198 ~~~g~f~wl~i~~~l~~~~Y~i~g~~~n~~~  228 (268)
T PF09451_consen  198 GGWGFFTWLFIILFLFLAAYLIFGSWYNYNR  228 (268)
T ss_pred             ccccHHHHHHHHHHHHHHHHhhhhhheeecc
Confidence            34555544444433  344567888887654


No 68 
>PF07069 PRRSV_2b:  Porcine reproductive and respiratory syndrome virus 2b ;  InterPro: IPR009775 This family consists of several Porcine reproductive and respiratory syndrome virus (PRRSV) ORF2b proteins. The function of this family is unknown however it is known that large amounts of 2b protein are present in the virion and it is thought that this protein may be an integral component of the virion [].
Probab=25.96  E-value=1.1e+02  Score=17.59  Aligned_cols=21  Identities=29%  Similarity=0.509  Sum_probs=13.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHHh
Q psy15007         14 TIPDYIVLLTMLVVSCAIGFF   34 (68)
Q Consensus        14 ~~~D~~v~~~yl~~~~~iG~~   34 (68)
                      +++|.++|..-+.....-|+.
T Consensus        25 sivdiiiflailfgftiagwl   45 (73)
T PF07069_consen   25 SIVDIIIFLAILFGFTIAGWL   45 (73)
T ss_pred             HHHHHHHHHHHHHhhHHHHHH
Confidence            457887777666555555544


No 69 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=25.93  E-value=23  Score=25.50  Aligned_cols=12  Identities=17%  Similarity=-0.039  Sum_probs=0.0

Q ss_pred             HHHHhheeccCC
Q psy15007         30 AIGFFVGMCGEK   41 (68)
Q Consensus        30 ~iG~~~~~~~~~   41 (68)
                      .|.....+|+|+
T Consensus       164 iIa~icyrrkR~  175 (290)
T PF05454_consen  164 IIACICYRRKRK  175 (290)
T ss_dssp             ------------
T ss_pred             HHHHHhhhhhhc
Confidence            344444444344


No 70 
>PRK14473 F0F1 ATP synthase subunit B; Provisional
Probab=25.27  E-value=1.2e+02  Score=19.23  Aligned_cols=26  Identities=15%  Similarity=0.199  Sum_probs=12.5

Q ss_pred             CCCCCCHHHHHH-HHHHHHHHHHHHHh
Q psy15007          9 LDNHFTIPDYIV-LLTMLVVSCAIGFF   34 (68)
Q Consensus         9 ~~~~~~~~D~~v-~~~yl~~~~~iG~~   34 (68)
                      ++..+++.+.+. ++.|++++..+..+
T Consensus         2 ~~~~~~~~~~~~~~inflil~~lL~~f   28 (164)
T PRK14473          2 EKLGINLGLLIAQLINFLLLIFLLRTF   28 (164)
T ss_pred             CcccCcHHHHHHHHHHHHHHHHHHHHH
Confidence            455667666544 33344444444433


No 71 
>PF11014 DUF2852:  Protein of unknown function (DUF2852);  InterPro: IPR021273  This bacterial family of proteins has no known function. 
Probab=25.16  E-value=44  Score=21.03  Aligned_cols=10  Identities=40%  Similarity=0.610  Sum_probs=5.4

Q ss_pred             HHHHHhhhhh
Q psy15007         57 TLPMALSLAA   66 (68)
Q Consensus        57 ~~~vglSl~A   66 (68)
                      +||+|+.++|
T Consensus        22 fWPlGla~La   31 (115)
T PF11014_consen   22 FWPLGLALLA   31 (115)
T ss_pred             HHHHHHHHHH
Confidence            4556655543


No 72 
>PF13268 DUF4059:  Protein of unknown function (DUF4059)
Probab=25.12  E-value=97  Score=18.03  Aligned_cols=7  Identities=29%  Similarity=0.454  Sum_probs=3.4

Q ss_pred             CCcCCcc
Q psy15007         40 EKQTTSD   46 (68)
Q Consensus        40 ~~~~s~~   46 (68)
                      ||.|+.+
T Consensus        35 ~~DKT~~   41 (72)
T PF13268_consen   35 KKDKTAK   41 (72)
T ss_pred             cCCCcHH
Confidence            4455543


No 73 
>TIGR01167 LPXTG_anchor LPXTG-motif cell wall anchor domain. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region.
Probab=25.10  E-value=87  Score=14.45  Aligned_cols=7  Identities=14%  Similarity=0.273  Sum_probs=2.8

Q ss_pred             HHHHhhe
Q psy15007         30 AIGFFVG   36 (68)
Q Consensus        30 ~iG~~~~   36 (68)
                      ..++++.
T Consensus        23 ~~~~~~~   29 (34)
T TIGR01167        23 LGGLLLR   29 (34)
T ss_pred             HHHHHhe
Confidence            3444443


No 74 
>PRK10845 colicin V production protein; Provisional
Probab=24.56  E-value=1.2e+02  Score=19.53  Aligned_cols=21  Identities=14%  Similarity=0.316  Sum_probs=12.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHh
Q psy15007         13 FTIPDYIVLLTMLVVSCAIGFF   34 (68)
Q Consensus        13 ~~~~D~~v~~~yl~~~~~iG~~   34 (68)
                      |+++|++++++.+ .....|++
T Consensus         1 m~~lDiiil~il~-~~~i~G~~   21 (162)
T PRK10845          1 MVWIDYAIIAVIG-FSALVSLI   21 (162)
T ss_pred             CcHHHHHHHHHHH-HHHHHHHH
Confidence            5788997765443 33344443


No 75 
>MTH00260 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=24.55  E-value=1.3e+02  Score=16.18  Aligned_cols=26  Identities=8%  Similarity=0.199  Sum_probs=13.9

Q ss_pred             CCCCHHHHHHHHHHHHHH---HHHHHhhe
Q psy15007         11 NHFTIPDYIVLLTMLVVS---CAIGFFVG   36 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~---~~iG~~~~   36 (68)
                      .++.++.|..+.+++..+   ..+-.|+.
T Consensus         2 PQmsPm~W~~l~~~f~~~~~~~~~~~~~~   30 (53)
T MTH00260          2 PHLSPMSWLTAMIIFWFILLIFASSMWWS   30 (53)
T ss_pred             CCcccHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            456677777665444433   23445554


No 76 
>PF11346 DUF3149:  Protein of unknown function (DUF3149);  InterPro: IPR021494  This bacterial family of proteins has no known function. 
Probab=24.21  E-value=1.2e+02  Score=15.76  Aligned_cols=22  Identities=9%  Similarity=-0.016  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhhee
Q psy15007         16 PDYIVLLTMLVVSCAIGFFVGM   37 (68)
Q Consensus        16 ~D~~v~~~yl~~~~~iG~~~~~   37 (68)
                      .-.++++.-+........|+.+
T Consensus        14 ~Sl~vI~~~igm~~~~~~~F~~   35 (42)
T PF11346_consen   14 MSLIVIVFTIGMGVFFIRYFIR   35 (42)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3445555555555555556653


No 77 
>PF11770 GAPT:  GRB2-binding adapter (GAPT);  InterPro: IPR021082  This entry represents a family of transmembrane proteins which bind the growth factor receptor-bound protein 2 (GRB2) in B cells []. In contrast to other transmembrane adaptor proteins, GAPT, which this entry represents, is not phosphorylated upon BCR ligation. It associates with GRB2 constitutively through its proline-rich region []. 
Probab=23.70  E-value=69  Score=21.26  Aligned_cols=22  Identities=23%  Similarity=0.326  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHHhheec
Q psy15007         17 DYIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        17 D~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      -..|++++++++.+||..+.|+
T Consensus        13 ~igi~Ll~lLl~cgiGcvwhwk   34 (158)
T PF11770_consen   13 SIGISLLLLLLLCGIGCVWHWK   34 (158)
T ss_pred             HHHHHHHHHHHHHhcceEEEee
Confidence            3444555566666788765543


No 78 
>PF04971 Lysis_S:  Lysis protein S ;  InterPro: IPR007054 The lysis S protein is a cytotoxic protein forming holes in membranes causing cell lysis. The action of Lysis S is independent of the proportion of acidic phospholipids in the membrane [].
Probab=23.17  E-value=1.1e+02  Score=17.51  Aligned_cols=16  Identities=0%  Similarity=0.243  Sum_probs=9.8

Q ss_pred             HHHHHHhheeccCCcC
Q psy15007         28 SCAIGFFVGMCGEKQT   43 (68)
Q Consensus        28 ~~~iG~~~~~~~~~~~   43 (68)
                      ...+.+||.++..|++
T Consensus        48 t~ltN~YFK~k~drr~   63 (68)
T PF04971_consen   48 TYLTNLYFKIKEDRRK   63 (68)
T ss_pred             HHHhHhhhhhhHhhhH
Confidence            4568888876543333


No 79 
>PRK00442 tatA twin arginine translocase protein A; Provisional
Probab=22.55  E-value=1.1e+02  Score=18.56  Aligned_cols=19  Identities=26%  Similarity=0.497  Sum_probs=13.0

Q ss_pred             CCCCHHHHHHHHHHHHHHH
Q psy15007         11 NHFTIPDYIVLLTMLVVSC   29 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~~   29 (68)
                      ..+++..++|+++-.++++
T Consensus         2 g~~g~~elliIlvIvlllF   20 (92)
T PRK00442          2 GIFDWKHWIVILVVVVLVF   20 (92)
T ss_pred             CCccHHHHHHHHHHHHHHh
Confidence            3577888888776665554


No 80 
>PRK14794 lipoprotein signal peptidase; Provisional
Probab=22.51  E-value=1.5e+02  Score=18.80  Aligned_cols=19  Identities=21%  Similarity=0.333  Sum_probs=13.9

Q ss_pred             CCCCCHHHHHHHHHHHHHH
Q psy15007         10 DNHFTIPDYIVLLTMLVVS   28 (68)
Q Consensus        10 ~~~~~~~D~~v~~~yl~~~   28 (68)
                      -+.|+..|..|.+.-.+++
T Consensus        99 ~pvFNvAD~~I~iGv~lll  117 (136)
T PRK14794         99 WPAFNLADIAIVLGALLFV  117 (136)
T ss_pred             CceeeHHHHHHHHHHHHHH
Confidence            3578999999887755443


No 81 
>COG4682 Predicted membrane protein [Function unknown]
Probab=22.48  E-value=83  Score=20.20  Aligned_cols=36  Identities=19%  Similarity=0.373  Sum_probs=22.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeec
Q psy15007         12 HFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLG   51 (68)
Q Consensus        12 ~~~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflg   51 (68)
                      .|.++-|..+++= ++...+|+|-+   .-+-+.+.||+|
T Consensus        11 af~~va~~~lv~G-~vvyLiGLWna---~~qLnEKGYyfa   46 (128)
T COG4682          11 AFTIVAWLALVVG-AVVYLVGLWNA---CMQLNEKGYYFA   46 (128)
T ss_pred             HHHHHHHHHHHHH-HHHHHHhhccc---chhhccCceeeh
Confidence            3555666554332 22346899976   457788899986


No 82 
>PF10095 DUF2333:  Uncharacterized protein conserved in bacteria (DUF2333);  InterPro: IPR016936 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=22.37  E-value=71  Score=23.61  Aligned_cols=24  Identities=17%  Similarity=0.117  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHhheec
Q psy15007         15 IPDYIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        15 ~~D~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      ..-.+++++|++++.++|+|.+..
T Consensus        14 ~~~~~~~~~~~~v~~~lg~~ws~~   37 (336)
T PF10095_consen   14 KTVGALLAVYLLVVLILGVYWSRE   37 (336)
T ss_pred             HHHHHHHHHHHHHHHHHheeEecC
Confidence            345677889999999999998843


No 83 
>PF07019 Rab5ip:  Rab5-interacting protein (Rab5ip)
Probab=22.23  E-value=43  Score=18.97  Aligned_cols=34  Identities=9%  Similarity=0.201  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHHHHHHHHhheeccCCcCCccceeecC
Q psy15007         17 DYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGS   52 (68)
Q Consensus        17 D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflgg   52 (68)
                      -+.-|+.|++....+...+..  +.++..++||.+.
T Consensus        25 g~~Gf~~f~~~~~~~s~~~~~--~~~~~~~~~f~~~   58 (81)
T PF07019_consen   25 GLYGFIFFFLSSFLVSLLYYA--KAGFPDEDYFGGP   58 (81)
T ss_pred             cHHHHHHHHHHHHHHHHHHHH--HhcCChhhhcCCH
Confidence            345677788887777666542  2344556777543


No 84 
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=22.21  E-value=83  Score=20.24  Aligned_cols=15  Identities=13%  Similarity=0.299  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHhhee
Q psy15007         23 TMLVVSCAIGFFVGM   37 (68)
Q Consensus        23 ~yl~~~~~iG~~~~~   37 (68)
                      +-.++.++.|+|...
T Consensus       126 ~g~ll~i~~giy~~~  140 (145)
T PF10661_consen  126 GGILLAICGGIYVVL  140 (145)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            335566678888654


No 85 
>PF03672 UPF0154:  Uncharacterised protein family (UPF0154);  InterPro: IPR005359 The proteins in this entry are functionally uncharacterised.
Probab=22.16  E-value=64  Score=18.29  Aligned_cols=16  Identities=38%  Similarity=0.808  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHhhee
Q psy15007         22 LTMLVVSCAIGFFVGM   37 (68)
Q Consensus        22 ~~yl~~~~~iG~~~~~   37 (68)
                      ++.+++=+++|+|.++
T Consensus         4 ilali~G~~~Gff~ar   19 (64)
T PF03672_consen    4 ILALIVGAVIGFFIAR   19 (64)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3444455578888874


No 86 
>MTH00158 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=22.12  E-value=1.1e+02  Score=14.60  Aligned_cols=19  Identities=5%  Similarity=0.464  Sum_probs=12.2

Q ss_pred             CCCCHHHHHHHHHHHHHHH
Q psy15007         11 NHFTIPDYIVLLTMLVVSC   29 (68)
Q Consensus        11 ~~~~~~D~~v~~~yl~~~~   29 (68)
                      +++.+..|..+..++..+.
T Consensus         2 PQmsPm~W~~l~~~f~~~~   20 (32)
T MTH00158          2 PQMSPMNWLILFILFLITF   20 (32)
T ss_pred             CCcccHHHHHHHHHHHHHH
Confidence            4677788877666555543


No 87 
>PF00003 7tm_3:  7 transmembrane sweet-taste receptor of 3 GCPR;  InterPro: IPR017978 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  GPCR family 3 receptors (also known as family C) are structurally similar to other GPCRs, but do not show any significant sequence similarity and thus represent a distinct group. Structurally they are composed of four elements; an N-terminal signal sequence; a large hydrophilic extracellular agonist-binding region containing several conserved cysteine residues which could be involved in disulphide bonds; a shorter region containing seven transmembrane domains; and a C-terminal cytoplasmic domain of variable length []. Family 3 members include the metabotropic glutamate receptors, the extracellular calcium-sensing receptors, the gamma-amino-butyric acid (GABA) type B receptors, and the vomeronasal type-2 receptors [, , , ]. As these receptors regulate many important physiological processes they are potentially promising targets for drug development. This entry represents the C-terminal region of family 3 GPCR receptor proteins, which contains the seven transmembrane region. The seven TM regions assemble in such a way as to produce a docking pocket into which such molecules as cyclamate and lactisole have been found to bind and consequently confer the taste of sweetness []. ; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway, 0016021 integral to membrane
Probab=22.02  E-value=1.1e+02  Score=19.83  Aligned_cols=29  Identities=21%  Similarity=0.125  Sum_probs=22.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHhheeccCC
Q psy15007         13 FTIPDYIVLLTMLVVSCAIGFFVGMCGEK   41 (68)
Q Consensus        13 ~~~~D~~v~~~yl~~~~~iG~~~~~~~~~   41 (68)
                      -+..+..+..+|-.+++.+|.+.+++.|+
T Consensus       146 ~~~~~~~~~~~y~~~Ll~~~~~la~~~R~  174 (238)
T PF00003_consen  146 NSNIWLILSLGYNGLLLLIGFFLAFKTRN  174 (238)
T ss_pred             CccchHHHHHHHHHHHHHHHHHHHHhhCC
Confidence            34466678889999999999998876554


No 88 
>PF11137 DUF2909:  Protein of unknown function (DUF2909);  InterPro: IPR021313  This is a family of proteins conserved in Proteobacteria of unknown function. 
Probab=21.92  E-value=1.6e+02  Score=16.48  Aligned_cols=22  Identities=18%  Similarity=0.286  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHhheeccC
Q psy15007         19 IVLLTMLVVSCAIGFFVGMCGE   40 (68)
Q Consensus        19 ~v~~~yl~~~~~iG~~~~~~~~   40 (68)
                      +++.++.+.+++-|+++..|++
T Consensus         6 v~lll~ii~sL~saL~~l~kd~   27 (63)
T PF11137_consen    6 VLLLLAIIASLFSALFFLVKDK   27 (63)
T ss_pred             HHHHHHHHHHHHHHHHHHhhCC
Confidence            4455666777888999886543


No 89 
>PRK15066 inner membrane transport permease; Provisional
Probab=21.62  E-value=1.4e+02  Score=19.96  Aligned_cols=23  Identities=22%  Similarity=0.379  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhee
Q psy15007         15 IPDYIVLLTMLVVSCAIGFFVGM   37 (68)
Q Consensus        15 ~~D~~v~~~yl~~~~~iG~~~~~   37 (68)
                      +.++.+.+++.++...+|.+..+
T Consensus       228 ~~~l~~l~~~~~v~~~la~~~~~  250 (257)
T PRK15066        228 WLAFAVLLVFIVVLYLLAWYLLE  250 (257)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            56788888888888889988653


No 90 
>PRK14857 tatA twin arginine translocase protein A; Provisional
Probab=21.49  E-value=1.1e+02  Score=18.25  Aligned_cols=22  Identities=14%  Similarity=0.161  Sum_probs=14.6

Q ss_pred             cCCCCCCHHHHHHHHHHHHHHH
Q psy15007          8 GLDNHFTIPDYIVLLTMLVVSC   29 (68)
Q Consensus         8 ~~~~~~~~~D~~v~~~yl~~~~   29 (68)
                      |.+..+++..++++++..++++
T Consensus         1 m~mF~iG~~ElliIlvVaLlvf   22 (90)
T PRK14857          1 MNIFGIGLPEMAVILVIALLVF   22 (90)
T ss_pred             CCcccccHHHHHHHHHHHHHHc
Confidence            3456678888887776655553


No 91 
>PRK11677 hypothetical protein; Provisional
Probab=21.43  E-value=1.1e+02  Score=19.52  Aligned_cols=21  Identities=29%  Similarity=0.173  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHHHHhheec
Q psy15007         18 YIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        18 ~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      |++.++-|++=++||++..|.
T Consensus         3 W~~a~i~livG~iiG~~~~R~   23 (134)
T PRK11677          3 WEYALIGLVVGIIIGAVAMRF   23 (134)
T ss_pred             HHHHHHHHHHHHHHHHHHHhh
Confidence            555556666666788877653


No 92 
>PF09973 DUF2208:  Predicted membrane protein (DUF2208);  InterPro: IPR009198 There are currently no experimental data for members of this group or their homologues. However, these proteins are predicted to contain three or more transmembrane segments.
Probab=21.19  E-value=1.3e+02  Score=21.03  Aligned_cols=21  Identities=19%  Similarity=0.391  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHhheec
Q psy15007         18 YIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        18 ~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      +.++++|+++..++-...+.|
T Consensus        26 ~~~filYfiv~~~i~~~~~~R   46 (233)
T PF09973_consen   26 FEVFILYFIVFFGIMIVMGIR   46 (233)
T ss_pred             HHHHHHHHHHHHHHHHHHhhh
Confidence            467888888888777766544


No 93 
>COG4708 Predicted membrane protein [Function unknown]
Probab=20.96  E-value=59  Score=21.68  Aligned_cols=36  Identities=19%  Similarity=0.215  Sum_probs=22.4

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecC
Q psy15007         12 HFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGS   52 (68)
Q Consensus        12 ~~~~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflgg   52 (68)
                      +++++|..+=..--++.+..|.+.-     .+-++||+.-|
T Consensus        69 S~g~iDv~~G~~sT~I~l~Lgv~~f-----~ky~Kdy~~ng  104 (169)
T COG4708          69 SFGWIDVFVGGLSTLIFLSLGVILF-----SKYSKDYLFNG  104 (169)
T ss_pred             HHHHHHHHhccHHHHHHHHHHHHhh-----hhhhhhhhhcc
Confidence            4788898876666666666665533     13445676654


No 94 
>PRK04335 cell division protein ZipA; Provisional
Probab=20.88  E-value=1.1e+02  Score=22.40  Aligned_cols=16  Identities=6%  Similarity=0.029  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHHhheec
Q psy15007         23 TMLVVSCAIGFFVGMC   38 (68)
Q Consensus        23 ~yl~~~~~iG~~~~~~   38 (68)
                      +-++.+++=|+|.++|
T Consensus        14 lAI~ALL~HGlWtsrK   29 (313)
T PRK04335         14 LAIAALLFHGLWTSKK   29 (313)
T ss_pred             HHHHHHHHhccccccc
Confidence            3344566789999854


No 95 
>PRK14393 membrane protein; Provisional
Probab=20.70  E-value=1.3e+02  Score=20.18  Aligned_cols=34  Identities=18%  Similarity=0.316  Sum_probs=23.5

Q ss_pred             HHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCC
Q psy15007         19 IVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMG   56 (68)
Q Consensus        19 ~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~   56 (68)
                      .+++.|++.++-.|++..+.  +..+..++  |++|.+
T Consensus         7 ~~i~~YLlGSip~~~ii~k~--~g~DiR~~--GSgN~G   40 (194)
T PRK14393          7 LLVGAYLLGSIPTGLLLAKA--VGVDIRNT--GSGNIG   40 (194)
T ss_pred             HHHHHHHHHhhHHHHHHHHH--hCCCchhc--CCCCcc
Confidence            45678999999999998753  24466665  555543


No 96 
>PRK10927 essential cell division protein FtsN; Provisional
Probab=20.70  E-value=1.1e+02  Score=22.56  Aligned_cols=21  Identities=10%  Similarity=0.229  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHHhheec
Q psy15007         18 YIVLLTMLVVSCAIGFFVGMC   38 (68)
Q Consensus        18 ~~v~~~yl~~~~~iG~~~~~~   38 (68)
                      .+++++-++++++-|+||--.
T Consensus        36 m~alAvavlv~fiGGLyFith   56 (319)
T PRK10927         36 MVAIAAAVLVTFIGGLYFITH   56 (319)
T ss_pred             HHHHHHHHHHHHhhheEEEec
Confidence            566677777778889998744


No 97 
>PF14316 DUF4381:  Domain of unknown function (DUF4381)
Probab=20.52  E-value=83  Score=19.69  Aligned_cols=15  Identities=20%  Similarity=0.370  Sum_probs=5.7

Q ss_pred             HHHHHHHHHHHHHhh
Q psy15007         21 LLTMLVVSCAIGFFV   35 (68)
Q Consensus        21 ~~~yl~~~~~iG~~~   35 (68)
                      +++.+++.++..+|.
T Consensus        26 l~~lll~~~~~~~~~   40 (146)
T PF14316_consen   26 LLALLLLLLILLLWR   40 (146)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            333333333344443


No 98 
>KOG2348|consensus
Probab=20.11  E-value=65  Score=25.51  Aligned_cols=28  Identities=29%  Similarity=0.254  Sum_probs=21.4

Q ss_pred             CCcCCccceeecCCCCCHHHHHhhhhhc
Q psy15007         40 EKQTTSDDFLLGSSSMGTLPMALSLAAS   67 (68)
Q Consensus        40 ~~~~s~~dyflggr~m~~~~vglSl~AT   67 (68)
                      +..+++|+|-.+||++..-.++-.++++
T Consensus        38 ~e~~tsE~FtTA~rsVkTGLiasaVVSs   65 (667)
T KOG2348|consen   38 GEVQTSEHFTTASRSVKTGLIASAVVSS   65 (667)
T ss_pred             ccccchhhhcccccccccceehhhhhhh
Confidence            3467899999999999877777555543


Done!