Diaphorina citri psyllid: psy1500


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MSHLFSNSQALTPADFQGNLGLTTLNKHLTPVQGMGIEFFLGFVLVLVIFGVCDGNKPHAKAPAALAIGLTVALGHLAAF
ccccccccCECccccccccCCccccccccccHHHHHHHHHHHHHHHEEEEEEECccccccccccHHHHHHHHHHHHHHcc
********QALTPADFQGNLGLTTLNKHLTPVQGMGIEFFLGFVLVLVIFGVCDGNKPHAKAPAALAIGLTVALGHLAAF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHLFSNSQALTPADFQGNLGLTTLNKHLTPVQGMGIEFFLGFVLVLVIFGVCDGNKPHAKAPAALAIGLTVALGHLAAF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0022857 [MF]transmembrane transporter activityprobableGO:0005215, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IYZ, chain A
Confidence level:very confident
Coverage over the Query: 5-79
View the alignment between query and template
View the model in PyMOL