Query         psy15010
Match_columns 94
No_of_seqs    106 out of 566
Neff          4.7 
Searched_HMMs 46136
Date          Fri Aug 16 18:07:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15010.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15010hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3737|consensus               99.9 1.8E-24 3.9E-29  178.1   2.1   80   15-94     97-176 (603)
  2 KOG3738|consensus               99.9 8.2E-23 1.8E-27  168.2   3.6   78   17-94     68-145 (559)
  3 KOG3736|consensus               99.9 1.8E-22 3.9E-27  169.7   2.8   73   22-94     90-163 (578)
  4 TIGR03469 HonB hopene-associat  79.7     1.1 2.4E-05   35.4   1.6   23   69-92     36-58  (384)
  5 TIGR03111 glyc2_xrt_Gpos1 puta  74.7       2 4.3E-05   34.7   1.8   23   70-93     46-68  (439)
  6 cd06439 CESA_like_1 CESA_like_  70.5     2.5 5.5E-05   30.0   1.4   22   70-92     26-47  (251)
  7 TIGR03030 CelA cellulose synth  70.2     2.3 4.9E-05   36.9   1.2   24   69-92    127-150 (713)
  8 PRK11498 bcsA cellulose syntha  61.6     4.8  0.0001   36.3   1.6   24   70-93    257-280 (852)
  9 TIGR03472 HpnI hopanoid biosyn  55.8     8.8 0.00019   30.1   2.1   17   70-86     38-54  (373)
 10 COG1215 Glycosyltransferases,   55.3     6.9 0.00015   30.3   1.4   22   72-93     53-74  (439)
 11 PRK11204 N-glycosyltransferase  50.7     9.6 0.00021   29.9   1.5   22   70-92     51-72  (420)
 12 PRK14583 hmsR N-glycosyltransf  46.1      13 0.00029   29.9   1.7   21   71-92     73-93  (444)
 13 PRK13915 putative glucosyl-3-p  41.6      15 0.00033   28.6   1.3   17   71-87     29-45  (306)
 14 PTZ00260 dolichyl-phosphate be  41.1      22 0.00047   27.9   2.2   18   69-86     66-83  (333)
 15 KOG4387|consensus               30.3      35 0.00076   26.0   1.7   24   71-94    131-156 (191)
 16 COG4038 Predicted membrane pro  21.9      27 0.00059   23.3  -0.2   30   56-87     26-57  (87)
 17 COG3455 Type VI protein secret  20.3      58  0.0012   25.8   1.3   16   72-87    118-133 (262)
 18 PRK14716 bacteriophage N4 adso  20.2      73  0.0016   27.0   1.9   17   69-85     62-78  (504)

No 1  
>KOG3737|consensus
Probab=99.89  E-value=1.8e-24  Score=178.13  Aligned_cols=80  Identities=31%  Similarity=0.421  Sum_probs=74.1

Q ss_pred             ccCCCcccccCccccCCCCCCccCCCcchhhccccCCCCCCCCCCCcccccccCCCCCCCceEEEEeecCcchhhhcccC
Q psy15010         15 VRYFDESAYLEKGALRPGQDPYESNKYNQAASDNTPSNRDVPDTRHPACTRHALPRDLPATSVIITFHNEARSALLRSVV   94 (94)
Q Consensus        15 w~~~~~~~~l~~~~~~~~~~~~~~~~FN~~~Sd~I~l~R~lpD~R~~~C~~~~y~~~LP~aSVII~FhNEa~StLLRTv~   94 (94)
                      .++-+++..|++++....+..-+++|||+++||+||++|+++|+|+..|+...|+.+||++||||+||||.||||+||||
T Consensus        97 PGE~gkp~~l~pe~k~a~~AsekEfGfN~~~SDmISm~R~v~D~R~EECkhWdYpe~Lpt~SVviVFHNEGws~LmRTVH  176 (603)
T KOG3737|consen   97 PGEKGKPLVLGPEFKQAIQASEKEFGFNMVASDMISMDRNVNDLRQEECKHWDYPENLPTSSVVIVFHNEGWSTLMRTVH  176 (603)
T ss_pred             CCcCCcccccChhHHHHHHHHHHhhCcceeehhhhhcccCccccCHhhccccCCcccCCcceEEEEEecCccHHHHHHHH
Confidence            56667777888888877777888999999999999999999999999999999999999999999999999999999997


No 2  
>KOG3738|consensus
Probab=99.86  E-value=8.2e-23  Score=168.16  Aligned_cols=78  Identities=56%  Similarity=0.916  Sum_probs=76.4

Q ss_pred             CCCcccccCccccCCCCCCccCCCcchhhccccCCCCCCCCCCCcccccccCCCCCCCceEEEEeecCcchhhhcccC
Q psy15010         17 YFDESAYLEKGALRPGQDPYESNKYNQAASDNTPSNRDVPDTRHPACTRHALPRDLPATSVIITFHNEARSALLRSVV   94 (94)
Q Consensus        17 ~~~~~~~l~~~~~~~~~~~~~~~~FN~~~Sd~I~l~R~lpD~R~~~C~~~~y~~~LP~aSVII~FhNEa~StLLRTv~   94 (94)
                      +|+..+||+++....+++.|+.|.||+..||.+..+|.+||+||++|....|..+||.|||||+|||||.|+|||||+
T Consensus        68 ~fd~~~y~~~~~~~~Ged~y~~~~fnq~esd~l~~~r~i~dtRh~qC~~~~y~~dlp~TsviITfHNEARS~LLRTv~  145 (559)
T KOG3738|consen   68 TFDVEAYLNGGKWHQGEDPYKANSFNQEESDKLNPTRKIPDTRHPQCRDVDYKVDLPPTSVIITFHNEARSTLLRTVV  145 (559)
T ss_pred             CCCchhhhcCCCccCCCchhhcCccchhhhhhhCCCCccccccccccccceeecCCCCceEEEEeccHHHHHHHHHHH
Confidence            899999999999999999999999999999999999999999999999999999999999999999999999999973


No 3  
>KOG3736|consensus
Probab=99.85  E-value=1.8e-22  Score=169.69  Aligned_cols=73  Identities=44%  Similarity=0.666  Sum_probs=65.2

Q ss_pred             cccCccccCCCCCCccCCCcchhhccccCCCCCCCCCCCccccc-ccCCCCCCCceEEEEeecCcchhhhcccC
Q psy15010         22 AYLEKGALRPGQDPYESNKYNQAASDNTPSNRDVPDTRHPACTR-HALPRDLPATSVIITFHNEARSALLRSVV   94 (94)
Q Consensus        22 ~~l~~~~~~~~~~~~~~~~FN~~~Sd~I~l~R~lpD~R~~~C~~-~~y~~~LP~aSVII~FhNEa~StLLRTv~   94 (94)
                      ..++..+.+.++.+|++++||+++||+|+++|++||+|++.|+. ..|...||++||||+||||||||||||||
T Consensus        90 ~~~~~~~~~~~~~~~~~~~~N~~~Sd~I~l~Rsl~D~r~~~C~~~~~~~~~Lp~~Svii~f~nE~~s~llRtv~  163 (578)
T KOG3736|consen   90 VKLPEAEEDLEDEGYEKNAFNALLSDRISLNRSLPDLRHPECKKLKYYSDKLPTTSVIIIFHNEAWSTLLRTVH  163 (578)
T ss_pred             ccCCcchHHHHHHHhhcccchhhhhhcccccCCCcchhchhhhhccccccccCCCceEEEEecCCCcchhheEE
Confidence            44556667778888999999999999999999999999999988 45556799999999999999999999997


No 4  
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB. This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. Indeed, the members of this family appear to never be found in a genome lacking squalene-hopene cyclase (SHC), although not all genomes encoding SHC have this glycosyl transferase. In the organism Zymomonas mobilis the linkage of this gene to hopanoid biosynthesis has been noted and the gene named HpnB. Hopanoids are known to feature polar glycosyl head groups in many organisms.
Probab=79.73  E-value=1.1  Score=35.43  Aligned_cols=23  Identities=26%  Similarity=0.436  Sum_probs=17.8

Q ss_pred             CCCCCCceEEEEeecCcchhhhcc
Q psy15010         69 PRDLPATSVIITFHNEARSALLRS   92 (94)
Q Consensus        69 ~~~LP~aSVII~FhNEa~StLLRT   92 (94)
                      +...|++||||+.|||+ ..|-|+
T Consensus        36 ~~~~p~VSVIIpa~Ne~-~~L~~~   58 (384)
T TIGR03469        36 PEAWPAVVAVVPARNEA-DVIGEC   58 (384)
T ss_pred             CCCCCCEEEEEecCCcH-hHHHHH
Confidence            34689999999999998 445444


No 5  
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111. Members of this protein family probable glycosyltransferases of family 2, whose genes are near those for Gram-positive proteins (TIGR03110) related to the proposed exosortase (TIGR02602).
Probab=74.66  E-value=2  Score=34.71  Aligned_cols=23  Identities=26%  Similarity=0.514  Sum_probs=18.4

Q ss_pred             CCCCCceEEEEeecCcchhhhccc
Q psy15010         70 RDLPATSVIITFHNEARSALLRSV   93 (94)
Q Consensus        70 ~~LP~aSVII~FhNEa~StLLRTv   93 (94)
                      ..+|++||||.-|||+ .+|-+++
T Consensus        46 ~~~P~vsVIIP~yNe~-~~l~~~l   68 (439)
T TIGR03111        46 GKLPDITIIIPVYNSE-DTLFNCI   68 (439)
T ss_pred             CCCCCEEEEEEeCCCh-HHHHHHH
Confidence            4589999999999998 6665543


No 6  
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily.  CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains.  The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
Probab=70.48  E-value=2.5  Score=30.05  Aligned_cols=22  Identities=27%  Similarity=0.381  Sum_probs=16.9

Q ss_pred             CCCCCceEEEEeecCcchhhhcc
Q psy15010         70 RDLPATSVIITFHNEARSALLRS   92 (94)
Q Consensus        70 ~~LP~aSVII~FhNEa~StLLRT   92 (94)
                      ...|.+||||..|||. +.|.++
T Consensus        26 ~~~~~isVvip~~n~~-~~l~~~   47 (251)
T cd06439          26 AYLPTVTIIIPAYNEE-AVIEAK   47 (251)
T ss_pred             CCCCEEEEEEecCCcH-HHHHHH
Confidence            4588999999999996 444443


No 7  
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
Probab=70.20  E-value=2.3  Score=36.92  Aligned_cols=24  Identities=25%  Similarity=0.404  Sum_probs=19.0

Q ss_pred             CCCCCCceEEEEeecCcchhhhcc
Q psy15010         69 PRDLPATSVIITFHNEARSALLRS   92 (94)
Q Consensus        69 ~~~LP~aSVII~FhNEa~StLLRT   92 (94)
                      +..+|++||||.-|||+...+-+|
T Consensus       127 ~~~~P~VsViIP~yNE~~~iv~~t  150 (713)
T TIGR03030       127 PEEWPTVDVFIPTYNEDLEIVATT  150 (713)
T ss_pred             cccCCeeEEEEcCCCCCHHHHHHH
Confidence            356899999999999987655444


No 8  
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional
Probab=61.61  E-value=4.8  Score=36.33  Aligned_cols=24  Identities=13%  Similarity=0.241  Sum_probs=18.8

Q ss_pred             CCCCCceEEEEeecCcchhhhccc
Q psy15010         70 RDLPATSVIITFHNEARSALLRSV   93 (94)
Q Consensus        70 ~~LP~aSVII~FhNEa~StLLRTv   93 (94)
                      ...|++||||+-|||....+-+|+
T Consensus       257 ~~~P~VsViIPtYNE~~~vv~~tI  280 (852)
T PRK11498        257 SLWPTVDIFVPTYNEDLNVVKNTI  280 (852)
T ss_pred             CCCCcEEEEEecCCCcHHHHHHHH
Confidence            357999999999999876654443


No 9  
>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI. This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The member of this clade from Acidithiobacillus ferrooxidans ATCC 23270 (AFE_0974) is found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. Similarly, in Ralstonia eutropha JMP134 (Reut_B4902) this gene is adjacent to HpnAB, IspH and HpnH (TIGR03470), although SHC itself is elsewhere in the genome. Notably, this gene (here named HpnI) and three others form a conserved set (HpnIJKL) which occur in a subset of all genomes containing the SHC enzyme. This relationship was discerned using the method of partial phylogenetic profiling. This group includes Zymomonas mobilis, the organism where the initial hopano
Probab=55.84  E-value=8.8  Score=30.13  Aligned_cols=17  Identities=29%  Similarity=0.554  Sum_probs=14.6

Q ss_pred             CCCCCceEEEEeecCcc
Q psy15010         70 RDLPATSVIITFHNEAR   86 (94)
Q Consensus        70 ~~LP~aSVII~FhNEa~   86 (94)
                      ...|.+||||+-|||+-
T Consensus        38 ~~~p~VSViiP~~nee~   54 (373)
T TIGR03472        38 RAWPPVSVLKPLHGDEP   54 (373)
T ss_pred             CCCCCeEEEEECCCCCh
Confidence            44799999999999964


No 10 
>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane]
Probab=55.32  E-value=6.9  Score=30.30  Aligned_cols=22  Identities=41%  Similarity=0.487  Sum_probs=18.4

Q ss_pred             CCCceEEEEeecCcchhhhccc
Q psy15010         72 LPATSVIITFHNEARSALLRSV   93 (94)
Q Consensus        72 LP~aSVII~FhNEa~StLLRTv   93 (94)
                      +|.+||||.-|||...++-+|+
T Consensus        53 ~p~vsviiP~ynE~~~~~~~~l   74 (439)
T COG1215          53 LPKVSVIIPAYNEEPEVLEETL   74 (439)
T ss_pred             CCceEEEEecCCCchhhHHHHH
Confidence            7999999999999986665553


No 11 
>PRK11204 N-glycosyltransferase; Provisional
Probab=50.73  E-value=9.6  Score=29.89  Aligned_cols=22  Identities=18%  Similarity=0.463  Sum_probs=16.5

Q ss_pred             CCCCCceEEEEeecCcchhhhcc
Q psy15010         70 RDLPATSVIITFHNEARSALLRS   92 (94)
Q Consensus        70 ~~LP~aSVII~FhNEa~StLLRT   92 (94)
                      ...|.+||||+-|||. ..+-++
T Consensus        51 ~~~p~vsViIp~yne~-~~i~~~   72 (420)
T PRK11204         51 KEYPGVSILVPCYNEG-ENVEET   72 (420)
T ss_pred             CCCCCEEEEEecCCCH-HHHHHH
Confidence            3578999999999995 444433


No 12 
>PRK14583 hmsR N-glycosyltransferase; Provisional
Probab=46.14  E-value=13  Score=29.92  Aligned_cols=21  Identities=19%  Similarity=0.320  Sum_probs=16.3

Q ss_pred             CCCCceEEEEeecCcchhhhcc
Q psy15010         71 DLPATSVIITFHNEARSALLRS   92 (94)
Q Consensus        71 ~LP~aSVII~FhNEa~StLLRT   92 (94)
                      ..|.+||||.-|||+-. +.+|
T Consensus        73 ~~p~vsViIP~yNE~~~-i~~~   93 (444)
T PRK14583         73 GHPLVSILVPCFNEGLN-ARET   93 (444)
T ss_pred             CCCcEEEEEEeCCCHHH-HHHH
Confidence            47999999999999743 4443


No 13 
>PRK13915 putative glucosyl-3-phosphoglycerate synthase; Provisional
Probab=41.63  E-value=15  Score=28.56  Aligned_cols=17  Identities=24%  Similarity=0.231  Sum_probs=14.4

Q ss_pred             CCCCceEEEEeecCcch
Q psy15010         71 DLPATSVIITFHNEARS   87 (94)
Q Consensus        71 ~LP~aSVII~FhNEa~S   87 (94)
                      .-|.+||||..|||+-.
T Consensus        29 ~~~~vSVVIPayNee~~   45 (306)
T PRK13915         29 AGRTVSVVLPALNEEET   45 (306)
T ss_pred             CCCCEEEEEecCCcHHH
Confidence            46899999999999743


No 14 
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional
Probab=41.13  E-value=22  Score=27.88  Aligned_cols=18  Identities=22%  Similarity=0.137  Sum_probs=15.3

Q ss_pred             CCCCCCceEEEEeecCcc
Q psy15010         69 PRDLPATSVIITFHNEAR   86 (94)
Q Consensus        69 ~~~LP~aSVII~FhNEa~   86 (94)
                      ....|..||||..|||+-
T Consensus        66 ~~~~~~isVVIP~yNe~~   83 (333)
T PTZ00260         66 KDSDVDLSIVIPAYNEED   83 (333)
T ss_pred             CCCCeEEEEEEeeCCCHH
Confidence            456889999999999975


No 15 
>KOG4387|consensus
Probab=30.35  E-value=35  Score=26.05  Aligned_cols=24  Identities=42%  Similarity=0.612  Sum_probs=19.3

Q ss_pred             CCCCceEEEEee--cCcchhhhcccC
Q psy15010         71 DLPATSVIITFH--NEARSALLRSVV   94 (94)
Q Consensus        71 ~LP~aSVII~Fh--NEa~StLLRTv~   94 (94)
                      .|---+|+|||+  +|-...|+||.+
T Consensus       131 kl~~d~Vfi~F~K~R~dr~~Llrtfs  156 (191)
T KOG4387|consen  131 KLHVDKVFICFDKNREDRAALLRTFS  156 (191)
T ss_pred             hhccceEEEEEecCccChHhhhhheh
Confidence            466678999998  677899999964


No 16 
>COG4038 Predicted membrane protein [Function unknown]
Probab=21.94  E-value=27  Score=23.32  Aligned_cols=30  Identities=27%  Similarity=0.463  Sum_probs=20.3

Q ss_pred             CCCCCcccccccCCCCCCCceEEEEe--ecCcch
Q psy15010         56 PDTRHPACTRHALPRDLPATSVIITF--HNEARS   87 (94)
Q Consensus        56 pD~R~~~C~~~~y~~~LP~aSVII~F--hNEa~S   87 (94)
                      |..|+|-.+.  ....+|++-|-++|  |||+..
T Consensus        26 p~~~dpiv~~--LN~EiPtvGVSLIFLaYnh~LA   57 (87)
T COG4038          26 PARSDPVVKS--LNLELPTVGVSLIFLAYNHLLA   57 (87)
T ss_pred             CcccCcHHHH--hccccccceeeehHHHHHHHHH
Confidence            4455555443  34579998888888  899764


No 17 
>COG3455 Type VI protein secretion system component VasF [Intracellular    trafficking, secretion, and vesicular transport]
Probab=20.26  E-value=58  Score=25.79  Aligned_cols=16  Identities=38%  Similarity=0.630  Sum_probs=12.9

Q ss_pred             CCCceEEEEeecCcch
Q psy15010         72 LPATSVIITFHNEARS   87 (94)
Q Consensus        72 LP~aSVII~FhNEa~S   87 (94)
                      =+.-|.++.||||+|.
T Consensus       118 W~~~sLlv~fhne~~g  133 (262)
T COG3455         118 WARQSLLVHFHNEAWG  133 (262)
T ss_pred             cccCCeeeeeeccccc
Confidence            3457889999999984


No 18 
>PRK14716 bacteriophage N4 adsorption protein B; Provisional
Probab=20.15  E-value=73  Score=27.04  Aligned_cols=17  Identities=12%  Similarity=0.094  Sum_probs=14.9

Q ss_pred             CCCCCCceEEEEeecCc
Q psy15010         69 PRDLPATSVIITFHNEA   85 (94)
Q Consensus        69 ~~~LP~aSVII~FhNEa   85 (94)
                      ..+.|..+|||+-|||+
T Consensus        62 ~~~~p~vaIlIPA~NE~   78 (504)
T PRK14716         62 SVPEKRIAIFVPAWREA   78 (504)
T ss_pred             cCCCCceEEEEeccCch
Confidence            34689999999999997


Done!