BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15012
(1085 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3OTR|A Chain A, 2.75 Angstrom Crystal Structure Of Enolase 1 From
Toxoplasma Gondii
pdb|3OTR|B Chain B, 2.75 Angstrom Crystal Structure Of Enolase 1 From
Toxoplasma Gondii
pdb|3OTR|C Chain C, 2.75 Angstrom Crystal Structure Of Enolase 1 From
Toxoplasma Gondii
pdb|3OTR|D Chain D, 2.75 Angstrom Crystal Structure Of Enolase 1 From
Toxoplasma Gondii
pdb|3OTR|E Chain E, 2.75 Angstrom Crystal Structure Of Enolase 1 From
Toxoplasma Gondii
pdb|3OTR|F Chain F, 2.75 Angstrom Crystal Structure Of Enolase 1 From
Toxoplasma Gondii
Length = 452
Score = 31.6 bits (70), Expect = 2.8, Method: Compositional matrix adjust.
Identities = 15/41 (36%), Positives = 22/41 (53%)
Query: 773 INIKCKKINSYGHITGEEYKNGKEMWIKYIQHVSFSSTIDQ 813
++ KCK N+ H+TGE+ K E W+K +S DQ
Sbjct: 268 LDYKCKTKNASKHLTGEKLKEVYEGWLKKYPIISVEDPFDQ 308
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.137 0.422
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 31,767,493
Number of Sequences: 62578
Number of extensions: 1328160
Number of successful extensions: 2553
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2550
Number of HSP's gapped (non-prelim): 4
length of query: 1085
length of database: 14,973,337
effective HSP length: 109
effective length of query: 976
effective length of database: 8,152,335
effective search space: 7956678960
effective search space used: 7956678960
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 57 (26.6 bits)