Query         psy15014
Match_columns 286
No_of_seqs    197 out of 1153
Neff          6.1 
Searched_HMMs 46136
Date          Fri Aug 16 18:13:43 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15014.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15014hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4280|consensus              100.0 1.1E-41 2.4E-46  338.3  11.8  156    1-282    92-247 (574)
  2 cd01373 KISc_KLP2_like Kinesin 100.0 5.4E-40 1.2E-44  311.7  20.0  164    1-283    81-246 (337)
  3 cd01370 KISc_KIP3_like Kinesin 100.0 8.3E-40 1.8E-44  310.5  18.9  154    1-282    94-247 (338)
  4 cd01368 KISc_KIF23_like Kinesi 100.0 2.3E-39 5.1E-44  308.3  18.9  157    1-283    95-254 (345)
  5 KOG0245|consensus              100.0 2.1E-40 4.6E-45  338.9   9.8  161    1-283    94-254 (1221)
  6 KOG0243|consensus              100.0 4.2E-40 9.2E-45  340.5  10.3  166    1-282   135-302 (1041)
  7 cd01367 KISc_KIF2_like Kinesin 100.0 7.6E-39 1.6E-43  302.0  16.7  146    1-283    91-236 (322)
  8 cd01365 KISc_KIF1A_KIF1B Kines 100.0 3.8E-38 8.2E-43  300.9  19.1  160    1-283    95-254 (356)
  9 cd01375 KISc_KIF9_like Kinesin 100.0   7E-38 1.5E-42  296.8  19.8  162    1-283    87-248 (334)
 10 PLN03188 kinesin-12 family pro 100.0 4.1E-38 8.9E-43  329.1  19.4  167    1-283   172-342 (1320)
 11 cd01372 KISc_KIF4 Kinesin moto 100.0 1.4E-37 3.1E-42  294.7  19.4  165    1-282    80-249 (341)
 12 cd01374 KISc_CENP_E Kinesin mo 100.0 2.5E-37 5.4E-42  291.2  19.1  154    1-283    80-233 (321)
 13 cd01371 KISc_KIF3 Kinesin moto 100.0 3.5E-37 7.6E-42  291.8  19.2  157    1-282    88-244 (333)
 14 cd01376 KISc_KID_like Kinesin  100.0 2.8E-37 6.1E-42  290.9  18.1  147    1-282    87-233 (319)
 15 KOG0242|consensus              100.0 2.7E-38 5.8E-43  322.5  12.0  150    1-283    93-242 (675)
 16 cd01369 KISc_KHC_KIF5 Kinesin  100.0 3.4E-37 7.4E-42  290.5  18.6  154    1-282    83-236 (325)
 17 KOG0240|consensus              100.0 5.8E-38 1.2E-42  307.0  11.7  154    1-282    89-242 (607)
 18 cd01364 KISc_BimC_Eg5 Kinesin  100.0 8.9E-37 1.9E-41  290.8  19.5  161    1-282    88-255 (352)
 19 KOG0247|consensus              100.0 7.4E-38 1.6E-42  312.9  10.0   87  193-282   257-343 (809)
 20 cd01366 KISc_C_terminal Kinesi 100.0 3.2E-36 6.9E-41  284.2  19.2  156    1-283    84-239 (329)
 21 PF00225 Kinesin:  Kinesin moto 100.0 4.8E-36   1E-40  282.9  13.0  163    1-282    81-244 (335)
 22 smart00129 KISc Kinesin motor, 100.0 9.8E-35 2.1E-39  274.4  19.1  154    1-283    86-239 (335)
 23 cd00106 KISc Kinesin motor dom 100.0 1.1E-34 2.4E-39  272.8  19.4  157    1-283    85-241 (328)
 24 KOG0239|consensus              100.0 2.7E-35 5.8E-40  299.9  11.7  154    1-282   399-552 (670)
 25 KOG0246|consensus              100.0 1.5E-34 3.2E-39  283.0  14.7  155    1-283   298-452 (676)
 26 KOG0241|consensus              100.0 1.4E-33   3E-38  286.1  10.5  159    1-283   100-258 (1714)
 27 COG5059 KIP1 Kinesin-like prot 100.0 7.7E-30 1.7E-34  257.1  11.9  152    1-283    96-247 (568)
 28 KOG0244|consensus              100.0 8.4E-31 1.8E-35  268.2  -3.5  157    1-283    72-228 (913)
 29 cd01363 Motor_domain Myosin an  99.9 1.4E-21   3E-26  171.0   8.6   62  219-282    58-119 (186)
 30 COG0556 UvrB Helicase subunit   94.2    0.05 1.1E-06   55.3   4.0   58    2-70     39-100 (663)
 31 PF01935 DUF87:  Domain of unkn  88.5    0.13 2.9E-06   45.6  -0.1   13    1-13     29-41  (229)
 32 cd00046 DEXDc DEAD-like helica  87.9    0.16 3.4E-06   39.4   0.0   14    1-14      6-19  (144)
 33 COG5059 KIP1 Kinesin-like prot  86.4   0.004 8.7E-08   63.8 -12.5   51  225-283   486-536 (568)
 34 PF04851 ResIII:  Type III rest  85.7    0.21 4.5E-06   41.6  -0.4   13    2-14     32-44  (184)
 35 COG2804 PulE Type II secretory  85.0    0.29 6.2E-06   49.5   0.1   13    2-14    265-277 (500)
 36 smart00382 AAA ATPases associa  83.3    0.34 7.4E-06   37.4  -0.2   13    1-13      8-20  (148)
 37 COG2805 PilT Tfp pilus assembl  80.8    0.54 1.2E-05   45.0   0.2   12    2-13    132-143 (353)
 38 PRK06620 hypothetical protein;  80.6    0.49 1.1E-05   42.4  -0.1   14    1-14     50-63  (214)
 39 PRK08727 hypothetical protein;  79.1    0.62 1.3E-05   42.1   0.0   14    1-14     47-60  (233)
 40 cd01131 PilT Pilus retraction   79.0    0.64 1.4E-05   40.8   0.1   12    2-13      8-19  (198)
 41 PF12846 AAA_10:  AAA-like doma  78.4    0.68 1.5E-05   41.7   0.0   12    2-13      8-19  (304)
 42 PF13245 AAA_19:  Part of AAA d  78.0    0.73 1.6E-05   34.6   0.1   12    2-13     17-28  (76)
 43 PRK06893 DNA replication initi  77.9    0.72 1.6E-05   41.5   0.0   14    1-14     45-58  (229)
 44 cd00009 AAA The AAA+ (ATPases   77.3    0.72 1.6E-05   36.0  -0.1   13    1-13     25-37  (151)
 45 PF00448 SRP54:  SRP54-type pro  76.5    0.73 1.6E-05   40.8  -0.3   12    2-13      8-19  (196)
 46 PRK08084 DNA replication initi  75.5    0.86 1.9E-05   41.2  -0.1   14    1-14     51-64  (235)
 47 PRK05642 DNA replication initi  74.8    0.96 2.1E-05   40.9   0.0   14    1-14     51-64  (234)
 48 PF13401 AAA_22:  AAA domain; P  74.7     0.7 1.5E-05   36.7  -0.8   13    1-13     10-22  (131)
 49 TIGR01420 pilT_fam pilus retra  74.7    0.99 2.1E-05   43.2   0.1   12    2-13    129-140 (343)
 50 PRK09087 hypothetical protein;  74.3    0.96 2.1E-05   40.8  -0.1   13    1-13     50-62  (226)
 51 PF00308 Bac_DnaA:  Bacterial d  74.3    0.79 1.7E-05   41.1  -0.7   14    1-14     40-53  (219)
 52 COG1474 CDC6 Cdc6-related prot  73.9       1 2.3E-05   43.8   0.0   12    1-12     48-59  (366)
 53 PRK10436 hypothetical protein;  73.9     1.1 2.4E-05   45.0   0.2   12    2-13    225-236 (462)
 54 TIGR02524 dot_icm_DotB Dot/Icm  73.6     1.1 2.4E-05   43.4   0.1   12    2-13    141-152 (358)
 55 PF00004 AAA:  ATPase family as  73.1       1 2.2E-05   35.5  -0.3   42    1-42      4-56  (132)
 56 TIGR02525 plasmid_TraJ plasmid  72.9     1.2 2.6E-05   43.5   0.1   12    2-13    156-167 (372)
 57 PF13479 AAA_24:  AAA domain     72.7     1.2 2.5E-05   39.7  -0.0   13    1-13      9-21  (213)
 58 PF00437 T2SE:  Type II/IV secr  72.3     1.1 2.3E-05   40.9  -0.3   12    2-13    134-145 (270)
 59 PF13086 AAA_11:  AAA domain; P  72.1     1.2 2.6E-05   38.3  -0.1   12    2-13     24-35  (236)
 60 TIGR02538 type_IV_pilB type IV  71.4     1.4 2.9E-05   45.3   0.1   12    2-13    323-334 (564)
 61 TIGR03420 DnaA_homol_Hda DnaA   70.6     1.3 2.9E-05   38.7  -0.1   13    1-13     44-56  (226)
 62 PRK06526 transposase; Provisio  70.1     1.3 2.9E-05   40.8  -0.2   14    1-14    104-117 (254)
 63 PF01695 IstB_IS21:  IstB-like   69.8     1.2 2.6E-05   38.7  -0.5   14    1-14     53-66  (178)
 64 TIGR02533 type_II_gspE general  69.7     1.5 3.3E-05   44.2   0.1   12    2-13    249-260 (486)
 65 PRK06835 DNA replication prote  69.4     1.4 3.1E-05   42.2  -0.1   14    1-14    189-202 (329)
 66 cd01129 PulE-GspE PulE/GspE Th  69.2     1.6 3.5E-05   40.4   0.1   12    2-13     87-98  (264)
 67 cd01130 VirB11-like_ATPase Typ  69.2     1.6 3.4E-05   37.8   0.1   11    2-12     32-42  (186)
 68 TIGR00362 DnaA chromosomal rep  69.1     1.5 3.2E-05   42.7  -0.2   13    1-13    142-154 (405)
 69 TIGR03499 FlhF flagellar biosy  68.8     1.7 3.6E-05   40.6   0.1   14    1-14    200-213 (282)
 70 PRK06921 hypothetical protein;  68.0     1.5 3.4E-05   40.5  -0.2   14    1-14    123-136 (266)
 71 KOG2543|consensus               67.5     1.8 3.8E-05   42.8  -0.0   13    1-13     36-48  (438)
 72 PRK12377 putative replication   67.1     1.7 3.7E-05   40.0  -0.1   14    1-14    107-120 (248)
 73 PRK00149 dnaA chromosomal repl  67.1     1.7 3.7E-05   43.0  -0.1   13    1-13    154-166 (450)
 74 PF01580 FtsK_SpoIIIE:  FtsK/Sp  67.0     1.5 3.2E-05   38.2  -0.6   14    1-14     44-57  (205)
 75 smart00487 DEXDc DEAD-like hel  66.9       2 4.4E-05   35.3   0.3   13    2-14     31-43  (201)
 76 PRK13833 conjugal transfer pro  66.0       2 4.4E-05   41.2   0.1   12    2-13    151-162 (323)
 77 PF00910 RNA_helicase:  RNA hel  65.9     1.8   4E-05   34.1  -0.2   13    1-13      4-16  (107)
 78 PRK14088 dnaA chromosomal repl  65.9     1.9   4E-05   42.9  -0.2   13    1-13    136-148 (440)
 79 COG0593 DnaA ATPase involved i  65.8     1.9 4.2E-05   42.7  -0.1   13    1-13    119-131 (408)
 80 PRK08903 DnaA regulatory inact  65.7       2 4.4E-05   38.0   0.0   13    1-13     48-60  (227)
 81 PRK13851 type IV secretion sys  64.9     2.1 4.6E-05   41.3   0.0   11    2-12    169-179 (344)
 82 COG1125 OpuBA ABC-type proline  64.9     2.3 4.9E-05   40.1   0.2   11    2-12     34-44  (309)
 83 PF05673 DUF815:  Protein of un  64.6     3.4 7.3E-05   38.4   1.3   49  203-252   110-159 (249)
 84 PRK08116 hypothetical protein;  64.6     2.1 4.5E-05   39.7  -0.1   13    1-13    120-132 (268)
 85 KOG0953|consensus               64.5     7.7 0.00017   40.1   3.8   42    2-43    198-239 (700)
 86 TIGR02928 orc1/cdc6 family rep  63.1     2.3 5.1E-05   40.2  -0.1   12    1-12     46-57  (365)
 87 TIGR02782 TrbB_P P-type conjug  63.0     2.5 5.4E-05   39.9   0.1   12    2-13    139-150 (299)
 88 PRK15483 type III restriction-  62.3     3.5 7.6E-05   45.1   1.1   12    3-14     67-78  (986)
 89 PRK12723 flagellar biosynthesi  62.2     2.4 5.3E-05   41.6  -0.1   13    1-13    180-192 (388)
 90 TIGR03015 pepcterm_ATPase puta  62.1     2.4 5.3E-05   38.1  -0.2   13    1-13     49-61  (269)
 91 cd01120 RecA-like_NTPases RecA  61.9     2.6 5.7E-05   33.9   0.0   13    1-13      5-17  (165)
 92 PRK08181 transposase; Validate  61.7     2.5 5.3E-05   39.5  -0.2   14    1-14    112-125 (269)
 93 PRK00411 cdc6 cell division co  61.7     2.5 5.5E-05   40.4  -0.1   12    1-12     61-72  (394)
 94 PRK08939 primosomal protein Dn  61.6     2.5 5.5E-05   40.0  -0.1   14    1-14    162-175 (306)
 95 PF07724 AAA_2:  AAA domain (Cd  61.3     2.4 5.3E-05   36.6  -0.3   12    1-12      9-20  (171)
 96 PF06309 Torsin:  Torsin;  Inte  61.3     2.9 6.3E-05   34.9   0.2   11    2-12     60-70  (127)
 97 PF00270 DEAD:  DEAD/DEAH box h  61.1     2.8 6.1E-05   34.5   0.1   13    2-14     21-33  (169)
 98 PRK12402 replication factor C   61.0     2.7 5.8E-05   39.1  -0.1   12    1-12     42-53  (337)
 99 PF13555 AAA_29:  P-loop contai  60.9     2.6 5.7E-05   30.8  -0.1   12    1-12     29-40  (62)
100 PRK14087 dnaA chromosomal repl  60.7     2.7 5.8E-05   42.0  -0.1   14    1-14    147-160 (450)
101 TIGR02881 spore_V_K stage V sp  60.7     2.7 5.9E-05   38.3  -0.1   12    1-12     48-59  (261)
102 TIGR00631 uvrb excinuclease AB  60.6     8.4 0.00018   40.4   3.5   59    1-70     35-97  (655)
103 PRK14722 flhF flagellar biosyn  60.4     2.8 6.1E-05   41.0  -0.1   13    1-13    143-155 (374)
104 PRK13900 type IV secretion sys  60.3       3 6.5E-05   40.0   0.1   12    2-13    167-178 (332)
105 COG1419 FlhF Flagellar GTP-bin  59.7     3.2 6.8E-05   41.1   0.2   11    2-12    210-220 (407)
106 PF13207 AAA_17:  AAA domain; P  59.5     2.8   6E-05   32.9  -0.2   12    1-12      5-16  (121)
107 PRK13894 conjugal transfer ATP  59.4     3.1 6.8E-05   39.7   0.1   12    2-13    155-166 (319)
108 PRK09183 transposase/IS protei  59.3       3 6.5E-05   38.4  -0.1   13    1-13    108-120 (259)
109 COG1484 DnaC DNA replication p  59.3       3 6.6E-05   38.4  -0.0   14    1-14    111-124 (254)
110 PF02456 Adeno_IVa2:  Adenoviru  59.1       3 6.5E-05   40.2  -0.1   12    1-12     93-104 (369)
111 COG5008 PilU Tfp pilus assembl  59.0     3.8 8.2E-05   39.0   0.5   11    2-12    134-144 (375)
112 PF07728 AAA_5:  AAA domain (dy  58.3     2.6 5.6E-05   34.1  -0.6   13    1-13      5-17  (139)
113 PF13191 AAA_16:  AAA ATPase do  57.5     3.3 7.1E-05   34.6  -0.2   12    1-12     30-41  (185)
114 PF13604 AAA_30:  AAA domain; P  57.3     3.1 6.7E-05   36.5  -0.3   12    2-13     25-36  (196)
115 cd02025 PanK Pantothenate kina  56.9     3.7 7.9E-05   36.9   0.1   12    2-13      6-17  (220)
116 cd02023 UMPK Uridine monophosp  56.3     3.8 8.3E-05   35.4   0.1   12    2-13      6-17  (198)
117 PF13238 AAA_18:  AAA domain; P  55.8     3.6 7.8E-05   32.1  -0.2   12    1-12      4-15  (129)
118 KOG0989|consensus               55.5     4.1 8.8E-05   39.2   0.1   12    1-12     63-74  (346)
119 PF00580 UvrD-helicase:  UvrD/R  55.2     3.4 7.3E-05   37.4  -0.4   13    2-14     20-32  (315)
120 PF13476 AAA_23:  AAA domain; P  54.9     3.1 6.8E-05   35.0  -0.7   12    1-12     25-36  (202)
121 PRK06995 flhF flagellar biosyn  54.8     4.2   9E-05   41.2   0.1   12    2-13    263-274 (484)
122 PRK12422 chromosomal replicati  54.5     3.9 8.5E-05   40.8  -0.1   13    1-13    147-159 (445)
123 cd03274 ABC_SMC4_euk Eukaryoti  54.3     4.4 9.6E-05   36.0   0.2   12    1-12     31-42  (212)
124 PRK07952 DNA replication prote  54.1       4 8.7E-05   37.5  -0.1   14    1-14    105-118 (244)
125 COG1219 ClpX ATP-dependent pro  53.3     4.9 0.00011   39.0   0.3   11    2-12    104-114 (408)
126 PRK13764 ATPase; Provisional    53.1     4.6 9.9E-05   42.0   0.1   12    2-13    264-275 (602)
127 TIGR00348 hsdR type I site-spe  53.0     4.6 9.9E-05   42.3   0.1   11    3-13    271-281 (667)
128 TIGR01242 26Sp45 26S proteasom  52.7     4.5 9.7E-05   38.8  -0.1   12    1-12    162-173 (364)
129 COG1223 Predicted ATPase (AAA+  52.6     4.7  0.0001   38.3   0.0   42    1-42    157-209 (368)
130 COG3842 PotA ABC-type spermidi  52.5     4.8  0.0001   39.2   0.1   11    2-12     38-48  (352)
131 PF06414 Zeta_toxin:  Zeta toxi  51.9     5.1 0.00011   34.9   0.2   12    2-13     22-33  (199)
132 TIGR01618 phage_P_loop phage n  51.6     4.6  0.0001   36.6  -0.2   13    1-13     18-30  (220)
133 KOG1803|consensus               51.2     6.1 0.00013   41.0   0.6   12    2-13    208-219 (649)
134 PRK05703 flhF flagellar biosyn  51.1     5.3 0.00011   39.6   0.1   13    1-13    227-239 (424)
135 PRK14086 dnaA chromosomal repl  50.7       5 0.00011   41.8  -0.1   13    1-13    320-332 (617)
136 PRK08233 hypothetical protein;  49.2       6 0.00013   33.2   0.2   11    2-12     10-20  (182)
137 PHA02544 44 clamp loader, smal  49.2     5.6 0.00012   36.9   0.0   12    1-12     49-60  (316)
138 cd00820 PEPCK_HprK Phosphoenol  48.9       6 0.00013   31.9   0.1   13    1-13     21-33  (107)
139 PF13671 AAA_33:  AAA domain; P  48.6     5.5 0.00012   32.0  -0.2   12    1-12      5-16  (143)
140 PF13173 AAA_14:  AAA domain     48.5     5.7 0.00012   32.0  -0.1   13    1-13      8-20  (128)
141 PLN03025 replication factor C   48.2     5.8 0.00013   37.3  -0.1   13    1-13     40-52  (319)
142 PRK14721 flhF flagellar biosyn  47.8     6.3 0.00014   39.2   0.1   11    2-12    198-208 (420)
143 PRK11545 gntK gluconate kinase  47.5     6.6 0.00014   33.3   0.2   12    1-12      1-12  (163)
144 KOG0926|consensus               47.3     9.6 0.00021   41.1   1.3   37    2-39    278-323 (1172)
145 PRK00080 ruvB Holliday junctio  47.2       6 0.00013   37.3  -0.1   12    1-12     57-68  (328)
146 PF05729 NACHT:  NACHT domain    47.0     6.4 0.00014   31.9   0.0   13    1-13      6-18  (166)
147 PF00485 PRK:  Phosphoribulokin  47.0     5.9 0.00013   34.3  -0.2   11    2-12      6-16  (194)
148 TIGR00635 ruvB Holliday juncti  46.4     6.3 0.00014   36.3  -0.1   12    1-12     36-47  (305)
149 CHL00181 cbbX CbbX; Provisiona  46.0     6.7 0.00015   36.7  -0.0   12    1-12     65-76  (287)
150 COG3839 MalK ABC-type sugar tr  45.9     7.1 0.00015   37.8   0.1   11    2-12     36-46  (338)
151 TIGR02880 cbbX_cfxQ probable R  45.3     6.7 0.00015   36.6  -0.1   12    1-12     64-75  (284)
152 PF12774 AAA_6:  Hydrolytic ATP  45.1     6.5 0.00014   35.8  -0.3   41    1-42     38-84  (231)
153 TIGR00376 DNA helicase, putati  45.0     6.6 0.00014   41.0  -0.3   13    1-13    179-191 (637)
154 PRK11889 flhF flagellar biosyn  44.5     7.5 0.00016   38.8   0.0   12    2-13    248-259 (436)
155 TIGR02788 VirB11 P-type DNA tr  44.2     7.7 0.00017   36.5   0.1   11    2-12    151-161 (308)
156 cd01127 TrwB Bacterial conjuga  44.2     7.4 0.00016   38.1  -0.0   12    1-12     48-59  (410)
157 PF01637 Arch_ATPase:  Archaeal  43.9       6 0.00013   34.0  -0.7   12    1-12     26-37  (234)
158 TIGR02322 phosphon_PhnN phosph  43.8     7.9 0.00017   32.7   0.1   11    2-12      8-18  (179)
159 PRK03992 proteasome-activating  43.6     7.8 0.00017   37.8   0.0   41    1-41    171-222 (389)
160 PRK05480 uridine/cytidine kina  43.5       8 0.00017   33.7   0.1   11    2-12     13-23  (209)
161 PF03215 Rad17:  Rad17 cell cyc  43.4     7.6 0.00016   39.6  -0.1   12    1-12     51-62  (519)
162 PTZ00301 uridine kinase; Provi  43.3     8.4 0.00018   34.5   0.2   11    2-12     10-20  (210)
163 PRK00440 rfc replication facto  43.0     7.7 0.00017   35.7  -0.1   12    1-12     44-55  (319)
164 PRK11448 hsdR type I restricti  42.9     7.5 0.00016   43.3  -0.3   13    2-14    440-452 (1123)
165 TIGR01241 FtsH_fam ATP-depende  42.7     7.9 0.00017   38.9  -0.1   12    1-12     94-105 (495)
166 PRK12726 flagellar biosynthesi  42.7     8.5 0.00018   38.1   0.1   13    1-13    212-224 (407)
167 PF10236 DAP3:  Mitochondrial r  42.6     8.1 0.00017   36.6  -0.1   13    1-13     29-41  (309)
168 TIGR00595 priA primosomal prot  42.5     8.2 0.00018   39.1  -0.0   13    1-13      3-15  (505)
169 COG1131 CcmA ABC-type multidru  42.4     8.5 0.00018   36.1   0.1   11    2-12     38-48  (293)
170 cd03279 ABC_sbcCD SbcCD and ot  41.7     9.1  0.0002   33.7   0.2   12    1-12     34-45  (213)
171 PRK06547 hypothetical protein;  41.6     8.7 0.00019   33.2   0.0   12    1-12     21-32  (172)
172 PRK10416 signal recognition pa  41.5     8.9 0.00019   36.6   0.1   12    2-13    121-132 (318)
173 KOG0335|consensus               41.5      11 0.00024   38.1   0.8   13    2-14    118-130 (482)
174 PRK14723 flhF flagellar biosyn  41.4     9.2  0.0002   40.9   0.2   12    1-12    191-202 (767)
175 PTZ00112 origin recognition co  41.4     8.4 0.00018   42.2  -0.1   12    1-12    787-798 (1164)
176 TIGR01313 therm_gnt_kin carboh  41.3     9.6 0.00021   31.7   0.2   10    2-11      5-14  (163)
177 PRK07261 topology modulation p  41.2     9.6 0.00021   32.6   0.2   11    2-12      7-17  (171)
178 PF01745 IPT:  Isopentenyl tran  40.9       8 0.00017   35.5  -0.3   12    1-12      7-18  (233)
179 PF05872 DUF853:  Bacterial pro  40.6      11 0.00024   38.1   0.5   11    2-12     26-36  (502)
180 TIGR00064 ftsY signal recognit  40.6     9.3  0.0002   35.5   0.0   12    2-13     79-90  (272)
181 cd00880 Era_like Era (E. coli   40.1     9.8 0.00021   29.7   0.1   12    2-13      3-14  (163)
182 TIGR00554 panK_bact pantothena  39.8     9.9 0.00021   35.9   0.1   11    2-12     69-79  (290)
183 COG1136 SalX ABC-type antimicr  39.7     9.9 0.00022   34.7   0.1   19  212-230   174-192 (226)
184 PTZ00361 26 proteosome regulat  39.6     9.3  0.0002   38.2  -0.1   41    1-41    223-274 (438)
185 COG4962 CpaF Flp pilus assembl  39.5     9.9 0.00021   37.0   0.0   14   62-75    254-267 (355)
186 TIGR02746 TraC-F-type type-IV   39.1      10 0.00022   40.1   0.1   12    2-13    437-448 (797)
187 cd02020 CMPK Cytidine monophos  38.8      11 0.00024   30.2   0.2   12    1-12      5-16  (147)
188 TIGR00176 mobB molybdopterin-g  38.4      11 0.00023   32.0   0.1   12    2-13      6-17  (155)
189 TIGR00235 udk uridine kinase.   38.4      11 0.00023   33.0   0.1   11    2-12     13-23  (207)
190 cd02021 GntK Gluconate kinase   38.3      11 0.00024   30.8   0.1   12    1-12      5-16  (150)
191 COG0610 Type I site-specific r  38.2      10 0.00022   41.6  -0.1   10    4-13    282-291 (962)
192 PTZ00454 26S protease regulato  38.1      10 0.00022   37.3  -0.1   41    1-41    185-236 (398)
193 PRK00771 signal recognition pa  38.0      10 0.00023   37.8  -0.1   13    1-13    101-113 (437)
194 cd03240 ABC_Rad50 The catalyti  37.9      10 0.00022   33.4  -0.1   12    1-12     28-39  (204)
195 PRK14974 cell division protein  37.7      11 0.00024   36.3   0.1   12    2-13    147-158 (336)
196 cd01124 KaiC KaiC is a circadi  37.1      11 0.00024   31.6   0.0   12    1-12      5-16  (187)
197 PF02702 KdpD:  Osmosensitive K  37.1      11 0.00023   34.2  -0.2   12    3-14     13-24  (211)
198 PRK00300 gmk guanylate kinase;  37.0      12 0.00026   32.3   0.1   11    2-12     12-22  (205)
199 PF13304 AAA_21:  AAA domain; P  36.8      11 0.00025   31.6   0.0   12    1-12      5-16  (303)
200 PRK06217 hypothetical protein;  36.7      12 0.00027   32.0   0.2   11    2-12      8-18  (183)
201 TIGR02237 recomb_radB DNA repa  36.7      12 0.00026   32.5   0.1   12    1-12     18-29  (209)
202 cd01126 TraG_VirD4 The TraG/Tr  36.4      15 0.00032   35.5   0.7   13    1-13      5-17  (384)
203 PF07693 KAP_NTPase:  KAP famil  36.3      12 0.00025   34.7  -0.1   42    1-42     26-83  (325)
204 TIGR00929 VirB4_CagE type IV s  36.2      12 0.00026   39.4   0.1   11    2-12    441-451 (785)
205 COG0630 VirB11 Type IV secreto  36.0      12 0.00027   35.5   0.1   12    2-13    150-161 (312)
206 TIGR02173 cyt_kin_arch cytidyl  36.0      12 0.00026   31.0   0.0   12    1-12      6-17  (171)
207 PTZ00424 helicase 45; Provisio  36.0      12 0.00025   35.8  -0.1   11    2-12     72-82  (401)
208 PF02562 PhoH:  PhoH-like prote  36.0      14  0.0003   33.2   0.4   13    1-13     25-37  (205)
209 PRK10536 hypothetical protein;  35.9      13 0.00028   34.8   0.2   13    1-13     80-92  (262)
210 cd03272 ABC_SMC3_euk Eukaryoti  35.8      13 0.00028   33.1   0.2   11    2-12     30-40  (243)
211 PRK10078 ribose 1,5-bisphospho  35.3      13 0.00028   32.0   0.1   11    2-12      9-19  (186)
212 PRK13909 putative recombinatio  35.2      12 0.00027   40.6  -0.1   10    4-13      7-16  (910)
213 TIGR00231 small_GTP small GTP-  35.2      12 0.00026   29.2  -0.1   12    1-12      7-18  (161)
214 PF02463 SMC_N:  RecF/RecN/SMC   35.1      11 0.00024   33.0  -0.4   12    1-12     30-41  (220)
215 cd01983 Fer4_NifH The Fer4_Nif  35.1      12 0.00026   27.1  -0.1   14    1-14      5-18  (99)
216 cd03242 ABC_RecF RecF is a rec  35.0      12 0.00027   34.3  -0.1   12    1-12     27-38  (270)
217 cd03238 ABC_UvrA The excision   35.0      13 0.00028   32.2   0.1   11    2-12     28-38  (176)
218 PHA00729 NTP-binding motif con  34.9      13 0.00028   34.0   0.0   13    1-13     23-35  (226)
219 TIGR03689 pup_AAA proteasome A  34.6      13 0.00028   37.9  -0.0   12    1-12    222-233 (512)
220 smart00488 DEXDc2 DEAD-like he  34.2      13 0.00029   34.7   0.0   13    2-14     34-46  (289)
221 smart00489 DEXDc3 DEAD-like he  34.2      13 0.00029   34.7   0.0   13    2-14     34-46  (289)
222 PRK14729 miaA tRNA delta(2)-is  34.2      15 0.00033   34.9   0.3   11    2-12     11-21  (300)
223 PF05707 Zot:  Zonular occluden  34.1      13 0.00027   32.4  -0.2   13    1-13      6-18  (193)
224 PF12775 AAA_7:  P-loop contain  34.1      14  0.0003   34.4   0.1   13    1-13     39-51  (272)
225 COG1118 CysA ABC-type sulfate/  34.0      14 0.00029   35.7   0.0   12    1-12     34-45  (345)
226 TIGR03744 traC_PFL_4706 conjug  33.9      14  0.0003   40.2   0.0   12    1-12    481-492 (893)
227 PRK11784 tRNA 2-selenouridine   33.9      14  0.0003   35.8   0.0   12    1-12    147-158 (345)
228 cd03278 ABC_SMC_barmotin Barmo  33.8      13 0.00028   32.6  -0.2   12    1-12     28-39  (197)
229 TIGR00609 recB exodeoxyribonuc  33.7      13 0.00028   41.3  -0.2   38  161-204   301-339 (1087)
230 PRK12724 flagellar biosynthesi  33.7      14 0.00031   36.9   0.1   12    2-13    230-241 (432)
231 PRK12727 flagellar biosynthesi  33.6      14 0.00031   38.0   0.1   12    2-13    357-368 (559)
232 PF04665 Pox_A32:  Poxvirus A32  33.4      15 0.00032   33.9   0.1   12    2-13     20-31  (241)
233 cd00268 DEADc DEAD-box helicas  33.4      14 0.00031   31.5   0.1   11    2-12     43-53  (203)
234 TIGR01188 drrA daunorubicin re  33.3      15 0.00032   34.3   0.1   11    2-12     26-36  (302)
235 cd02019 NK Nucleoside/nucleoti  33.2      15 0.00032   26.6   0.1   11    2-12      6-16  (69)
236 PRK09270 nucleoside triphospha  33.1      15 0.00032   32.8   0.1   11    2-12     40-50  (229)
237 PRK00131 aroK shikimate kinase  33.1      14 0.00031   30.4   0.0   12    1-12     10-21  (175)
238 cd03225 ABC_cobalt_CbiO_domain  32.9      15 0.00032   31.9   0.1   11    2-12     34-44  (211)
239 cd03293 ABC_NrtD_SsuB_transpor  32.9      15 0.00032   32.2   0.1   11    2-12     37-47  (220)
240 PF10412 TrwB_AAD_bind:  Type I  32.8      13 0.00027   36.3  -0.4   12    2-13     22-33  (386)
241 KOG2373|consensus               32.7      18  0.0004   35.7   0.7   12    2-13    280-291 (514)
242 cd02028 UMPK_like Uridine mono  32.7      16 0.00034   31.6   0.2   12    2-13      6-17  (179)
243 cd03276 ABC_SMC6_euk Eukaryoti  32.7      14  0.0003   32.4  -0.1   12    1-12     27-38  (198)
244 PRK10876 recB exonuclease V su  32.5      14  0.0003   41.5  -0.2   14  191-204   407-420 (1181)
245 cd03258 ABC_MetN_methionine_tr  32.5      15 0.00033   32.4   0.1   11    2-12     38-48  (233)
246 TIGR01587 cas3_core CRISPR-ass  32.4      16 0.00035   34.4   0.2   11    2-12      6-16  (358)
247 PF06048 DUF927:  Domain of unk  32.4      14  0.0003   34.4  -0.2   12    1-12    199-210 (286)
248 TIGR03608 L_ocin_972_ABC putat  32.2      16 0.00034   31.6   0.1   11    2-12     31-41  (206)
249 PF13481 AAA_25:  AAA domain; P  32.2      12 0.00026   31.8  -0.7   13    1-13     38-50  (193)
250 TIGR01166 cbiO cobalt transpor  32.0      16 0.00034   31.3   0.1   11    2-12     25-35  (190)
251 cd04163 Era Era subfamily.  Er  31.9      16 0.00035   29.0   0.1   11    2-12     10-20  (168)
252 PRK13873 conjugal transfer ATP  31.9      16 0.00035   39.1   0.1   12    1-12    447-458 (811)
253 cd03255 ABC_MJ0796_Lo1CDE_FtsE  31.5      16 0.00035   31.9   0.1   11    2-12     37-47  (218)
254 TIGR03263 guanyl_kin guanylate  31.4      16 0.00035   30.7   0.1   12    1-12      7-18  (180)
255 PRK04837 ATP-dependent RNA hel  31.4      16 0.00034   35.6  -0.0   11    2-12     52-62  (423)
256 cd03115 SRP The signal recogni  31.4      16 0.00036   30.6   0.1   13    1-13      6-18  (173)
257 cd00071 GMPK Guanosine monopho  31.3      16 0.00035   30.0   0.1   11    2-12      6-16  (137)
258 TIGR02673 FtsE cell division A  31.3      16 0.00036   31.7   0.1   11    2-12     35-45  (214)
259 COG3587 Restriction endonuclea  31.1      18  0.0004   39.1   0.4   10    3-12     82-91  (985)
260 cd03226 ABC_cobalt_CbiO_domain  31.1      17 0.00036   31.6   0.1   11    2-12     33-43  (205)
261 PF00005 ABC_tran:  ABC transpo  31.0      14 0.00031   29.4  -0.3   11    2-12     18-28  (137)
262 TIGR00960 3a0501s02 Type II (G  30.8      17 0.00037   31.7   0.1   11    2-12     36-46  (216)
263 cd03256 ABC_PhnC_transporter A  30.7      17 0.00037   32.2   0.1   11    2-12     34-44  (241)
264 PRK04195 replication factor C   30.7      16 0.00034   36.6  -0.1   12    1-12     45-56  (482)
265 PRK05342 clpX ATP-dependent pr  30.6      17 0.00036   36.1  -0.0   12    1-12    114-125 (412)
266 PRK13342 recombination factor   30.5      16 0.00035   35.8  -0.1   12    1-12     42-53  (413)
267 PRK08118 topology modulation p  30.5      18  0.0004   30.8   0.2   11    2-12      8-18  (167)
268 PRK13341 recombination factor   30.3      16 0.00036   38.8  -0.1   13    1-13     58-70  (725)
269 PRK13891 conjugal transfer pro  30.3      17 0.00038   39.2   0.1   12    1-12    494-505 (852)
270 cd03264 ABC_drug_resistance_li  30.3      17 0.00038   31.5   0.1   11    2-12     32-42  (211)
271 PRK11331 5-methylcytosine-spec  30.2      17 0.00037   36.6  -0.0   12    1-12    200-211 (459)
272 cd03265 ABC_DrrA DrrA is the A  29.9      18 0.00039   31.7   0.1   11    2-12     33-43  (220)
273 CHL00195 ycf46 Ycf46; Provisio  29.9      17 0.00037   36.9  -0.1   41    1-41    265-316 (489)
274 cd03229 ABC_Class3 This class   29.8      18 0.00039   30.8   0.1   11    2-12     33-43  (178)
275 PRK11776 ATP-dependent RNA hel  29.8      18 0.00039   35.6   0.1   11    2-12     48-58  (460)
276 PRK13537 nodulation ABC transp  29.8      18 0.00039   33.9   0.1   12    1-12     39-50  (306)
277 COG4096 HsdR Type I site-speci  29.7      20 0.00044   38.6   0.5   11    3-13    193-203 (875)
278 PF04548 AIG1:  AIG1 family;  I  29.6      18 0.00039   31.9   0.1   11    2-12      7-17  (212)
279 cd03275 ABC_SMC1_euk Eukaryoti  29.5      17 0.00037   32.8  -0.1   12    1-12     28-39  (247)
280 cd03273 ABC_SMC2_euk Eukaryoti  29.5      19  0.0004   32.5   0.1   12    1-12     31-42  (251)
281 TIGR01360 aden_kin_iso1 adenyl  29.4      20 0.00043   30.1   0.3   11    2-12     10-20  (188)
282 COG1122 CbiO ABC-type cobalt t  29.3      17 0.00037   33.2  -0.2   12    1-12     36-47  (235)
283 TIGR01243 CDC48 AAA family ATP  29.3      18  0.0004   38.1   0.0   12    1-12    218-229 (733)
284 PRK04040 adenylate kinase; Pro  29.2      17 0.00037   31.8  -0.2   12    1-12      8-19  (188)
285 PRK04296 thymidine kinase; Pro  29.1      15 0.00032   32.0  -0.6   14    1-14      8-21  (190)
286 TIGR03819 heli_sec_ATPase heli  29.1      19 0.00041   34.6   0.1   12    2-13    185-196 (340)
287 TIGR03522 GldA_ABC_ATP gliding  29.1      19 0.00041   33.6   0.1   11    2-12     35-45  (301)
288 PRK13721 conjugal transfer ATP  29.1      19 0.00041   38.8   0.1   11    2-12    456-466 (844)
289 PRK15177 Vi polysaccharide exp  29.0      19 0.00041   31.7   0.1   34  203-236   174-207 (213)
290 cd03262 ABC_HisP_GlnQ_permease  29.0      19 0.00041   31.2   0.1   11    2-12     33-43  (213)
291 PRK10246 exonuclease subunit S  29.0      33 0.00071   38.0   1.9   12    1-12     36-47  (1047)
292 cd03222 ABC_RNaseL_inhibitor T  29.0      18 0.00038   31.5  -0.1   11    2-12     32-42  (177)
293 PRK11629 lolD lipoprotein tran  29.0      19 0.00041   31.9   0.1   11    2-12     42-52  (233)
294 TIGR01288 nodI ATP-binding ABC  28.9      19 0.00041   33.6   0.1   11    2-12     37-47  (303)
295 TIGR00382 clpX endopeptidase C  28.9      18 0.00039   35.9  -0.1   12    1-12    122-133 (413)
296 cd03261 ABC_Org_Solvent_Resist  28.8      19 0.00042   31.9   0.1   11    2-12     33-43  (235)
297 PRK13538 cytochrome c biogenes  28.8      19 0.00042   31.2   0.1   11    2-12     34-44  (204)
298 cd03259 ABC_Carb_Solutes_like   28.7      19 0.00042   31.3   0.1   11    2-12     33-43  (213)
299 COG0552 FtsY Signal recognitio  28.6      20 0.00044   34.7   0.2   11    2-12    146-156 (340)
300 COG1222 RPT1 ATP-dependent 26S  28.5      21 0.00045   35.2   0.2   39    1-42    191-243 (406)
301 cd03260 ABC_PstB_phosphate_tra  28.5      20 0.00042   31.6   0.1   11    2-12     33-43  (227)
302 PRK06696 uridine kinase; Valid  28.4      21 0.00045   31.7   0.2   11    2-12     29-39  (223)
303 TIGR00073 hypB hydrogenase acc  28.3      20 0.00043   31.4   0.1   11    2-12     29-39  (207)
304 cd03245 ABCC_bacteriocin_expor  28.3      20 0.00043   31.3   0.1   11    2-12     37-47  (220)
305 PRK05416 glmZ(sRNA)-inactivati  28.2      20 0.00043   33.8   0.0   12    2-13     13-24  (288)
306 cd01123 Rad51_DMC1_radA Rad51_  28.1      21 0.00045   31.4   0.1   12    1-12     25-36  (235)
307 PHA02653 RNA helicase NPH-II;   28.0      24 0.00051   37.3   0.6   11    1-11    185-195 (675)
308 PRK07667 uridine kinase; Provi  27.9      21 0.00046   31.0   0.2   11    2-12     24-34  (193)
309 cd03292 ABC_FtsE_transporter F  27.9      20 0.00044   31.0   0.1   11    2-12     34-44  (214)
310 cd03269 ABC_putative_ATPase Th  27.9      20 0.00044   31.1   0.1   11    2-12     33-43  (210)
311 cd03235 ABC_Metallic_Cations A  27.8      20 0.00044   31.1   0.1   11    2-12     32-42  (213)
312 cd03297 ABC_ModC_molybdenum_tr  27.7      21 0.00044   31.2   0.1   11    2-12     30-40  (214)
313 PRK06762 hypothetical protein;  27.7      22 0.00047   29.6   0.2   11    1-11      8-18  (166)
314 cd03263 ABC_subfamily_A The AB  27.7      21 0.00045   31.2   0.1   11    2-12     35-45  (220)
315 TIGR03265 PhnT2 putative 2-ami  27.7      21 0.00045   34.5   0.1   12    1-12     36-47  (353)
316 PF00063 Myosin_head:  Myosin h  27.6      18  0.0004   37.8  -0.3   11    2-12     92-102 (689)
317 PRK13536 nodulation factor exp  27.5      21 0.00045   34.2   0.1   11    2-12     74-84  (340)
318 PRK13853 type IV secretion sys  27.4      19 0.00042   38.5  -0.2   12    1-12    432-443 (789)
319 TIGR00602 rad24 checkpoint pro  27.4      20 0.00043   37.6  -0.1   12    1-12    116-127 (637)
320 COG4148 ModC ABC-type molybdat  27.4      22 0.00048   34.1   0.2   12    1-12     30-41  (352)
321 cd03214 ABC_Iron-Siderophores_  27.4      21 0.00046   30.4   0.1   11    2-12     32-42  (180)
322 PF03969 AFG1_ATPase:  AFG1-lik  27.4      22 0.00047   34.7   0.2   43    1-43     68-111 (362)
323 PRK09825 idnK D-gluconate kina  27.3      21 0.00046   30.7   0.1   11    2-12     10-20  (176)
324 cd03296 ABC_CysA_sulfate_impor  27.3      21 0.00046   31.7   0.1   11    2-12     35-45  (239)
325 TIGR03864 PQQ_ABC_ATP ABC tran  27.3      21 0.00046   31.7   0.1   11    2-12     34-44  (236)
326 TIGR01359 UMP_CMP_kin_fam UMP-  27.2      21 0.00046   30.1   0.0   12    1-12      5-16  (183)
327 PRK14242 phosphate transporter  27.2      21 0.00046   32.0   0.1   11    2-12     39-49  (253)
328 cd02024 NRK1 Nicotinamide ribo  27.1      22 0.00049   31.2   0.2   11    2-12      6-16  (187)
329 PRK10584 putative ABC transpor  27.1      22 0.00047   31.3   0.1   11    2-12     43-53  (228)
330 PF13166 AAA_13:  AAA domain     27.0      22 0.00048   37.0   0.2   10    1-10     22-31  (712)
331 cd03221 ABCF_EF-3 ABCF_EF-3  E  27.0      22 0.00047   29.4   0.1   11    2-12     33-43  (144)
332 cd03301 ABC_MalK_N The N-termi  27.0      22 0.00047   30.9   0.1   11    2-12     33-43  (213)
333 PRK13539 cytochrome c biogenes  26.9      22 0.00047   31.0   0.1   11    2-12     35-45  (207)
334 cd03218 ABC_YhbG The ABC trans  26.9      22 0.00047   31.3   0.1   12    1-12     32-43  (232)
335 cd00882 Ras_like_GTPase Ras-li  26.8      22 0.00047   27.1   0.0   12    1-12      2-13  (157)
336 COG1117 PstB ABC-type phosphat  26.7      40 0.00086   31.2   1.7   11    2-12     40-50  (253)
337 TIGR02688 conserved hypothetic  26.7      23 0.00049   35.7   0.1   14    1-14    215-228 (449)
338 PRK13646 cbiO cobalt transport  26.6      22 0.00048   32.8   0.1   11    2-12     40-50  (286)
339 cd03219 ABC_Mj1267_LivG_branch  26.5      22 0.00048   31.4   0.1   12    1-12     32-43  (236)
340 PRK10875 recD exonuclease V su  26.5      21 0.00045   37.3  -0.1   11    2-12    174-184 (615)
341 TIGR02858 spore_III_AA stage I  26.5      20 0.00044   33.4  -0.2   12    1-12    117-128 (270)
342 TIGR02640 gas_vesic_GvpN gas v  26.4      22 0.00047   32.6  -0.0   12    1-12     27-38  (262)
343 PLN02165 adenylate isopentenyl  26.3      24 0.00052   34.1   0.3   11    2-12     50-60  (334)
344 PLN02796 D-glycerate 3-kinase   26.3      22 0.00048   34.5   0.0   11    2-12    107-117 (347)
345 PRK14961 DNA polymerase III su  26.2      22 0.00047   34.2  -0.1   12    1-12     44-55  (363)
346 TIGR02211 LolD_lipo_ex lipopro  26.2      23 0.00049   31.0   0.1   11    2-12     38-48  (221)
347 cd03257 ABC_NikE_OppD_transpor  26.2      23 0.00049   31.0   0.1   11    2-12     38-48  (228)
348 TIGR03410 urea_trans_UrtE urea  26.1      23  0.0005   31.2   0.1   12    1-12     32-43  (230)
349 PHA02244 ATPase-like protein    26.1      22 0.00049   35.0   0.0   12    1-12    125-136 (383)
350 COG1126 GlnQ ABC-type polar am  26.1      24 0.00051   32.6   0.2   11    2-12     35-45  (240)
351 COG4152 ABC-type uncharacteriz  26.1      28  0.0006   32.9   0.6   11    2-12     35-45  (300)
352 COG0419 SbcC ATPase involved i  26.0      24 0.00052   38.3   0.2   12    1-12     31-42  (908)
353 PF01926 MMR_HSR1:  50S ribosom  26.0      20 0.00043   27.9  -0.3   12    1-12      5-16  (116)
354 TIGR00972 3a0107s01c2 phosphat  26.0      23  0.0005   31.7   0.1   11    2-12     34-44  (247)
355 cd01876 YihA_EngB The YihA (En  25.9      23 0.00049   28.2  -0.0   11    2-12      6-16  (170)
356 cd01379 MYSc_type_III Myosin m  25.9      25 0.00054   37.0   0.3   11    2-12     93-103 (653)
357 PRK11432 fbpC ferric transport  25.8      23  0.0005   34.1   0.0   11    2-12     39-49  (351)
358 TIGR01447 recD exodeoxyribonuc  25.8      23 0.00049   36.8  -0.0   11    2-12    167-177 (586)
359 TIGR01425 SRP54_euk signal rec  25.7      23 0.00051   35.3   0.1   11    2-12    107-117 (429)
360 cd03224 ABC_TM1139_LivF_branch  25.7      23 0.00051   30.8   0.1   11    2-12     33-43  (222)
361 PF08477 Miro:  Miro-like prote  25.6      26 0.00057   26.9   0.3   11    2-12      6-16  (119)
362 PRK13645 cbiO cobalt transport  25.5      24 0.00052   32.6   0.1   11    2-12     44-54  (289)
363 PRK11650 ugpC glycerol-3-phosp  25.5      24 0.00051   34.1   0.0   12    1-12     36-47  (356)
364 TIGR01978 sufC FeS assembly AT  25.3      25 0.00053   31.2   0.1   11    2-12     33-43  (243)
365 PRK10867 signal recognition pa  25.3      24 0.00053   35.2   0.1   12    2-13    107-118 (433)
366 cd03241 ABC_RecN RecN ATPase i  25.3      25 0.00053   32.4   0.1   12    1-12     27-38  (276)
367 cd01394 radB RadB. The archaea  25.3      25 0.00054   30.7   0.2   12    1-12     25-36  (218)
368 PRK11607 potG putrescine trans  25.3      24 0.00052   34.4   0.1   12    1-12     51-62  (377)
369 TIGR02315 ABC_phnC phosphonate  25.2      24 0.00053   31.3   0.1   11    2-12     35-45  (243)
370 KOG0745|consensus               25.2      27 0.00059   35.4   0.4   25  211-235   471-495 (564)
371 PRK09493 glnQ glutamine ABC tr  25.2      24 0.00053   31.3   0.1   11    2-12     34-44  (240)
372 COG1074 RecB ATP-dependent exo  25.1      25 0.00055   39.3   0.2   10    4-13     25-34  (1139)
373 CHL00176 ftsH cell division pr  25.1      23  0.0005   37.1  -0.1   12    1-12    222-233 (638)
374 TIGR01189 ccmA heme ABC export  25.1      25 0.00053   30.3   0.1   11    2-12     33-43  (198)
375 PRK13650 cbiO cobalt transport  25.1      25 0.00053   32.4   0.1   11    2-12     40-50  (279)
376 PRK11124 artP arginine transpo  25.0      25 0.00053   31.3   0.1   11    2-12     35-45  (242)
377 cd03290 ABCC_SUR1_N The SUR do  25.0      25 0.00054   30.8   0.1   11    2-12     34-44  (218)
378 TIGR00959 ffh signal recogniti  25.0      24 0.00053   35.1   0.0   12    2-13    106-117 (428)
379 PRK13541 cytochrome c biogenes  25.0      25 0.00054   30.3   0.1   11    2-12     33-43  (195)
380 cd00464 SK Shikimate kinase (S  24.9      24 0.00051   28.6  -0.1   12    1-12      5-16  (154)
381 smart00053 DYNc Dynamin, GTPas  24.8 2.1E+02  0.0045   26.2   6.1   53  211-281    84-136 (240)
382 PRK11248 tauB taurine transpor  24.7      25 0.00055   31.9   0.1   11    2-12     34-44  (255)
383 PRK14240 phosphate transporter  24.7      25 0.00055   31.4   0.1   11    2-12     36-46  (250)
384 cd03298 ABC_ThiQ_thiamine_tran  24.7      25 0.00055   30.5   0.1   11    2-12     31-41  (211)
385 cd01428 ADK Adenylate kinase (  24.6      25 0.00054   29.7   0.0   12    1-12      5-16  (194)
386 PF03668 ATP_bind_2:  P-loop AT  24.6      58  0.0013   30.8   2.5   11    2-12      8-18  (284)
387 cd02027 APSK Adenosine 5'-phos  24.5      27 0.00058   29.1   0.2   12    1-12      5-16  (149)
388 PF05496 RuvB_N:  Holliday junc  24.5      24 0.00052   32.5  -0.1   12    1-12     56-67  (233)
389 cd03252 ABCC_Hemolysin The ABC  24.5      25 0.00055   31.1   0.1   11    2-12     35-45  (237)
390 KOG0726|consensus               24.5      22 0.00047   34.4  -0.4   42    1-42    225-277 (440)
391 TIGR00101 ureG urease accessor  24.4      26 0.00056   30.9   0.1   11    2-12      8-18  (199)
392 PRK13651 cobalt transporter AT  24.3      26 0.00056   33.0   0.1   11    2-12     40-50  (305)
393 PF14532 Sigma54_activ_2:  Sigm  24.3      24 0.00051   28.8  -0.2   12    1-12     27-38  (138)
394 PRK09452 potA putrescine/sperm  24.3      26 0.00055   34.2   0.0   12    1-12     46-57  (375)
395 cd03239 ABC_SMC_head The struc  24.3      24 0.00052   30.5  -0.1   12    1-12     28-39  (178)
396 cd03254 ABCC_Glucan_exporter_l  24.3      26 0.00056   30.8   0.1   11    2-12     36-46  (229)
397 PRK14494 putative molybdopteri  24.3      25 0.00054   32.1  -0.1   12    2-13      8-19  (229)
398 PRK04182 cytidylate kinase; Pr  24.2      27 0.00059   29.0   0.2   11    2-12      7-17  (180)
399 TIGR01184 ntrCD nitrate transp  24.2      26 0.00057   31.1   0.1   11    2-12     18-28  (230)
400 PRK03839 putative kinase; Prov  24.2      27 0.00059   29.5   0.2   12    1-12      6-17  (180)
401 cd03237 ABC_RNaseL_inhibitor_d  24.1      26 0.00057   31.8   0.1   11    2-12     32-42  (246)
402 cd03249 ABC_MTABC3_MDL1_MDL2 M  24.0      25 0.00055   31.1  -0.0   11    2-12     36-46  (238)
403 TIGR01187 potA spermidine/putr  23.8      27 0.00058   33.1   0.1   12    1-12      2-13  (325)
404 COG0444 DppD ABC-type dipeptid  23.8      27 0.00058   33.6   0.1   12    2-13     38-49  (316)
405 cd00227 CPT Chloramphenicol (C  23.8      28 0.00061   29.5   0.2   11    2-12      9-19  (175)
406 TIGR01243 CDC48 AAA family ATP  23.8      26 0.00056   37.1  -0.1   42    1-42    493-545 (733)
407 PRK11022 dppD dipeptide transp  23.8      26 0.00056   33.3  -0.0   11    2-12     40-50  (326)
408 cd00267 ABC_ATPase ABC (ATP-bi  23.8      27 0.00059   28.8   0.1   11    2-12     32-42  (157)
409 KOG0922|consensus               23.8      33 0.00071   36.1   0.7   11    2-12     73-83  (674)
410 PRK11231 fecE iron-dicitrate t  23.8      27 0.00059   31.4   0.1   11    2-12     35-45  (255)
411 TIGR02639 ClpA ATP-dependent C  23.7      26 0.00056   37.1  -0.1   12    1-12    490-501 (731)
412 cd04164 trmE TrmE (MnmE, ThdF,  23.7      27 0.00059   27.6   0.1   11    2-12      8-18  (157)
413 PRK11144 modC molybdate transp  23.7      27 0.00059   33.5   0.1   11    2-12     31-41  (352)
414 TIGR02759 TraD_Ftype type IV c  23.6      26 0.00055   36.2  -0.1   12    1-12    182-193 (566)
415 TIGR03258 PhnT 2-aminoethylpho  23.6      27 0.00059   33.8   0.1   12    1-12     37-48  (362)
416 PRK03695 vitamin B12-transport  23.6      27 0.00059   31.4   0.1   11    2-12     29-39  (248)
417 cd03295 ABC_OpuCA_Osmoprotecti  23.6      27 0.00059   31.1   0.1   11    2-12     34-44  (242)
418 cd03283 ABC_MutS-like MutS-lik  23.6      28 0.00061   30.6   0.2   11    2-12     32-42  (199)
419 cd01393 recA_like RecA is a  b  23.6      29 0.00062   30.3   0.2   12    1-12     25-36  (226)
420 PRK00091 miaA tRNA delta(2)-is  23.5      30 0.00065   32.9   0.3   11    2-12     11-21  (307)
421 TIGR02397 dnaX_nterm DNA polym  23.5      27 0.00058   32.8  -0.0   12    1-12     42-53  (355)
422 PRK14248 phosphate ABC transpo  23.5      27 0.00059   31.7   0.1   11    2-12     54-64  (268)
423 TIGR00611 recf recF protein. A  23.5      25 0.00055   34.1  -0.2   12    1-12     29-40  (365)
424 PRK10865 protein disaggregatio  23.4      26 0.00057   37.9  -0.1   12    1-12    604-615 (857)
425 PRK14251 phosphate ABC transpo  23.4      28  0.0006   31.2   0.1   11    2-12     37-47  (251)
426 PRK14261 phosphate ABC transpo  23.4      28  0.0006   31.3   0.1   11    2-12     39-49  (253)
427 cd03268 ABC_BcrA_bacitracin_re  23.4      28  0.0006   30.2   0.1   11    2-12     33-43  (208)
428 TIGR00390 hslU ATP-dependent p  23.2      27 0.00059   35.0   0.0   12    1-12     53-64  (441)
429 TIGR00643 recG ATP-dependent D  23.2      27 0.00059   36.3  -0.0   11    2-12    263-273 (630)
430 PRK08533 flagellar accessory p  23.2      27 0.00058   31.4  -0.0   12    1-12     30-41  (230)
431 cd03223 ABCD_peroxisomal_ALDP   23.2      28 0.00061   29.3   0.1   11    2-12     34-44  (166)
432 COG0563 Adk Adenylate kinase a  23.2      31 0.00066   30.1   0.3   11    2-12      7-17  (178)
433 cd03233 ABC_PDR_domain1 The pl  23.2      28 0.00061   30.3   0.1   11    2-12     40-50  (202)
434 cd03251 ABCC_MsbA MsbA is an e  23.1      28 0.00061   30.7   0.1   11    2-12     35-45  (234)
435 PRK13548 hmuV hemin importer A  23.0      28 0.00062   31.5   0.1   11    2-12     35-45  (258)
436 PRK09361 radB DNA repair and r  23.0      29 0.00062   30.5   0.1   13    1-13     29-41  (225)
437 CHL00081 chlI Mg-protoporyphyr  23.0      27 0.00058   34.0  -0.1   13    1-13     44-56  (350)
438 PRK13638 cbiO cobalt transport  23.0      29 0.00062   31.7   0.1   11    2-12     34-44  (271)
439 PRK11264 putative amino-acid A  23.0      29 0.00062   31.0   0.1   11    2-12     36-46  (250)
440 PRK11701 phnK phosphonate C-P   22.9      28 0.00062   31.3   0.1   11    2-12     39-49  (258)
441 PRK09544 znuC high-affinity zi  22.9      29 0.00062   31.5   0.1   11    2-12     37-47  (251)
442 cd03250 ABCC_MRP_domain1 Domai  22.9      29 0.00063   30.0   0.1   11    2-12     38-48  (204)
443 cd03228 ABCC_MRP_Like The MRP   22.9      29 0.00062   29.3   0.1   11    2-12     35-45  (171)
444 TIGR03881 KaiC_arch_4 KaiC dom  22.9      29 0.00062   30.6   0.1   12    1-12     26-37  (229)
445 KOG1970|consensus               22.8      33 0.00071   35.6   0.5   11    2-12    117-127 (634)
446 PRK10851 sulfate/thiosulfate t  22.8      29 0.00062   33.4   0.1   12    1-12     34-45  (353)
447 COG0324 MiaA tRNA delta(2)-iso  22.8      30 0.00065   33.1   0.2   12    1-12      9-20  (308)
448 cd03294 ABC_Pro_Gly_Bertaine T  22.8      29 0.00063   31.7   0.1   11    2-12     57-67  (269)
449 PRK14250 phosphate ABC transpo  22.7      29 0.00063   31.0   0.1   11    2-12     36-46  (241)
450 PRK11131 ATP-dependent RNA hel  22.6      30 0.00065   39.3   0.1   11    2-12     96-106 (1294)
451 PRK11000 maltose/maltodextrin   22.5      29 0.00063   33.6   0.0   11    2-12     36-46  (369)
452 cd03114 ArgK-like The function  22.4      29 0.00062   29.1  -0.0   12    2-13      6-17  (148)
453 CHL00131 ycf16 sulfate ABC tra  22.4      30 0.00065   30.9   0.1   11    2-12     40-50  (252)
454 cd03246 ABCC_Protease_Secretio  22.4      30 0.00065   29.2   0.1   12    1-12     34-45  (173)
455 COG4555 NatA ABC-type Na+ tran  22.4      35 0.00075   31.4   0.5   12    1-12     34-45  (245)
456 PRK14530 adenylate kinase; Pro  22.3      31 0.00068   30.3   0.2   11    2-12     10-20  (215)
457 PRK10895 lipopolysaccharide AB  22.3      30 0.00065   30.7   0.1   12    1-12     35-46  (241)
458 PRK13830 conjugal transfer pro  22.3      30 0.00065   37.3   0.1   13    1-13    462-474 (818)
459 PRK10247 putative ABC transpor  22.2      30 0.00065   30.5   0.1   11    2-12     40-50  (225)
460 PF08423 Rad51:  Rad51;  InterP  22.2      25 0.00055   32.2  -0.4   11    1-11     44-54  (256)
461 cd03216 ABC_Carb_Monos_I This   22.2      30 0.00066   29.0   0.1   11    2-12     33-43  (163)
462 PRK13647 cbiO cobalt transport  22.2      30 0.00064   31.8   0.0   11    2-12     38-48  (274)
463 TIGR00750 lao LAO/AO transport  22.2      31 0.00067   32.3   0.1   12    2-13     41-52  (300)
464 PRK14269 phosphate ABC transpo  22.2      30 0.00066   30.9   0.1   11    2-12     35-45  (246)
465 PRK05541 adenylylsulfate kinas  22.1      31 0.00068   29.0   0.2   11    2-12     14-24  (176)
466 TIGR02903 spore_lon_C ATP-depe  22.1      28 0.00062   36.2  -0.1   12    1-12    181-192 (615)
467 PRK14245 phosphate ABC transpo  22.1      30 0.00066   30.9   0.1   11    2-12     36-46  (250)
468 cd03243 ABC_MutS_homologs The   22.1      32  0.0007   29.9   0.2   12    2-13     36-47  (202)
469 PRK13652 cbiO cobalt transport  22.0      31 0.00066   31.7   0.1   11    2-12     37-47  (277)
470 PRK13634 cbiO cobalt transport  22.0      30 0.00065   32.1   0.0   11    2-12     40-50  (290)
471 PRK06067 flagellar accessory p  22.0      31 0.00067   30.6   0.1   12    1-12     31-42  (234)
472 cd03248 ABCC_TAP TAP, the Tran  22.0      31 0.00066   30.3   0.1   11    2-12     47-57  (226)
473 TIGR02323 CP_lyasePhnK phospho  22.0      31 0.00067   30.9   0.1   11    2-12     36-46  (253)
474 TIGR03411 urea_trans_UrtD urea  21.9      31 0.00067   30.6   0.1   11    2-12     35-45  (242)
475 PRK10908 cell division protein  21.9      31 0.00067   30.3   0.1   11    2-12     35-45  (222)
476 cd03266 ABC_NatA_sodium_export  21.9      31 0.00068   30.0   0.1   11    2-12     38-48  (218)
477 PRK14262 phosphate ABC transpo  21.9      31 0.00067   30.8   0.1   11    2-12     36-46  (250)
478 PRK14970 DNA polymerase III su  21.8      29 0.00064   33.0  -0.1   12    1-12     45-56  (367)
479 PRK14273 phosphate ABC transpo  21.8      31 0.00068   30.9   0.1   11    2-12     40-50  (254)
480 cd03215 ABC_Carb_Monos_II This  21.8      31 0.00068   29.4   0.1   12    1-12     32-43  (182)
481 PF00158 Sigma54_activat:  Sigm  21.7      29 0.00062   29.8  -0.2   32  199-230    93-124 (168)
482 PRK13648 cbiO cobalt transport  21.7      31 0.00068   31.4   0.1   11    2-12     42-52  (269)
483 PRK11034 clpA ATP-dependent Cl  21.7      31 0.00066   37.0   0.0   12    1-12    494-505 (758)
484 PRK13649 cbiO cobalt transport  21.7      31 0.00068   31.5   0.1   11    2-12     40-50  (280)
485 PRK14259 phosphate ABC transpo  21.7      31 0.00068   31.5   0.1   11    2-12     46-56  (269)
486 TIGR02236 recomb_radA DNA repa  21.6      32  0.0007   32.0   0.1   12    1-12    101-112 (310)
487 smart00242 MYSc Myosin. Large   21.5      35 0.00075   36.0   0.3   11    2-12     99-109 (677)
488 PRK10744 pstB phosphate transp  21.5      32 0.00069   31.1   0.1   11    2-12     46-56  (260)
489 TIGR03005 ectoine_ehuA ectoine  21.5      32 0.00069   30.8   0.1   11    2-12     33-43  (252)
490 KOG0990|consensus               21.4      41 0.00089   32.7   0.8   41    1-41     68-122 (360)
491 PF02810 SEC-C:  SEC-C motif;    21.4      38 0.00083   19.5   0.4    8    4-11      7-14  (21)
492 TIGR00618 sbcc exonuclease Sbc  21.4      30 0.00066   38.1  -0.1   12    1-12     32-43  (1042)
493 cd03270 ABC_UvrA_I The excisio  21.4      31 0.00068   30.7  -0.0   14    1-14     27-40  (226)
494 cd03247 ABCC_cytochrome_bd The  21.4      32  0.0007   29.1   0.1   11    2-12     35-45  (178)
495 PRK13635 cbiO cobalt transport  21.4      32 0.00069   31.7   0.0   11    2-12     40-50  (279)
496 PRK13540 cytochrome c biogenes  21.3      32  0.0007   29.7   0.1   11    2-12     34-44  (200)
497 PRK10771 thiQ thiamine transpo  21.3      32  0.0007   30.4   0.1   11    2-12     32-42  (232)
498 cd01852 AIG1 AIG1 (avrRpt2-ind  21.3      34 0.00074   29.4   0.2   11    2-12      7-17  (196)
499 KOG1882|consensus               21.3 1.4E+02  0.0031   27.9   4.2   42  238-284   211-253 (293)
500 PF03029 ATP_bind_1:  Conserved  21.2      30 0.00065   31.5  -0.2   13    2-14      3-15  (238)

No 1  
>KOG4280|consensus
Probab=100.00  E-value=1.1e-41  Score=338.35  Aligned_cols=156  Identities=36%  Similarity=0.492  Sum_probs=137.8

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||.|.     +++..|||||++++||..|+..++        ...|.|+|||+|||||.|+|||.     
T Consensus        92 YGQTGsGKTyTM~G~-----~~~~~GiiPraf~~LF~~I~~~~~--------~~~f~vrvS~lEiYnE~i~DLL~-----  153 (574)
T KOG4280|consen   92 YGQTGSGKTYTMIGP-----DPELRGLIPRAFEHLFRHIDERKE--------KTRFLVRVSYLEIYNESIRDLLS-----  153 (574)
T ss_pred             eccCCCCCceEeeCC-----ChhhCCchhHHHHHHHHHHHhccc--------cceEEEEeehHHHHhHHHHHHhC-----
Confidence            999999999999996     378999999999999999998754        34799999999999999977773     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       154 --------------------------------------------------------------------------------  153 (574)
T KOG4280|consen  154 --------------------------------------------------------------------------------  153 (574)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +..       ...|.|+++++.||||+||+++.|.++++++.+|..|..+|++++|.||.+
T Consensus       154 -------------------~~~-------~~~l~lre~p~~Gv~V~nlse~~v~s~~d~~~~l~~G~~nR~vgat~mn~~  207 (574)
T KOG4280|consen  154 -------------------PVN-------PKGLELREDPKCGVYVENLSEMDVESAEDAQQLLVVGLANRRVGATSMNEE  207 (574)
T ss_pred             -------------------ccC-------cCCceeeEcCCCceEecCcceeecCCHHHHHHHHHHHHhhcchhhccCCcc
Confidence                               221       367999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||||+|++...  ..+.....+.++|+||||||||.
T Consensus       208 SsRSH~ift~~i~~~~~--~~~~~~~~~~~rlnlvDLagsEr  247 (574)
T KOG4280|consen  208 SSRSHAIFTIHIESSEK--SDGGLMSGRSSKLNLVDLAGSER  247 (574)
T ss_pred             cccceEEEEEEEEeecc--cCCCccccccceeeeeeccchhh
Confidence            99999999999999332  22334456778999999999986


No 2  
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup. Members of this subgroup seem to play a role in mitosis and meiosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second
Probab=100.00  E-value=5.4e-40  Score=311.71  Aligned_cols=164  Identities=36%  Similarity=0.465  Sum_probs=138.1

Q ss_pred             CCCCccccccccccccCCC--CCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhh
Q psy15014          1 MLQTGSGKTYTMGTGFETD--VSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITC   78 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~--~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~   78 (286)
                      ||||||||||||+|+....  ....++|||||++++||..++...+..    .....|.|++||+|||||+|+|||.   
T Consensus        81 YGqTGSGKTyTm~G~~~~~~~~~~~~~Giipr~~~~Lf~~i~~~~~~~----~~~~~~~v~~S~~EIyne~v~DLL~---  153 (337)
T cd01373          81 YGQTGSGKTYTMMGPSSSDDESPHGLQGVIPRIFEYLFSLIQREEEKR----GDGLKFLCKCSFLEIYNEQITDLLD---  153 (337)
T ss_pred             eCCCCCCceEEecCCCCccccccccCCCHHHHHHHHHHHHHHhhhhhc----ccCceEEEEEEEEeecCCEeeeCCC---
Confidence            9999999999999964322  234678999999999999987654321    2356899999999999999977773   


Q ss_pred             ccccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhh
Q psy15014         79 VQAHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERD  158 (286)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (286)
                                                                                                      
T Consensus       154 --------------------------------------------------------------------------------  153 (337)
T cd01373         154 --------------------------------------------------------------------------------  153 (337)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHhhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCC
Q psy15014        159 KVLASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMN  238 (286)
Q Consensus       159 ~~~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N  238 (286)
                                           +.        ...++|++++.++++|+||+++.|.|++|++++|..|..+|++++|.+|
T Consensus       154 ---------------------~~--------~~~l~i~e~~~~~~~v~gl~~~~v~s~~e~~~ll~~g~~~R~~~~t~~n  204 (337)
T cd01373         154 ---------------------PT--------SRNLKIREDIKKGVYVENLTEEYVSSYEDVYQVLLKGLSNRKVAATSMN  204 (337)
T ss_pred             ---------------------CC--------CCCceEEECCCCCEEeCCCEEEEeCCHHHHHHHHHHHHhccCcccCcCC
Confidence                                 21        3568999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        239 SQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       239 ~~SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      .+|||||+||+|+|.+....   ........++|+||||||||..
T Consensus       205 ~~SSRSH~i~~i~v~~~~~~---~~~~~~~~s~l~~VDLAGSEr~  246 (337)
T cd01373         205 SESSRSHAVFTCTIESWEKK---ASSTNIRTSRLNLVDLAGSERQ  246 (337)
T ss_pred             CCCCCccEEEEEEEEEeecC---CCCCcEEEEEEEEEECCCCCcc
Confidence            99999999999999986532   2222456789999999999964


No 3  
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup. The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a sec
Probab=100.00  E-value=8.3e-40  Score=310.55  Aligned_cols=154  Identities=30%  Similarity=0.409  Sum_probs=137.4

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|      ..+++|||||++++||+.++....        ...|.|++||+|||||+|+|||+     
T Consensus        94 yGqtGSGKTyTm~G------~~~~~Giipr~~~~LF~~i~~~~~--------~~~~~v~vS~~EIyne~v~DLL~-----  154 (338)
T cd01370          94 YGATGAGKTHTMLG------TDSDPGLMVLTMKDLFDKIEERKD--------DKEFEVSLSYLEIYNETIRDLLS-----  154 (338)
T ss_pred             eCCCCCCCeEEEcC------CCCCCchHHHHHHHHHHhhhhccc--------CceEEEEEEEEEEECCEEEECCC-----
Confidence            99999999999999      457899999999999999987642        57899999999999999977773     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       155 --------------------------------------------------------------------------------  154 (338)
T cd01370         155 --------------------------------------------------------------------------------  154 (338)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +.        ..+|+|+++++++++|+|++++.|.+++|++++|+.|..+|++++|.+|.+
T Consensus       155 -------------------~~--------~~~l~i~ed~~~~~~v~gl~~~~v~s~~e~~~~l~~g~~~R~~~~t~~n~~  207 (338)
T cd01370         155 -------------------PS--------SGPLELREDPNQGIVVAGLTEHQPKSAEEILELLMKGNRNRTQEPTEANAT  207 (338)
T ss_pred             -------------------CC--------CCCceEEEcCCCCEEeCCcEEEEeCCHHHHHHHHHHHHhhcccccccccCc
Confidence                               21        356899999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||+|+|.+.....  +.......++|+||||||||.
T Consensus       208 SSRSH~i~~i~i~~~~~~~--~~~~~~~~s~l~~VDLAGsEr  247 (338)
T cd01370         208 SSRSHAVLQITVRQKDRTA--SINQQVRIGKLSLIDLAGSER  247 (338)
T ss_pred             cCcceEEEEEEEEEEecCC--CCCCcEEEEEEEEEECCCCcc
Confidence            9999999999999977532  224556788999999999995


No 4  
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup. Members of this group may play a role in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, a
Probab=100.00  E-value=2.3e-39  Score=308.35  Aligned_cols=157  Identities=31%  Similarity=0.437  Sum_probs=135.0

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|      .+.++|||||++++||+.++.              |.|+|||+|||||+|+|||..    
T Consensus        95 YGqtGSGKTyTm~G------~~~~~Gli~r~~~~lF~~~~~--------------~~v~~S~~EIyne~v~DLL~~----  150 (345)
T cd01368          95 YGVTNSGKTYTMQG------SPGDGGILPRSLDVIFNSIGG--------------YSVFVSYVEIYNNYIYDLLED----  150 (345)
T ss_pred             eCCCCCCCeEEecC------CCCCCchHHHHHHHHHHHHHh--------------eeEEEEEEEEeCCEeEeCCCC----
Confidence            99999999999999      558999999999999999743              899999999999999888842    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       151 --------------------------------------------------------------------------------  150 (345)
T cd01368         151 --------------------------------------------------------------------------------  150 (345)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                          ....  ..+...++|+++++++++|+||+++.|.|++|++++|+.|..+|++++|.+|.+
T Consensus       151 --------------------~~~~--~~~~~~l~i~ed~~~~~~i~gl~~~~v~s~~e~~~~l~~g~~~R~~~~t~~N~~  208 (345)
T cd01368         151 --------------------SPSS--TKKRQSLRLREDHNGNMYVAGLTEVEVSSTEEAREVFKRGQKNRRVAGTKLNRE  208 (345)
T ss_pred             --------------------cccc--ccCCCceEEEECCCCCEEecCCEEEEeCCHHHHHHHHHHhhccceeccccCcCC
Confidence                                1000  011567999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCC---CCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVED---PEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~---~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|+|.+........   ..+....++|+||||||||..
T Consensus       209 SSRSH~i~~i~v~~~~~~~~~~~~~~~~~~~~s~l~~VDLAGsEr~  254 (345)
T cd01368         209 SSRSHSVFTIKLVQAPGDSDGDVDQDKDQITVSQLSLVDLAGSERT  254 (345)
T ss_pred             CCCceEEEEEEEEEeccCcccccccCCCceEEEEEEEEeccccccc
Confidence            9999999999999876533211   234567889999999999963


No 5  
>KOG0245|consensus
Probab=100.00  E-value=2.1e-40  Score=338.94  Aligned_cols=161  Identities=31%  Similarity=0.368  Sum_probs=141.9

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||+|||+|-.    .+++.|||||.|++||.++...+.+       ...|.|.|||+|||||+|+|||+.    
T Consensus        94 YGQTGSGKSYTMMG~~----~~~e~GIIPrlCEeLF~ri~~nq~~-------~~sy~VevSymEIYcErVrDLL~~----  158 (1221)
T KOG0245|consen   94 YGQTGSGKSYTMMGFQ----EPDEPGIIPRLCEELFSRIADNQSQ-------QMSYSVEVSYMEIYCERVRDLLNA----  158 (1221)
T ss_pred             eccCCCCcceeeeccC----CCCCCCchhHHHHHHHHHHhhcccc-------cceEEEEEeehhHHHHHHHHHhhC----
Confidence            9999999999999932    4589999999999999999987643       689999999999999999888731    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       159 --------------------------------------------------------------------------------  158 (1221)
T KOG0245|consen  159 --------------------------------------------------------------------------------  158 (1221)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +.+       +.+|+|||+|-.|+||++|+.+.|+|..|+..+|..|++.|++++|.||+.
T Consensus       159 -------------------p~~-------kg~LRVREHP~lGPYVedLS~~aV~Sy~dI~~~md~GNkqRTtAATnMNdt  212 (1221)
T KOG0245|consen  159 -------------------PKS-------KGGLRVREHPILGPYVEDLSKLAVTSYADIQDLMDEGNKQRTTAATNMNDT  212 (1221)
T ss_pred             -------------------CCC-------CCCceeeccCccChhHhHhhhcccccHHHHHHHHHhcchhhhhhhhccccc
Confidence                               111       788999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|.+.|+...... .-....+|+++||||||||+.
T Consensus       213 SSRSHaVFtIvftQk~~~~~~-~l~sek~SKIsLVDLAGSERa  254 (1221)
T KOG0245|consen  213 SSRSHAVFTIVFTQKKHDQDT-GLDSEKVSKISLVDLAGSERA  254 (1221)
T ss_pred             cccceeEEEEEEEeeeccccC-CCcceeeeeeeEEeccCcccc
Confidence            999999999999998753222 233568899999999999974


No 6  
>KOG0243|consensus
Probab=100.00  E-value=4.2e-40  Score=340.48  Aligned_cols=166  Identities=37%  Similarity=0.458  Sum_probs=133.7

Q ss_pred             CCCCccccccccccccC--CCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhh
Q psy15014          1 MLQTGSGKTYTMGTGFE--TDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITC   78 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~--~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~   78 (286)
                      |||||+||||||.|+..  ....++.+|||||+|.+||..++..          +.+|.|+|||+|+|||.|+|||+.+-
T Consensus       135 YGQTGTGKTyTMeG~~~~~~g~l~~~aGIIPRal~~IFd~Le~~----------~~EYsvKVSfLELYNEEl~DLLa~~~  204 (1041)
T KOG0243|consen  135 YGQTGTGKTYTMEGGERKKNGELPSEAGIIPRALRQIFDTLEAQ----------GAEYSVKVSFLELYNEELTDLLASED  204 (1041)
T ss_pred             ecCCCCCceeeeecCcccccCCCCccCCcchHHHHHHHHHHHhc----------CCeEEEEEEehhhhhHHHHHhcCCcc
Confidence            99999999999999633  3446799999999999999999876          56999999999999999999995200


Q ss_pred             ccccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhh
Q psy15014         79 VQAHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERD  158 (286)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (286)
                                +.+                                                                   
T Consensus       205 ----------~~~-------------------------------------------------------------------  207 (1041)
T KOG0243|consen  205 ----------TSD-------------------------------------------------------------------  207 (1041)
T ss_pred             ----------ccc-------------------------------------------------------------------
Confidence                      000                                                                   


Q ss_pred             HHhhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCC
Q psy15014        159 KVLASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMN  238 (286)
Q Consensus       159 ~~~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N  238 (286)
                                    -..+....          ..+  . +.+++|+|+||.++.|+++.|++++|.+|..+|++|+|.||
T Consensus       208 --------------~~~~~k~~----------~~~--~-~~kggV~vkGlEEi~V~~A~ei~klLekGs~kRrtAaTl~N  260 (1041)
T KOG0243|consen  208 --------------KKLRIKDD----------STI--V-DGKGGVIVKGLEEIIVTNADEIYKLLEKGSKKRRTAATLMN  260 (1041)
T ss_pred             --------------cccccccC----------Ccc--c-CCcCcEEEecceeeeecchhHHHHHHHhhhhHhHHHHHHhh
Confidence                          00111111          111  1 67899999999999999999999999999999999999999


Q ss_pred             CCCCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        239 SQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       239 ~~SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      ++|||||+||+|+|..+.....  .+..+..++|+||||||||-
T Consensus       261 ~~SSRSHsIFsItvhike~t~~--geelvK~GKLNLVDLAGSEN  302 (1041)
T KOG0243|consen  261 DQSSRSHSIFSITVHIKENTPE--GEELVKIGKLNLVDLAGSEN  302 (1041)
T ss_pred             hhccccceEEEEEEEEecCCCc--chhhHhhcccceeecccccc
Confidence            9999999999999998764221  22336677999999999983


No 7  
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group. KIF2 is a protein expressed in neurons, which has been associated with axonal transport and neuron development; alternative splice forms have been implicated in lysosomal translocation. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found in the middle (M-type) of the protein chain. M-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second (KIF2 may be slower). To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and lo
Probab=100.00  E-value=7.6e-39  Score=302.05  Aligned_cols=146  Identities=32%  Similarity=0.406  Sum_probs=132.7

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|      +.+++|||||++++||+.++..          ...|.|++||+|||||+|+|||.     
T Consensus        91 yGqtGSGKTyTm~G------~~~~~Glipr~~~~lf~~~~~~----------~~~~~v~~S~~EIy~e~v~DLL~-----  149 (322)
T cd01367          91 YGQTGSGKTYTMLG------DENQEGLYALAARDIFRLLAQP----------NDDLGVTVSFFEIYGGKLFDLLN-----  149 (322)
T ss_pred             ccCCCCCCceEecC------cCCcCccHHHHHHHHHHHHhcc----------ccccEEEEEEEeeecCchhhhcc-----
Confidence            99999999999999      5588999999999999999775          25899999999999999977773     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       150 --------------------------------------------------------------------------------  149 (322)
T cd01367         150 --------------------------------------------------------------------------------  149 (322)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +         ...++|++++.++++|+|++++.|.|++|++++|..|..+|.+++|.+|..
T Consensus       150 -------------------~---------~~~l~i~~~~~~~~~v~~l~~~~v~s~~e~~~~l~~g~~~R~~~~t~~n~~  201 (322)
T cd01367         150 -------------------D---------RKRLSVLEDGKGNVQIVGLTEKPVTSVDELLELIESGNSLRTTGSTGANDQ  201 (322)
T ss_pred             -------------------C---------ccceeEEEcCCCCEEeCCCEEEEeCCHHHHHHHHHHHhcccccccCcCCCC
Confidence                               2         356899999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|+|.+...        ....++|+||||||||..
T Consensus       202 SSRSH~i~~i~v~~~~~--------~~~~s~l~~vDLAGsE~~  236 (322)
T cd01367         202 SSRSHAILQIILKNKKL--------NKLLGKLSFIDLAGSERG  236 (322)
T ss_pred             cccceEEEEEEEEEecC--------CeeEEEEEEeecCCcccc
Confidence            99999999999998653        446789999999999963


No 8  
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins. KIF1A (Unc104) transports synaptic vesicles to the nerve  terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively.
Probab=100.00  E-value=3.8e-38  Score=300.86  Aligned_cols=160  Identities=38%  Similarity=0.461  Sum_probs=138.4

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|      ...+.|||||++++||+.++....+       ...|.|+|||+|||||+|+|||..    
T Consensus        95 yGqtGSGKT~Tm~G------~~~~~Gli~r~~~~Lf~~~~~~~~~-------~~~~~v~~S~~EIy~e~v~DLL~~----  157 (356)
T cd01365          95 YGQTGSGKSYTMMG------YKEEKGIIPRLCEELFQRIESKKEQ-------NLSYEVEVSYMEIYNEKVRDLLNP----  157 (356)
T ss_pred             ecCCCCCCeEEecC------CCCCCchHHHHHHHHHHHHhhcccc-------CceEEEEEEEEEEECCeeeeCCCC----
Confidence            99999999999999      4568999999999999999876431       568999999999999999888732    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       158 --------------------------------------------------------------------------------  157 (356)
T cd01365         158 --------------------------------------------------------------------------------  157 (356)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                          ...     ....++|++++.++++|+|++++.|.|++|++++|+.|.++|.+++|.+|..
T Consensus       158 --------------------~~~-----~~~~l~i~~~~~~g~~v~gl~~~~v~s~~e~~~~l~~g~~~R~~~~t~~n~~  212 (356)
T cd01365         158 --------------------KKK-----NKGNLKVREHPVLGPYVEDLSKVAVTSYEDIQNLLEEGNKSRTTASTNMNDT  212 (356)
T ss_pred             --------------------Ccc-----CCcCceEEECCCCCEEeCCCEEEEeCCHHHHHHHHHHHHhcccccCCCCCCC
Confidence                                110     1467899999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|+|.+...... ........++|+||||||||..
T Consensus       213 SSRSH~i~~l~v~~~~~~~~-~~~~~~~~s~l~~VDLAGsEr~  254 (356)
T cd01365         213 SSRSHAVFTIVLTQKKLDKE-TDLTTEKVSKISLVDLAGSERA  254 (356)
T ss_pred             cCCceEEEEEEEEEEecccC-CCCCceEEEEEEeeeccccccc
Confidence            99999999999998765321 2344567889999999999964


No 9  
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 
Probab=100.00  E-value=7e-38  Score=296.84  Aligned_cols=162  Identities=36%  Similarity=0.437  Sum_probs=138.5

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|+.+   ...++|||||++++||+.++...         ...|.|++||+|||||+|+|||..    
T Consensus        87 yG~tgSGKTyTm~G~~~---~~~~~Glipr~~~~lf~~~~~~~---------~~~~~v~~S~~Eiy~e~v~DLL~~----  150 (334)
T cd01375          87 YGQTGAGKTFTMTGGTE---SYKDRGLIPRALEQVFREVAMRA---------TKTYTVHVSYLEIYNEQLYDLLGD----  150 (334)
T ss_pred             ecCCCCCCeEEccCCCC---cccCCchHHHHHHHHHHHHHhcc---------CcceEEEEEEEEEECCEeecCCCC----
Confidence            99999999999999643   34688999999999999997753         568999999999999999999842    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       151 --------------------------------------------------------------------------------  150 (334)
T cd01375         151 --------------------------------------------------------------------------------  150 (334)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                          ....  ......++|++++.++++|+|++++.|.+++|++++|..|..+|++++|.+|+.
T Consensus       151 --------------------~~~~--~~~~~~l~i~e~~~~~~~v~gl~~~~v~s~~e~~~~~~~g~~~R~~~~t~~n~~  208 (334)
T cd01375         151 --------------------TPEA--LESLPAVTILEDSEQNIHVKGLSLHSATTEEEALNLLFLGETNRTIAETSMNQA  208 (334)
T ss_pred             --------------------Cccc--cccCCceEEEEcCCCCEEeCCcEEEEeCCHHHHHHHHHHHHhhcccccCcCcCC
Confidence                                0000  001467899999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|+|.+....   ........++|+||||||||..
T Consensus       209 sSRSH~i~~l~v~~~~~~---~~~~~~~~s~l~~VDLAGsEr~  248 (334)
T cd01375         209 SSRSHCIFTIHLESRSRE---AGSEVVRLSKLNLVDLAGSERV  248 (334)
T ss_pred             cCcCeEEEEEEEEEEecC---CCCCceEEEEEEEEECCCCCcc
Confidence            999999999999997542   2344567889999999999863


No 10 
>PLN03188 kinesin-12 family protein; Provisional
Probab=100.00  E-value=4.1e-38  Score=329.12  Aligned_cols=167  Identities=29%  Similarity=0.433  Sum_probs=138.4

Q ss_pred             CCCCccccccccccccCC----CCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchh
Q psy15014          1 MLQTGSGKTYTMGTGFET----DVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHI   76 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~----~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~   76 (286)
                      ||||||||||||+|+..+    .....+.|||||++++||..+......   ..+....|.|+|||+|||||+|+|||. 
T Consensus       172 YGQTGSGKTYTM~G~~~~~~de~~s~~e~GIIPRaledLF~~I~e~q~k---~~d~~~~y~V~vSyLEIYNEkI~DLLs-  247 (1320)
T PLN03188        172 YGQTGSGKTYTMWGPANGLLEEHLSGDQQGLTPRVFERLFARINEEQIK---HADRQLKYQCRCSFLEIYNEQITDLLD-  247 (1320)
T ss_pred             CCCCCCCCCEeeCCCCCcccccccccccCCchHHHHHHHHHHHHhhhhh---ccccccceEEEEEEEeeecCcceeccc-
Confidence            999999999999996432    123578999999999999999764321   112356799999999999999977773 


Q ss_pred             hhccccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhh
Q psy15014         77 TCVQAHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEE  156 (286)
Q Consensus        77 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~  156 (286)
                                                                                                      
T Consensus       248 --------------------------------------------------------------------------------  247 (1320)
T PLN03188        248 --------------------------------------------------------------------------------  247 (1320)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhHHhhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCC
Q psy15014        157 RDKVLASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQ  236 (286)
Q Consensus       157 ~~~~~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~  236 (286)
                                             +.        ..+|+|++++.+++||+||+++.|.+++|++++|..|..+|++++|.
T Consensus       248 -----------------------p~--------~k~L~IRED~kgGv~VeGLTEv~V~S~ED~l~LL~~G~~nR~tasT~  296 (1320)
T PLN03188        248 -----------------------PS--------QKNLQIREDVKSGVYVENLTEEYVKTMKDVTQLLIKGLSNRRTGATS  296 (1320)
T ss_pred             -----------------------cc--------cCCceEEEcCCCCeEeCCCeEEeCCCHHHHHHHHHHHhccceeccCC
Confidence                                   21        45689999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        237 MNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       237 ~N~~SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      +|..|||||+||+|.|.+...... +.......++|+||||||||+.
T Consensus       297 mN~~SSRSHaIFtI~Ves~~k~~~-dg~ss~r~SkLnLVDLAGSER~  342 (1320)
T PLN03188        297 INAESSRSHSVFTCVVESRCKSVA-DGLSSFKTSRINLVDLAGSERQ  342 (1320)
T ss_pred             CCCccCCCceeEEEEEEEeecccC-CCCcceEEEEEEEEECCCchhc
Confidence            999999999999999998653221 1223456789999999999964


No 11 
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Members of this group seem to perform a variety of functions, and have been implicated in neuronal organelle transport and chromosome segregation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain,
Probab=100.00  E-value=1.4e-37  Score=294.71  Aligned_cols=165  Identities=48%  Similarity=0.635  Sum_probs=141.9

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|+........++|||||++++||+.++....        ..+|.|.|||+|||||+|+|||..    
T Consensus        80 yG~tgSGKT~Tm~G~~~~~~~~~~~Giipr~~~~LF~~~~~~~~--------~~~~~v~vS~~EIy~e~v~DLL~~----  147 (341)
T cd01372          80 YGQTGSGKTYTMGTAFTASEDEEEVGIIPRAIQHIFKKIDEKKD--------EPDFQLKVSFLELYNEEVRDLLSP----  147 (341)
T ss_pred             ecCCCCCCcEEecCCCccccccccCChHHHHHHHHHHHHHhccc--------cceEEEEEEEEEeECCeeecCCCC----
Confidence            99999999999999654334568999999999999999987642        468999999999999999888842    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       148 --------------------------------------------------------------------------------  147 (341)
T cd01372         148 --------------------------------------------------------------------------------  147 (341)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                          ...     ....++|++++.++++|.|++++.|.|++|++++|..|..+|.+++|.+|..
T Consensus       148 --------------------~~~-----~~~~l~i~e~~~~~~~i~gl~~~~v~s~~e~~~~l~~g~~~R~~~~t~~n~~  202 (341)
T cd01372         148 --------------------STS-----EKSPIQIREDSKGNIIIVGLTEVTVNSAQEVMSCLEQGSLSRTTASTAMNSQ  202 (341)
T ss_pred             --------------------ccc-----CCCCceEEECCCCCEecCCCEEEEECCHHHHHHHHHHHHHhcccccccCCCc
Confidence                                100     0467899999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccC-----CCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVE-----DPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~-----~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||+|+|.+.......     ........++|+||||||||.
T Consensus       203 sSRsH~i~~i~v~~~~~~~~~~~~~~~~~~~~~~s~l~~VDLAGsE~  249 (341)
T cd01372         203 SSRSHAIFTITLEQTRKNGPIAPMSGDDKNSTLTSKFHFVDLAGSER  249 (341)
T ss_pred             cCcCcEEEEEEEEEEecCCccccccccCCCceeeEEEEEEECCCCcc
Confidence            999999999999998764221     133456788999999999996


No 12 
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to
Probab=100.00  E-value=2.5e-37  Score=291.23  Aligned_cols=154  Identities=32%  Similarity=0.501  Sum_probs=136.7

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|      ...++|||||++++||..++...         ...|.|+|||+|||||+|+|||.     
T Consensus        80 yG~tgSGKT~T~~G------~~~~~Gli~r~~~~lf~~~~~~~---------~~~~~v~~S~~Eiy~e~v~DLL~-----  139 (321)
T cd01374          80 YGQTSSGKTFTMSG------DEQEPGIIPLAVRDIFQRIQDTP---------DREFLLRVSYLEIYNEKIKDLLS-----  139 (321)
T ss_pred             ecCCCCCCceeccC------CCCCCchHHHHHHHHHHHHhccc---------CceEEEEEEEEEEEcCEeEEccC-----
Confidence            99999999999999      45888999999999999997653         46899999999999999977773     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       140 --------------------------------------------------------------------------------  139 (321)
T cd01374         140 --------------------------------------------------------------------------------  139 (321)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +.        ...+++++++.++++|+|++++.|.|++|++++|+.|..+|++++|.+|.+
T Consensus       140 -------------------~~--------~~~l~i~~~~~~~~~v~gl~~~~v~s~~e~~~~l~~~~~~R~~~~t~~n~~  192 (321)
T cd01374         140 -------------------PS--------PQELRIREDPNKGVVVAGLTEEIVTSPEHLLQLIARGEKNRHVGETDFNER  192 (321)
T ss_pred             -------------------CC--------CCCceEEECCCCCEEeCCceEEEeCCHHHHHHHHHHHHhccccccCcCCCc
Confidence                               22        356899999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|+|.+.....  ...+....++|+||||||||..
T Consensus       193 ssRSH~i~~i~v~~~~~~~--~~~~~~~~s~l~~vDLAGsE~~  233 (321)
T cd01374         193 SSRSHTIFQLTIESRERGD--SESGTVRVSTLNLIDLAGSERA  233 (321)
T ss_pred             cccccEEEEEEEEEEecCC--CCCCcEEEEEEEEEECCCCCcc
Confidence            9999999999999976532  1345667899999999999964


No 13 
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins. Subgroup of kinesins, which form heterotrimers composed of 2 kinesins and one non-motor accessory subunit. Kinesins II play important roles in ciliary transport, and have been implicated in neuronal transport, melanosome transport, the secretory pathway, and mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this group the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain
Probab=100.00  E-value=3.5e-37  Score=291.83  Aligned_cols=157  Identities=34%  Similarity=0.478  Sum_probs=136.8

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|..+   ...++|||||++++||+.++...         ...|.|.|||+|||||+|+|||.     
T Consensus        88 yG~tgSGKTyTm~G~~~---~~~~~Glipr~~~~Lf~~~~~~~---------~~~~~v~~S~~Eiy~e~v~DLL~-----  150 (333)
T cd01371          88 YGQTGTGKTFTMEGVRE---PPELRGIIPNSFAHIFGHIAKAE---------NVQFLVRVSYLEIYNEEVRDLLG-----  150 (333)
T ss_pred             cCCCCCCCcEeecCCCC---cccccchHHHHHHHHHHHHhhcc---------CccEEEEEEEEEeeCCeeeeCCC-----
Confidence            99999999999999532   34689999999999999987653         36899999999999999977773     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       151 --------------------------------------------------------------------------------  150 (333)
T cd01371         151 --------------------------------------------------------------------------------  150 (333)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +..       ...+++++++.++++|+||+++.|.+++|++.+|..|..+|++++|.+|.+
T Consensus       151 -------------------~~~-------~~~l~i~~~~~~~~~v~~l~~~~v~s~~~~~~~l~~g~~~R~~~~t~~n~~  204 (333)
T cd01371         151 -------------------KDQ-------KKKLELKERPDRGVYVKDLSMFVVKNAEEMDKLMTLGNKNRSVGATNMNED  204 (333)
T ss_pred             -------------------CCC-------CCceeEEEcCCCCEEeCCCEEEEeCCHHHHHHHHHHHHhhCccccccccCC
Confidence                               111       346889999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||+|+|++.....  ........++|+||||||||.
T Consensus       205 ssRSH~i~~i~v~~~~~~~--~~~~~~~~s~L~~VDLAGsEr  244 (333)
T cd01371         205 SSRSHSIFTITIECSEKGE--DGENHIRVGKLNLVDLAGSER  244 (333)
T ss_pred             CCCCcEEEEEEEEEEeccC--CCCCcEEEEEEEEEECCCCCc
Confidence            9999999999999876532  234456788999999999986


No 14 
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup. Members of this group might play a role in regulating chromosomal movement along microtubules in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through
Probab=100.00  E-value=2.8e-37  Score=290.91  Aligned_cols=147  Identities=33%  Similarity=0.370  Sum_probs=132.2

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|      ...++|||||++++||+.++..          ...+.|++||+|||||+|+|||.     
T Consensus        87 yG~tgSGKTyTm~G------~~~~~Glipr~~~~Lf~~~~~~----------~~~~~v~~S~~EIy~e~v~DLL~-----  145 (319)
T cd01376          87 YGSTGAGKTHTMLG------DPNEPGLIPRTLSDLLRMGRKQ----------AWTGAFSMSYYEIYNEKVYDLLE-----  145 (319)
T ss_pred             ECCCCCCCcEEEeC------CcCccchHHHHHHHHHHHHhhc----------cccceEEEEEEEEECCEeeEccC-----
Confidence            99999999999999      4568999999999999988664          36899999999999999977773     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       146 --------------------------------------------------------------------------------  145 (319)
T cd01376         146 --------------------------------------------------------------------------------  145 (319)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +.        ...++|+++++++++|+|+++++|.+++|++++|..|.++|.+++|.+|..
T Consensus       146 -------------------~~--------~~~l~i~~~~~~~~~v~gl~~~~v~s~~e~~~~l~~~~~~R~~~~t~~n~~  198 (319)
T cd01376         146 -------------------PA--------KKELPIREDKDGNILIVGLTSKPIKSMAEFEEAYIPASKNRTVAATKLNDN  198 (319)
T ss_pred             -------------------CC--------CCCceEEEcCCCCEEeeCCEEEEeCCHHHHHHHHHHHHhhhccccCcCCCc
Confidence                               22        356889999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||+|+|.+...       .....++|+||||||||.
T Consensus       199 SSRSH~i~~i~v~~~~~-------~~~~~s~l~~VDLAGsE~  233 (319)
T cd01376         199 SSRSHAVLRIKVTQPAS-------NIQLEGKLNLIDLAGSED  233 (319)
T ss_pred             cCCCeEEEEEEEEEECC-------CceEEEEEEEEECCCCCc
Confidence            99999999999998643       236788999999999995


No 15 
>KOG0242|consensus
Probab=100.00  E-value=2.7e-38  Score=322.54  Aligned_cols=150  Identities=37%  Similarity=0.521  Sum_probs=135.7

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||.|      ...++||||+++.+||..|....         ...|.|.+||+|||||.|+|||.     
T Consensus        93 YG~TgSGKTyTM~G------~~~~PGii~la~~dif~~I~~~~---------~r~f~v~vSYlEIYNE~I~DLL~-----  152 (675)
T KOG0242|consen   93 YGQTGSGKTYTMSG------SEDDPGIIPLAMKDIFEKIDKSG---------EREFSVRVSYLEIYNERIRDLLN-----  152 (675)
T ss_pred             ecCCCCCCceEEec------cCCCCCeeehHHHHHHHHHHhcC---------CceeEEEEEEEEEeccccccccC-----
Confidence            99999999999999      77889999999999999998853         56899999999999999977773     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       153 --------------------------------------------------------------------------------  152 (675)
T KOG0242|consen  153 --------------------------------------------------------------------------------  152 (675)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +.        ...|+|+||+.++++|.||+++.|.|+++++.+|..|..+|+++.|.+|..
T Consensus       153 -------------------~~--------~~~L~irED~~~gi~V~gL~e~~v~s~e~~~~ll~~g~~~R~~g~T~~N~~  205 (675)
T KOG0242|consen  153 -------------------PD--------GGDLRLREDSEGGIVVPGLTEETVSSREELLELLQKGNKNRTTGETNLNEQ  205 (675)
T ss_pred             -------------------CC--------CCCceEeEcCCCCEEecCCeeecCCCHHHHHHHHHHhhccCcccccccccc
Confidence                               22        345999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|.|.+......     . ..++|+||||||||..
T Consensus       206 SSRSHaIl~i~i~s~~~~~~-----~-~~s~L~lIDLAGSERa  242 (675)
T KOG0242|consen  206 SSRSHAILRITVESRGREAS-----S-RVSKLNLIDLAGSERA  242 (675)
T ss_pred             cchhhheeeEEEEecccccc-----c-hhheehhhhhhhhhhh
Confidence            99999999999999775332     1 6779999999999964


No 16 
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup. Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-c
Probab=100.00  E-value=3.4e-37  Score=290.54  Aligned_cols=154  Identities=38%  Similarity=0.591  Sum_probs=136.2

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|+..   ..++.|||||++++||+.+.....        ..+|.|++||+|||||+++|||+     
T Consensus        83 yG~tgSGKT~Tm~G~~~---~~~~~Giipr~~~~Lf~~~~~~~~--------~~~~~v~~S~~EIy~e~v~DLL~-----  146 (325)
T cd01369          83 YGQTGSGKTYTMEGPPG---DPELKGIIPRIVHDIFEHISSMDE--------NLEFHVKVSYLEIYMEKIRDLLD-----  146 (325)
T ss_pred             eCCCCCCceEEecCCCC---ccccCChHHHHHHHHHHHHhhccC--------CceEEEEEEEEEEECCChhhccc-----
Confidence            99999999999999543   245899999999999999987632        56899999999999999977773     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       147 --------------------------------------------------------------------------------  146 (325)
T cd01369         147 --------------------------------------------------------------------------------  146 (325)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +.        ...+++++++.++++|+|++++.|.|++|++++|..|..+|++++|.+|..
T Consensus       147 -------------------~~--------~~~l~i~~~~~~~~~v~gl~~~~v~s~~e~~~~i~~~~~~R~~~~t~~n~~  199 (325)
T cd01369         147 -------------------VS--------KDNLQVHEDKNRGVYVKGLTERFVSSPEEVLEVINEGKSNRAVASTNMNEE  199 (325)
T ss_pred             -------------------Cc--------cCCceEEEcCCCCEEEcCCEEEEcCCHHHHHHHHHHHHhhcccccCcCCCc
Confidence                               21        456889999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||+|+|.+...     ..+....++|+||||||||.
T Consensus       200 ssRSH~i~~i~v~~~~~-----~~~~~~~s~l~~VDLAGsE~  236 (325)
T cd01369         200 SSRSHSIFLITLKQENV-----ETGSKKRGKLFLVDLAGSEK  236 (325)
T ss_pred             cccccEEEEEEEEEEec-----CCCCEEEEEEEEEECCCCCc
Confidence            99999999999998764     23446788999999999996


No 17 
>KOG0240|consensus
Probab=100.00  E-value=5.8e-38  Score=307.04  Aligned_cols=154  Identities=36%  Similarity=0.546  Sum_probs=138.7

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||.|...   ++...|||||++.+||..|.....        +..|.|++||||||+|+|+|||+     
T Consensus        89 YGqT~sGKTytm~G~~~---d~~~~GIipRi~~diF~~Iys~~~--------n~efhVkVsy~EIYmEKi~DLL~-----  152 (607)
T KOG0240|consen   89 YGQTGSGKTYTMEGIGH---DPEEMGIIPRILNDIFDHIYSMEE--------NLEFHVKVSYFEIYMEKIRDLLD-----  152 (607)
T ss_pred             ecCCCCCcceeecccCC---ChhhcCcHHHHHHHHHHHHhcCcc--------cceEEEEEEeehhhhhHHHHHhC-----
Confidence            99999999999998533   456779999999999999998743        67999999999999999977763     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       153 --------------------------------------------------------------------------------  152 (607)
T KOG0240|consen  153 --------------------------------------------------------------------------------  152 (607)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +.        +.+|.|++|.+..+||+|++++.|.+.+++++.|..|..+|.++.|.||.+
T Consensus       153 -------------------~~--------k~nlsvheDK~~v~~vkG~t~~~v~s~d~v~~~i~~g~~nr~va~t~mn~~  205 (607)
T KOG0240|consen  153 -------------------PE--------KTNLSVHEDKNRVPYVKGVTERFVSSPDEVLDVIDEGKSNRHVAVTNMNEH  205 (607)
T ss_pred             -------------------cc--------cCCceeecccCCCceecCceeEEecCHHHHHHHHhcccccchhhhcccccc
Confidence                               22        788999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||+|+|+|...     .......++|+||||||||.
T Consensus       206 sSRSHsIF~i~VkQ~n~-----e~~~~~~gkLyLVDLaGSEk  242 (607)
T KOG0240|consen  206 SSRSHSIFLIHVKQENV-----EDKRKLSGKLYLVDLAGSEK  242 (607)
T ss_pred             ccccceEEEEEEEeccc-----cchhhccccEEEEEcccccc
Confidence            99999999999999764     44556778999999999996


No 18 
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil d
Probab=100.00  E-value=8.9e-37  Score=290.76  Aligned_cols=161  Identities=35%  Similarity=0.470  Sum_probs=136.9

Q ss_pred             CCCCccccccccccccCCC-----CCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccch
Q psy15014          1 MLQTGSGKTYTMGTGFETD-----VSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEH   75 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~-----~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~   75 (286)
                      ||||||||||||+|+....     ...+.+|||||++.+||+.++..          ...|.|+|||+|||||+|+|||+
T Consensus        88 yG~tgSGKTyTl~G~~~~~~~~~~~~~~~~Glipr~~~~Lf~~~~~~----------~~~~~v~~S~~EIy~e~v~DLL~  157 (352)
T cd01364          88 YGQTGTGKTYTMEGDRTDNKGSTWELSPHAGIIPRALYQLFEKLESQ----------NTEYSVKVSYLELYNEELFDLLS  157 (352)
T ss_pred             CCCCCCCCcEEecCCCcccccccccccccCCchHHHHHHHHHHHHhc----------cceeEEEEEEEEeeCCeeeeCCC
Confidence            9999999999999965432     12567999999999999999875          46899999999999999988874


Q ss_pred             hhhccccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhh
Q psy15014         76 ITCVQAHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEE  155 (286)
Q Consensus        76 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~  155 (286)
                      .                                                                               
T Consensus       158 ~-------------------------------------------------------------------------------  158 (352)
T cd01364         158 S-------------------------------------------------------------------------------  158 (352)
T ss_pred             C-------------------------------------------------------------------------------
Confidence            2                                                                               


Q ss_pred             hhhHHhhhcccCCCccccccccCCCCCccccccCCCCceEEEc--CCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcc
Q psy15014        156 ERDKVLASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHED--SGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTA  233 (286)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~--~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~  233 (286)
                                               ..     .....++|+++  ..++++|+|++++.|.|++|++++|+.|..+|+++
T Consensus       159 -------------------------~~-----~~~~~l~i~e~~~~~~g~~v~gl~~~~v~s~~e~~~~l~~g~~~R~~~  208 (352)
T cd01364         159 -------------------------ES-----DLNKPLRIFDDTNNKGGVVIQGLEEITVNNANEGLKLLEKGSAKRKTA  208 (352)
T ss_pred             -------------------------cc-----ccCccceEEeccCcCCCEEeCCcEEEEeCCHHHHHHHHHHHhhhcccc
Confidence                                     11     01567999999  58999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        234 STQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       234 sT~~N~~SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      +|.+|..|||||+||+|+|.+......  .......++|+||||||||.
T Consensus       209 ~t~~n~~sSRSH~i~~i~i~~~~~~~~--~~~~~~~s~l~~VDLAGsE~  255 (352)
T cd01364         209 ATLMNDQSSRSHSIFSITIHIKETTIS--GEELVKIGKLNLVDLAGSEN  255 (352)
T ss_pred             cCcCCCCCCCCceEEEEEEEEeccCCC--CCccEEEEEEEEEECCCccc
Confidence            999999999999999999998764221  22334678999999999995


No 19 
>KOG0247|consensus
Probab=100.00  E-value=7.4e-38  Score=312.87  Aligned_cols=87  Identities=32%  Similarity=0.437  Sum_probs=80.0

Q ss_pred             ceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCCCCCCceeEEEEEEEeeecccCCCCCceeEEEE
Q psy15014        193 IKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLL  272 (286)
Q Consensus       193 l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L  272 (286)
                      ..+++|.++.+||+|++||+|.+.+||+++|+.|.++|++++|.+|+.|||||+||+|+|.+....   .....+..|.|
T Consensus       257 ~ll~~d~~~~~~Vkgl~~V~VssseEA~~l~~lGqk~r~~asT~lN~~SSRSHsVFtIkl~q~~~~---~~s~~i~vSql  333 (809)
T KOG0247|consen  257 KLLREDTNGNMYVKGLTEVEVSSSEEALELFQLGQKRRRVASTKLNANSSRSHSVFTIKLVQAPRS---QDSNQITVSQL  333 (809)
T ss_pred             hhhhhccCCCeeeccccEEEeccHHHHHHHHHHHHhhhhhhheeccccccccceeEEEEeeecccc---cccCceeEEee
Confidence            557899999999999999999999999999999999999999999999999999999999996642   24566889999


Q ss_pred             EEEeCCCCcC
Q psy15014        273 FLTFPTGSAS  282 (286)
Q Consensus       273 ~lVDLAGS~~  282 (286)
                      .||||||||+
T Consensus       334 sLvDLAGSER  343 (809)
T KOG0247|consen  334 SLVDLAGSER  343 (809)
T ss_pred             eeeecccchh
Confidence            9999999997


No 20 
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for mi
Probab=100.00  E-value=3.2e-36  Score=284.24  Aligned_cols=156  Identities=39%  Similarity=0.495  Sum_probs=138.6

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||+|||||||||+|      ..+++|||||++++||+.++...++       ...|.|++||+|||||+|+|||..    
T Consensus        84 yG~tgSGKT~tl~G------~~~~~Gli~r~~~~lf~~~~~~~~~-------~~~~~v~~S~~EIy~e~v~DLL~~----  146 (329)
T cd01366          84 YGQTGSGKTYTMEG------PPENPGIIPRALEQLFNTAEELKEK-------GWSYTITASMLEIYNETIRDLLAT----  146 (329)
T ss_pred             eCCCCCCCcEEecC------CCCCCCcHHHHHHHHHHHHHhhhcc-------CceEEEEEEEEEEECCEeEECCCC----
Confidence            89999999999999      5588999999999999999886532       578999999999999999888742    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       147 --------------------------------------------------------------------------------  146 (329)
T cd01366         147 --------------------------------------------------------------------------------  146 (329)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                          ..     .....++|+++++++++|+|++++.|.|++|++++|..|..+|.+++|.+|..
T Consensus       147 --------------------~~-----~~~~~l~i~~~~~~~~~i~~l~~~~v~s~~e~~~~l~~~~~~R~~~~t~~n~~  201 (329)
T cd01366         147 --------------------KP-----APKKKLEIKHDSKGETYVTNLTEVPVSSPEEVTRLLNLGSKNRSVASTNMNEH  201 (329)
T ss_pred             --------------------Cc-----CCCCceEEEECCCCCEEecCCEEEEeCCHHHHHHHHHHHHhhcccccccccCC
Confidence                                10     01567999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|+|.+....     .+....++|+||||||||..
T Consensus       202 sSRsH~i~~i~v~~~~~~-----~~~~~~s~l~~VDLaGsE~~  239 (329)
T cd01366         202 SSRSHAVFQLKIRGTNLQ-----TGEQTRGKLNLVDLAGSERL  239 (329)
T ss_pred             CCCccEEEEEEEEEEcCC-----CCcEEEEEEEEEECCCCccc
Confidence            999999999999987642     45667889999999999963


No 21 
>PF00225 Kinesin:  Kinesin motor domain;  InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport. The kinesin motor activity is directed toward the microtubule's plus end. Kinesin is an oligomeric complex composed of two heavy chains and two light chains. The maintenance of the quaternary structure does not require interchain disulphide bonds. The heavy chain is composed of three structural domains: a large globular N-terminal domain which is responsible for the motor activity of kinesin (it is known to hydrolyse ATP, to bind and move on microtubules), a central alpha-helical coiled coil domain that mediates the heavy chain dimerisation; and a small globular C-terminal domain which interacts with other proteins (such as the kinesin light chains), vesicles and membranous organelles. A number of proteins have been recently found that contain a domain similar to that of the kinesin 'motor' domain [, ]:   Drosophila melanogaster claret segregational protein (ncd). Ncd is required for normal chromosomal segregation in meiosis, in females, and in early mitotic divisions of the embryo. The ncd motor activity is directed toward the microtubule's minus end.  Homo sapiens CENP-E []. CENP-E is a protein that associates with kinetochores during chromosome congression, relocates to the spindle midzone at anaphase, and is quantitatively discarded at the end of the cell division. CENP-E is probably an important motor molecule in chromosome movement and/or spindle elongation. H. sapiens mitotic kinesin-like protein-1 (MKLP-1), a motor protein whose activity is directed toward the microtubule's plus end.  Saccharomyces cerevisiae KAR3 protein, which is essential for nuclear fusion during mating. KAR3 may mediate microtubule sliding during nuclear fusion and possibly mitosis. S. cerevisiae CIN8 and KIP1 proteins which are required for the assembly of the mitotic spindle. Both proteins seem to interact with spindle microtubules to produce an outwardly directed force acting upon the poles.  Emericella nidulans (Aspergillus nidulans) bimC, which plays an important role in nuclear division. A. nidulans klpA.  Caenorhabditis elegans unc-104, which may be required for the transport of substances needed for neuronal cell differentiation. C. elegans osm-3.  Xenopus laevis Eg5, which may be involved in mitosis.  Arabidopsis thaliana KatA, KatB and katC.  Chlamydomonas reinhardtii FLA10/KHP1 and KLP1. Both proteins seem to play a role in the rotation or twisting of the microtubules of the flagella. C. elegans hypothetical protein T09A5.2.   The kinesin motor domain is located in the N-terminal part of most of the above proteins, with the exception of KAR3, klpA, and ncd where it is located in the C-terminal section. The kinesin motor domain contains about 330 amino acids. An ATP-binding motif of type A is found near position 80 to 90, the C-terminal half of the domain is involved in microtubule-binding.; GO: 0003777 microtubule motor activity, 0005524 ATP binding, 0007018 microtubule-based movement; PDB: 3NWN_A 2Y5W_A 2Y65_C 3BFN_A 2WBE_C 2ZFL_A 2ZFI_A 1I6I_A 2ZFM_A 1IA0_K ....
Probab=100.00  E-value=4.8e-36  Score=282.86  Aligned_cols=163  Identities=40%  Similarity=0.560  Sum_probs=137.3

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||+|||||||||+|+    ....++|||||++++||+.++.....      ....+.|+|||+|||||+|+|||..    
T Consensus        81 yG~tgSGKT~Tm~G~----~~~~~~Gli~~~~~~lf~~~~~~~~~------~~~~~~v~vS~~EIy~e~v~DLL~~----  146 (335)
T PF00225_consen   81 YGQTGSGKTYTMFGS----NDPSEPGLIPRALRDLFSQIEERKEK------SGYEFSVSVSYLEIYNEKVYDLLSP----  146 (335)
T ss_dssp             EESTTSSHHHHHTBS----TSTTTBSHHHHHHHHHHHHHHHHTTT------STEEEEEEEEEEEEETTEEEETTST----
T ss_pred             ecccccccccccccc----ccccccchhhhHHHHHhhhhcccccc------ccccccccccchhhhhhhhhhhcCc----
Confidence            899999999999994    13789999999999999999886431      0258999999999999999888742    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       147 --------------------------------------------------------------------------------  146 (335)
T PF00225_consen  147 --------------------------------------------------------------------------------  146 (335)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCc-EEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHS-IYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNS  239 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~-v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~  239 (286)
                                          ...    .....++|++++..+ ++|+|++++.|.+++|++++|..|..+|+++.|.+|.
T Consensus       147 --------------------~~~----~~~~~l~i~~~~~~g~~~i~~l~~~~v~s~~~~~~~l~~~~~~R~~~~t~~n~  202 (335)
T PF00225_consen  147 --------------------NNS----KSRKPLKIREDSNKGSVYIKGLTEVEVKSAEEALQLLKKGQKNRRTASTKMNA  202 (335)
T ss_dssp             --------------------TSS----STTSEBEEEEETTTEEEEETTSEEEEESSHHHHHHHHHHHHHHHTCTSSSCTH
T ss_pred             --------------------ccc----ccccccceeeccccccceeeccccccccccccccccccchhhccccccccccc
Confidence                                110    014579999999866 9999999999999999999999999999999999999


Q ss_pred             CCCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        240 QSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       240 ~SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      .|||||+||+|+|.+......... .....++|.||||||||.
T Consensus       203 ~sSRSH~i~~i~v~~~~~~~~~~~-~~~~~s~l~~vDLaGsE~  244 (335)
T PF00225_consen  203 RSSRSHAIFTIHVEQKDRDPSDDE-ESVKHSRLTFVDLAGSER  244 (335)
T ss_dssp             HGGGSEEEEEEEEEEEETTTTTEE-EEEEEEEEEEEEEEESTG
T ss_pred             cccccccccccccccccccccccc-cceeecceeeeecccccc
Confidence            999999999999999875322111 125788999999999996


No 22 
>smart00129 KISc Kinesin motor, catalytic domain. ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division.
Probab=100.00  E-value=9.8e-35  Score=274.36  Aligned_cols=154  Identities=40%  Similarity=0.561  Sum_probs=136.5

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||+|||||||||+|      +.+++|||||++++||+.+....+        ...+.|++||+|||||+|+|||.     
T Consensus        86 yG~tgSGKT~tl~G------~~~~~Gli~~~~~~Lf~~~~~~~~--------~~~~~v~~S~~ei~~e~v~DLL~-----  146 (335)
T smart00129       86 YGQTGSGKTYTMSG------TPDSPGIIPRALKDLFEKIDKLEE--------GWQFQVKVSYLEIYNEKIRDLLN-----  146 (335)
T ss_pred             eCCCCCCCceEecC------CCCCCCHHHHHHHHHHHHhhhccc--------CceEEEEEEEEEEECCEEEECcC-----
Confidence            89999999999999      457889999999999999977542        56899999999999999977763     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       147 --------------------------------------------------------------------------------  146 (335)
T smart00129      147 --------------------------------------------------------------------------------  146 (335)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +.        ...++|++++.++++++|++++.|.|++|++++|..|..+|.+++|.+|..
T Consensus       147 -------------------~~--------~~~l~i~~~~~~~~~i~~l~~~~v~s~~e~~~~l~~~~~~R~~~~t~~n~~  199 (335)
T smart00129      147 -------------------PS--------PKKLEIREDKKGGVYVKGLTEISVSSFEEVYNLLEKGNKNRTVAATKMNEE  199 (335)
T ss_pred             -------------------CC--------CCCcEEEECCCCCEEecCCEEEEeCCHHHHHHHHHHHHhccccccCCCCCC
Confidence                               22        456899999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|+|.+...   +...+....++|.||||||||..
T Consensus       200 ssRsH~i~~l~v~~~~~---~~~~~~~~~s~l~~VDLaGse~~  239 (335)
T smart00129      200 SSRSHAVFTITVESKIK---NSSSGSGKASKLNLVDLAGSERA  239 (335)
T ss_pred             CCcceEEEEEEEEEEec---CCCCCCEEEEEEEEEECCCCCcc
Confidence            99999999999998743   23445567889999999999864


No 23 
>cd00106 KISc Kinesin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coil
Probab=100.00  E-value=1.1e-34  Score=272.79  Aligned_cols=157  Identities=41%  Similarity=0.524  Sum_probs=137.3

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||+|||||||||+|      +..++|||||++++||+.++....       ....+.|.+||+|||||+|+|||..    
T Consensus        85 yG~tgSGKT~tl~G------~~~~~Gli~~~~~~Lf~~~~~~~~-------~~~~~~v~~S~~Ei~~e~v~DLL~~----  147 (328)
T cd00106          85 YGQTGSGKTYTMFG------SPKDPGIIPRALEDLFNLIDERKE-------KNKSFSVSVSYLEIYNEKVYDLLSP----  147 (328)
T ss_pred             ecCCCCCCeEEecC------CCCCCchHHHHHHHHHHHHhhccc-------cCceEEEEEEEEEEECCEeEECCCC----
Confidence            89999999999999      568899999999999999987632       1468999999999999999888742    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       148 --------------------------------------------------------------------------------  147 (328)
T cd00106         148 --------------------------------------------------------------------------------  147 (328)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                          ..      ....++|++++.++++|+|++++.|.|++|++++|..|..+|+.++|.+|..
T Consensus       148 --------------------~~------~~~~l~i~~~~~~~~~v~~l~~~~v~s~~e~~~~l~~~~~~R~~~~t~~n~~  201 (328)
T cd00106         148 --------------------EP------PSKPLSLREDPKGGVYVKGLTEVEVGSAEDALSLLQKGLKNRTTASTAMNER  201 (328)
T ss_pred             --------------------CC------CCCCcEEEEcCCCCEEEeCCEEEEeCCHHHHHHHHHHHHhhcCcccCcCCCC
Confidence                                11      1567899999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|+|.+.....   .......++|.||||||||..
T Consensus       202 ssRSH~i~~i~v~~~~~~~---~~~~~~~s~l~~VDLaGse~~  241 (328)
T cd00106         202 SSRSHAIFTIHVEQRNTTN---DGRSIKSSKLNLVDLAGSERA  241 (328)
T ss_pred             cCcCcEEEEEEEEEEecCC---CCccEEEEEEEEEECCCCCcc
Confidence            9999999999999976522   111367889999999999964


No 24 
>KOG0239|consensus
Probab=100.00  E-value=2.7e-35  Score=299.92  Aligned_cols=154  Identities=33%  Similarity=0.377  Sum_probs=138.9

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||.|+     +++++|||||++.+||..++....        .+.|.+.++|+|||||.|+|||..    
T Consensus       399 YGQTGSGKTyTM~G~-----~~~~~Giipral~~lF~~~~~~~~--------g~~y~~~~s~~EIYNe~i~DlL~~----  461 (670)
T KOG0239|consen  399 YGQTGSGKTYTMSGP-----TPEDPGIIPRALEKLFRTITSLKS--------GWKYDKTVSMLEIYNEAIRDLLSD----  461 (670)
T ss_pred             ecccCCCccccccCC-----CcccCCccHHHHHHHHHHHHhhcc--------CceEEeeeehhHHHHHHHHHhccc----
Confidence            999999999999985     578999999999999999998753        789999999999999999888842    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       462 --------------------------------------------------------------------------------  461 (670)
T KOG0239|consen  462 --------------------------------------------------------------------------------  461 (670)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                          ..      ....+.|++++++..+|.+++.+.|.+.+|+..+|+.|..+|++++|.+|.+
T Consensus       462 --------------------~~------~~~k~~I~~~~~~~~~V~~~t~~~V~s~~~v~~ll~~g~~nRsv~~T~~Ne~  515 (670)
T KOG0239|consen  462 --------------------ES------YVGKLEIVDDAEGNLMVPLLTVIKVGSSEEVDILLEIGLSNRSVASTASNER  515 (670)
T ss_pred             --------------------cc------cccceeEEEcCCCceecccceEEecCCHHHHHHHHHHhhccccccccccchh
Confidence                                11      0567899999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||+|+|....     ...+....+.|+||||||||+
T Consensus       516 SSRSH~v~~v~v~g~~-----~~t~~~~~g~l~LVDLAGSER  552 (670)
T KOG0239|consen  516 SSRSHLVFRVRIRGIN-----ELTGIRVTGVLNLVDLAGSER  552 (670)
T ss_pred             hhccceEEEEEEeccc-----cCcccccccceeEeecccCcc
Confidence            9999999999999864     355666777999999999997


No 25 
>KOG0246|consensus
Probab=100.00  E-value=1.5e-34  Score=282.97  Aligned_cols=155  Identities=28%  Similarity=0.387  Sum_probs=139.3

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|++.+.......||.-.+.+++|..+....-+       ..++.|+++|||||+.++||||..    
T Consensus       298 YGQTGSGKT~TMggdfsgk~q~~s~giya~aa~Dvf~~L~~p~Y~-------~~~l~v~~tFFEIYgGKvfDLL~~----  366 (676)
T KOG0246|consen  298 YGQTGSGKTYTMGGDFSGKAQDCSKGIYALAARDVFRLLRQPTYR-------KLDLKVYVTFFEIYGGKVYDLLND----  366 (676)
T ss_pred             eccCCCCceeecccccCcccccccccchhhhhhHHHHHhcccchh-------hcceEEEEEEEEEeCcchhhhhcc----
Confidence            999999999999999988878889999999999999999874322       568999999999999999888731    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       367 --------------------------------------------------------------------------------  366 (676)
T KOG0246|consen  367 --------------------------------------------------------------------------------  366 (676)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                                   +.+|.+.||.+.+|.|.||++..|.+.+|++++|..|...|+++.|..|++
T Consensus       367 -----------------------------k~KLrvLEDg~QQVqVVGLqE~~v~~~eeVl~lIe~Gns~RtsG~TsANs~  417 (676)
T KOG0246|consen  367 -----------------------------KKKLRVLEDGNQQVQVVGLQEEEVSGVEEVLELIEKGNSCRTSGQTSANSN  417 (676)
T ss_pred             -----------------------------ccceEEeecCCceEEEeeceeeeccCHHHHHHHHHhcccccccCcccCccc
Confidence                                         688999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      ||||||||+|-|....        +.-..+++.||||||+|+.
T Consensus       418 SSRSHAvfQIilr~~~--------~~k~hGKfSlIDLAGnERG  452 (676)
T KOG0246|consen  418 SSRSHAVFQIILRKHG--------EFKLHGKFSLIDLAGNERG  452 (676)
T ss_pred             ccccceeEeeeeecCC--------cceeEeEEEEEEccCCccC
Confidence            9999999999998632        1234569999999999974


No 26 
>KOG0241|consensus
Probab=100.00  E-value=1.4e-33  Score=286.07  Aligned_cols=159  Identities=35%  Similarity=0.440  Sum_probs=140.3

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||.|      ..+++|||||.+..||.+|....       .+...|.|.+||+|||||+++|||      
T Consensus       100 YGQtGsGKsYsmmG------t~~QpGiIPrlc~~lFe~I~k~~-------n~~~tfkVeVSymEIynEkv~DLL------  160 (1714)
T KOG0241|consen  100 YGQTGSGKSYSMMG------TAEQPGIIPRLCESLFERIDKES-------NPSQTFKVEVSYMEIYNEKVRDLL------  160 (1714)
T ss_pred             ecccCCCceeEeec------cCCCCCchhHHHHHHHHHHHhcc-------CCCceEEEEEEHHHHhhcchhhhh------
Confidence            99999999999999      78999999999999999998864       457899999999999999996666      


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       161 --------------------------------------------------------------------------------  160 (1714)
T KOG0241|consen  161 --------------------------------------------------------------------------------  160 (1714)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                        +|...      ...|+++++.-.|.||.||.+..|.|++|+-.+|..|.+.|+++.|.||..
T Consensus       161 ------------------dPk~s------sqtlkVrehsvlGp~vdGLS~laV~S~qdId~lm~egnKsrtvaatnmn~E  216 (1714)
T KOG0241|consen  161 ------------------DPKGS------SQTLKVREHSVLGPYVDGLSQLAVTSFQDIDSLMSEGNKSRTVAATNMNEE  216 (1714)
T ss_pred             ------------------CCCCC------cceeEEeecccccccccchhhhhcccHHHHHHHHHhccccceeeeeccccc
Confidence                              33322      567999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||.|.|.|.-......-. ....++|.||||||||..
T Consensus       217 ssrsHaVFslvvtQ~l~D~ktg~S-geKvsklslVDLAgsera  258 (1714)
T KOG0241|consen  217 SSRSHAVFSLVVTQTLYDLKTGHS-GEKVSKLSLVDLAGSERA  258 (1714)
T ss_pred             ccccceeEEEEEeeEEeccccCcc-hhheeeeeEEEecccccc
Confidence            999999999999997653333322 236789999999999864


No 27 
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]
Probab=99.96  E-value=7.7e-30  Score=257.06  Aligned_cols=152  Identities=39%  Similarity=0.562  Sum_probs=133.5

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||.|      ..++.||||+++.+||+.+.....        ..++.|.+||+|||||+++|||.     
T Consensus        96 yGqTgsgKtyt~~G------~~~~~Gii~~~l~~lf~~l~~~~~--------~~~~~v~is~lEiYnEk~~DLl~-----  156 (568)
T COG5059          96 YGQTGSGKTYTMSG------TEEEPGIIPLSLKELFSKLEDLSM--------TKDFAVSISYLEIYNEKIYDLLS-----  156 (568)
T ss_pred             EcccCCCceeEeec------CccccchHHHHHHHHHHHHHhccc--------CcceeeEeehhHHHhhHHHhhcc-----
Confidence            99999999999999      568999999999999999988743        46899999999999999988873     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       157 --------------------------------------------------------------------------------  156 (568)
T COG5059         157 --------------------------------------------------------------------------------  156 (568)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +.        ...+.++++...+|+|.|++++.|.+.+|++.+|+.|..+|+++.|.+|+.
T Consensus       157 -------------------~~--------~~~~~~~~~~~~~v~v~~l~~~~~~s~ee~l~~l~~~~~nr~~~~te~n~~  209 (568)
T COG5059         157 -------------------PN--------EESLNIREDSLLGVKVAGLTEKHVSSKEEILDLLRKGEKNRTTASTEINDE  209 (568)
T ss_pred             -------------------Cc--------cccccccccCCCceEeecceEEecCChHHHHHHHHHhhhhcccccchhccc
Confidence                               11        111668899999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||+|.+.+.....     +....++|+||||||||..
T Consensus       210 ssRshsi~~i~~~~~~~~~-----~~~~~~~l~lvDLagSE~~  247 (568)
T COG5059         210 SSRSHSIFQIELASKNKVS-----GTSETSKLSLVDLAGSERA  247 (568)
T ss_pred             cccceEEEEEEEEEeccCc-----cceecceEEEEeecccccc
Confidence            9999999999999986432     3333468999999999974


No 28 
>KOG0244|consensus
Probab=99.95  E-value=8.4e-31  Score=268.20  Aligned_cols=157  Identities=41%  Similarity=0.532  Sum_probs=132.7

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||++.+....+  +.|||||++..||.++....         ...|.|.++|+|||+|.|+||+.     
T Consensus        72 ygQtgsgkTytmgt~~~~~~~--~~Gvipr~v~~~f~~i~~~~---------~~~f~i~vs~vely~e~v~dl~~-----  135 (913)
T KOG0244|consen   72 YGQTGSGKTYTMGTNDAPAQD--TVGVIPRAVSTLFTRIGKTE---------SFVFRITVSFVELYNEEVLDLLK-----  135 (913)
T ss_pred             ecccCCCceeecccccccccc--cCCcCcchHHHHHHHHHhhh---------ccceeeeeeeeeccchhhhhhcC-----
Confidence            999999999999875443322  27999999999999999875         36799999999999999988872     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       136 --------------------------------------------------------------------------------  135 (913)
T KOG0244|consen  136 --------------------------------------------------------------------------------  135 (913)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +...      ..++++++ +++++.+.||+++.|.+..+++..|..|...|++++|.||.+
T Consensus       136 -------------------~~~~------~~~i~~~e-~~g~it~~glte~tv~~~~q~~~~L~~g~~~RtvasTnMN~q  189 (913)
T KOG0244|consen  136 -------------------PSRL------KANIKLRE-PKGEITIRGLTEKTVRMKLQLLSRLEKGSLERTVASTNMNAQ  189 (913)
T ss_pred             -------------------hhhh------hhceeccc-cCCceEEEeehHHHHHHHHHHHHHHHhchHHHHHHHHhcchh
Confidence                               1111      44578888 889999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      |||||+||||.+++...    ........++|+||||||||..
T Consensus       190 ssRshAifti~lkq~kk----~~~~s~~~sKlhlVDLAGSER~  228 (913)
T KOG0244|consen  190 SSRSHAIFTITLKQRKK----LSKRSSFCSKLHLVDLAGSERV  228 (913)
T ss_pred             hhhhhHHHHHHHHHHHH----hhccchhhhhhheeeccccccc
Confidence            99999999999998553    2223355689999999999863


No 29 
>cd01363 Motor_domain Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.
Probab=99.85  E-value=1.4e-21  Score=170.99  Aligned_cols=62  Identities=31%  Similarity=0.395  Sum_probs=50.9

Q ss_pred             HHHHHHHHHhcCCcccCCCCCCCCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        219 AMNALRQGALSRTTASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       219 a~~lL~~G~~~R~~~sT~~N~~SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      ++++|..|..+|+++.|.+|..|||||+||+|+|.+.....  ...+....++|+||||||||.
T Consensus        58 ~~~ll~~g~~~R~~~~t~~N~~SSRsH~i~~i~v~~~~~~~--~~~~~~~~s~l~lVDLAGsE~  119 (186)
T cd01363          58 VIDLMDKGNANRTTAATAMNEHSSRSHSVFRIHFGGKNALA--SATEQPKVGKINLVDLAGSER  119 (186)
T ss_pred             HHHHHhhccccccccccCCCCccCcccEEEEEEEEEeecCC--CCccceeeeeEEEEEcccccc
Confidence            34466677888999999999999999999999999977533  223456788999999999996


No 30 
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]
Probab=94.19  E-value=0.05  Score=55.26  Aligned_cols=58  Identities=21%  Similarity=0.317  Sum_probs=37.3

Q ss_pred             CCCccccccccccccCCCCCCCCcChH----HHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccc
Q psy15014          2 LQTGSGKTYTMGTGFETDVSEEMLGII----PRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEV   70 (286)
Q Consensus         2 GqTGSGKTyTm~G~~~~~~~~~~~GIi----PRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i   70 (286)
                      |.|||||||||.--..   ..+.+-||    --...+||....+..        |...+.-.+||+.-|+-..
T Consensus        39 GvTGSGKTfT~AnVI~---~~~rPtLV~AhNKTLAaQLy~Efk~fF--------P~NaVEYFVSYYDYYQPEA  100 (663)
T COG0556          39 GVTGSGKTFTMANVIA---KVQRPTLVLAHNKTLAAQLYSEFKEFF--------PENAVEYFVSYYDYYQPEA  100 (663)
T ss_pred             eeccCCchhHHHHHHH---HhCCCeEEEecchhHHHHHHHHHHHhC--------cCcceEEEeeeccccCccc
Confidence            8999999999953110   00111111    013568888887763        4667777889999997765


No 31 
>PF01935 DUF87:  Domain of unknown function DUF87;  InterPro: IPR002789 The function of this domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=88.47  E-value=0.13  Score=45.62  Aligned_cols=13  Identities=46%  Similarity=0.549  Sum_probs=11.7

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|.||||||||+.
T Consensus        29 ~G~TGsGKS~~~~   41 (229)
T PF01935_consen   29 FGTTGSGKSNTVK   41 (229)
T ss_pred             ECCCCCCHHHHHH
Confidence            4999999999994


No 32 
>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=87.87  E-value=0.16  Score=39.39  Aligned_cols=14  Identities=43%  Similarity=0.375  Sum_probs=12.3

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      +|.||+|||++|..
T Consensus         6 ~~~~G~GKT~~~~~   19 (144)
T cd00046           6 AAPTGSGKTLAALL   19 (144)
T ss_pred             ECCCCCchhHHHHH
Confidence            58999999999964


No 33 
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]
Probab=86.43  E-value=0.004  Score=63.76  Aligned_cols=51  Identities=31%  Similarity=0.342  Sum_probs=39.3

Q ss_pred             HHHhcCCcccCCCCCCCCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcCc
Q psy15014        225 QGALSRTTASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE  283 (286)
Q Consensus       225 ~G~~~R~~~sT~~N~~SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~~  283 (286)
                      .....+..+.+..|.+++|+|.+|..........     ....   .+++|||||+|+.
T Consensus       486 ~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~-----~~~~---~~n~~~~~~~e~~  536 (568)
T COG5059         486 KASKLRSSASTKLNLRSSRSHSKFRDHLNGSNSS-----TKEL---SLNQVDLAGSERK  536 (568)
T ss_pred             hhccchhhcccchhhhhcccchhhhhcccchhhh-----hHHH---Hhhhhhccccccc
Confidence            5677788899999999999999998877653321     1111   2799999999986


No 34 
>PF04851 ResIII:  Type III restriction enzyme, res subunit;  InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3.1.21.3 from EC), the Res subunit of type III endonucleases (3.1.21.5 from EC), and the B subunit of excinuclease ABC (uvrB) [, , ].; GO: 0003677 DNA binding, 0005524 ATP binding, 0016787 hydrolase activity; PDB: 2Y3T_B 2W74_B 2FWR_A 2FZ4_A 3UWX_B 3H1T_A 3B6E_A 2FDC_A 1D9Z_A 1T5L_B ....
Probab=85.68  E-value=0.21  Score=41.59  Aligned_cols=13  Identities=46%  Similarity=0.422  Sum_probs=11.5

Q ss_pred             CCCcccccccccc
Q psy15014          2 LQTGSGKTYTMGT   14 (286)
Q Consensus         2 GqTGSGKTyTm~G   14 (286)
                      +.||||||++|..
T Consensus        32 ~~tGsGKT~~~~~   44 (184)
T PF04851_consen   32 APTGSGKTIIALA   44 (184)
T ss_dssp             ESTTSSHHHHHHH
T ss_pred             ECCCCCcChhhhh
Confidence            6899999999974


No 35 
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=84.97  E-value=0.29  Score=49.46  Aligned_cols=13  Identities=54%  Similarity=0.488  Sum_probs=11.8

Q ss_pred             CCCcccccccccc
Q psy15014          2 LQTGSGKTYTMGT   14 (286)
Q Consensus         2 GqTGSGKTyTm~G   14 (286)
                      |+||||||.||..
T Consensus       265 GPTGSGKTTTLY~  277 (500)
T COG2804         265 GPTGSGKTTTLYA  277 (500)
T ss_pred             CCCCCCHHHHHHH
Confidence            8999999999954


No 36 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=83.28  E-value=0.34  Score=37.36  Aligned_cols=13  Identities=38%  Similarity=0.342  Sum_probs=11.7

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|.+|||||+++.
T Consensus         8 ~G~~G~GKTtl~~   20 (148)
T smart00382        8 VGPPGSGKTTLAR   20 (148)
T ss_pred             ECCCCCcHHHHHH
Confidence            6999999999994


No 37 
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=80.81  E-value=0.54  Score=45.03  Aligned_cols=12  Identities=50%  Similarity=0.609  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+||||||.||.
T Consensus       132 GpTGSGKSTTlA  143 (353)
T COG2805         132 GPTGSGKSTTLA  143 (353)
T ss_pred             CCCCCcHHHHHH
Confidence            899999999993


No 38 
>PRK06620 hypothetical protein; Validated
Probab=80.62  E-value=0.49  Score=42.37  Aligned_cols=14  Identities=36%  Similarity=0.349  Sum_probs=12.5

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||++||||||.+..
T Consensus        50 ~Gp~G~GKThLl~a   63 (214)
T PRK06620         50 KGPSSSGKTYLTKI   63 (214)
T ss_pred             ECCCCCCHHHHHHH
Confidence            89999999999953


No 39 
>PRK08727 hypothetical protein; Validated
Probab=79.12  E-value=0.62  Score=42.06  Aligned_cols=14  Identities=29%  Similarity=0.169  Sum_probs=12.3

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||.+|+||||-+..
T Consensus        47 ~G~~G~GKThL~~a   60 (233)
T PRK08727         47 SGPAGTGKTHLALA   60 (233)
T ss_pred             ECCCCCCHHHHHHH
Confidence            79999999999853


No 40 
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=78.98  E-value=0.64  Score=40.84  Aligned_cols=12  Identities=50%  Similarity=0.609  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+||||||.+|.
T Consensus         8 GptGSGKTTll~   19 (198)
T cd01131           8 GPTGSGKSTTLA   19 (198)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999994


No 41 
>PF12846 AAA_10:  AAA-like domain
Probab=78.40  E-value=0.68  Score=41.74  Aligned_cols=12  Identities=50%  Similarity=0.534  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||++|.
T Consensus         8 G~tGsGKT~~~~   19 (304)
T PF12846_consen    8 GKTGSGKTTLLK   19 (304)
T ss_pred             CCCCCcHHHHHH
Confidence            999999999994


No 42 
>PF13245 AAA_19:  Part of AAA domain
Probab=78.01  E-value=0.73  Score=34.64  Aligned_cols=12  Identities=42%  Similarity=0.551  Sum_probs=10.9

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |..|||||+|+.
T Consensus        17 g~pGtGKT~~~~   28 (76)
T PF13245_consen   17 GPPGTGKTTTLA   28 (76)
T ss_pred             CCCCCCHHHHHH
Confidence            789999999996


No 43 
>PRK06893 DNA replication initiation factor; Validated
Probab=77.87  E-value=0.72  Score=41.48  Aligned_cols=14  Identities=21%  Similarity=0.154  Sum_probs=12.5

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||++|+||||-+..
T Consensus        45 ~G~~G~GKThL~~a   58 (229)
T PRK06893         45 WGGKSSGKSHLLKA   58 (229)
T ss_pred             ECCCCCCHHHHHHH
Confidence            79999999999854


No 44 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=77.32  E-value=0.72  Score=36.01  Aligned_cols=13  Identities=31%  Similarity=0.279  Sum_probs=11.0

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|.+|+|||+.+.
T Consensus        25 ~G~~G~GKT~l~~   37 (151)
T cd00009          25 YGPPGTGKTTLAR   37 (151)
T ss_pred             ECCCCCCHHHHHH
Confidence            6999999998763


No 45 
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=76.48  E-value=0.73  Score=40.77  Aligned_cols=12  Identities=50%  Similarity=0.540  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+||+|||.|+.
T Consensus         8 GptGvGKTTt~a   19 (196)
T PF00448_consen    8 GPTGVGKTTTIA   19 (196)
T ss_dssp             ESTTSSHHHHHH
T ss_pred             CCCCCchHhHHH
Confidence            899999999994


No 46 
>PRK08084 DNA replication initiation factor; Provisional
Probab=75.52  E-value=0.86  Score=41.19  Aligned_cols=14  Identities=14%  Similarity=0.366  Sum_probs=12.5

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||++|+||||.+..
T Consensus        51 ~Gp~G~GKThLl~a   64 (235)
T PRK08084         51 WSREGAGRSHLLHA   64 (235)
T ss_pred             ECCCCCCHHHHHHH
Confidence            79999999999953


No 47 
>PRK05642 DNA replication initiation factor; Validated
Probab=74.83  E-value=0.96  Score=40.89  Aligned_cols=14  Identities=14%  Similarity=0.273  Sum_probs=12.3

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||.+|+||||-+..
T Consensus        51 ~G~~G~GKTHLl~a   64 (234)
T PRK05642         51 WGKDGVGRSHLLQA   64 (234)
T ss_pred             ECCCCCCHHHHHHH
Confidence            79999999999853


No 48 
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=74.74  E-value=0.7  Score=36.67  Aligned_cols=13  Identities=38%  Similarity=0.345  Sum_probs=10.5

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|+|||.++.
T Consensus        10 ~G~~G~GKT~~~~   22 (131)
T PF13401_consen   10 SGPPGSGKTTLIK   22 (131)
T ss_dssp             EE-TTSSHHHHHH
T ss_pred             EcCCCCCHHHHHH
Confidence            6999999999884


No 49 
>TIGR01420 pilT_fam pilus retraction protein PilT. This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation.
Probab=74.72  E-value=0.99  Score=43.24  Aligned_cols=12  Identities=50%  Similarity=0.609  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||.||.
T Consensus       129 G~tGSGKTT~l~  140 (343)
T TIGR01420       129 GPTGSGKSTTLA  140 (343)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999994


No 50 
>PRK09087 hypothetical protein; Validated
Probab=74.34  E-value=0.96  Score=40.84  Aligned_cols=13  Identities=38%  Similarity=0.309  Sum_probs=12.0

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+||||||-+.
T Consensus        50 ~G~~GsGKThLl~   62 (226)
T PRK09087         50 AGPVGSGKTHLAS   62 (226)
T ss_pred             ECCCCCCHHHHHH
Confidence            7999999999995


No 51 
>PF00308 Bac_DnaA:  Bacterial dnaA  protein;  InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; PDB: 2KJQ_A 2Z4S_A 2Z4R_C 2HCB_B 3R8F_C 1L8Q_A 3SC3_B 3BOS_A.
Probab=74.32  E-value=0.79  Score=41.10  Aligned_cols=14  Identities=29%  Similarity=0.297  Sum_probs=12.4

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||.+|+||||-|..
T Consensus        40 ~G~~G~GKTHLL~A   53 (219)
T PF00308_consen   40 YGPSGLGKTHLLQA   53 (219)
T ss_dssp             EESTTSSHHHHHHH
T ss_pred             ECCCCCCHHHHHHH
Confidence            89999999998754


No 52 
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=73.91  E-value=1  Score=43.76  Aligned_cols=12  Identities=50%  Similarity=0.556  Sum_probs=11.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||.||+|||.|+
T Consensus        48 yG~~GTGKT~~~   59 (366)
T COG1474          48 YGPTGTGKTATV   59 (366)
T ss_pred             ECCCCCCHhHHH
Confidence            899999999998


No 53 
>PRK10436 hypothetical protein; Provisional
Probab=73.88  E-value=1.1  Score=44.97  Aligned_cols=12  Identities=58%  Similarity=0.534  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+||||||.||.
T Consensus       225 GpTGSGKTTtL~  236 (462)
T PRK10436        225 GPTGSGKTVTLY  236 (462)
T ss_pred             CCCCCChHHHHH
Confidence            899999999994


No 54 
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB. Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.
Probab=73.56  E-value=1.1  Score=43.45  Aligned_cols=12  Identities=42%  Similarity=0.504  Sum_probs=11.0

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+||||||.||.
T Consensus       141 GpTGSGKTTtL~  152 (358)
T TIGR02524       141 GATGSGKSTLLA  152 (358)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999993


No 55 
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=73.11  E-value=1  Score=35.48  Aligned_cols=42  Identities=17%  Similarity=0.200  Sum_probs=26.3

Q ss_pred             CCCCccccccccc------cc----cC-CCCCCCCcChHHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTMG------TG----FE-TDVSEEMLGIIPRAITHLFEGIQNI   42 (286)
Q Consensus         1 YGqTGSGKTyTm~------G~----~~-~~~~~~~~GIiPRal~~LF~~~~~~   42 (286)
                      ||+.|+|||+..-      |-    .+ ........+-..+.+..+|..+...
T Consensus         4 ~G~~G~GKT~l~~~la~~l~~~~~~i~~~~~~~~~~~~~~~~i~~~~~~~~~~   56 (132)
T PF00004_consen    4 HGPPGTGKTTLARALAQYLGFPFIEIDGSELISSYAGDSEQKIRDFFKKAKKS   56 (132)
T ss_dssp             ESSTTSSHHHHHHHHHHHTTSEEEEEETTHHHTSSTTHHHHHHHHHHHHHHHT
T ss_pred             ECcCCCCeeHHHHHHHhhccccccccccccccccccccccccccccccccccc
Confidence            7999999999872      10    00 0011234566777888888886553


No 56 
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ. Members of this protein family are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase of a type-IV secretion-like system of obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii (TIGR02524).
Probab=72.89  E-value=1.2  Score=43.54  Aligned_cols=12  Identities=42%  Similarity=0.459  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+||||||.||.
T Consensus       156 G~TGSGKTT~l~  167 (372)
T TIGR02525       156 GETGSGKSTLAA  167 (372)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999993


No 57 
>PF13479 AAA_24:  AAA domain
Probab=72.70  E-value=1.2  Score=39.68  Aligned_cols=13  Identities=38%  Similarity=0.335  Sum_probs=11.9

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||++|+|||++..
T Consensus         9 yG~~G~GKTt~a~   21 (213)
T PF13479_consen    9 YGPPGSGKTTLAA   21 (213)
T ss_pred             ECCCCCCHHHHHH
Confidence            8999999999884


No 58 
>PF00437 T2SE:  Type II/IV secretion system protein;  InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]. These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....
Probab=72.31  E-value=1.1  Score=40.92  Aligned_cols=12  Identities=50%  Similarity=0.529  Sum_probs=11.0

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||.+|.
T Consensus       134 G~tGSGKTT~l~  145 (270)
T PF00437_consen  134 GPTGSGKTTLLN  145 (270)
T ss_dssp             ESTTSSHHHHHH
T ss_pred             CCCccccchHHH
Confidence            899999999994


No 59 
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=72.07  E-value=1.2  Score=38.34  Aligned_cols=12  Identities=42%  Similarity=0.551  Sum_probs=10.0

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+.|||||+|+.
T Consensus        24 GpPGTGKT~~l~   35 (236)
T PF13086_consen   24 GPPGTGKTTTLA   35 (236)
T ss_dssp             -STTSSHHHHHH
T ss_pred             CCCCCChHHHHH
Confidence            899999999884


No 60 
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB. This model describes a protein of type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly and is closely related to GspE (TIGR02533) of type II secretion, also called the main terminal branch of the general secretion pathway. Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.
Probab=71.41  E-value=1.4  Score=45.32  Aligned_cols=12  Identities=50%  Similarity=0.506  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||.||.
T Consensus       323 G~tGSGKTTtl~  334 (564)
T TIGR02538       323 GPTGSGKTVSLY  334 (564)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999994


No 61 
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=70.65  E-value=1.3  Score=38.74  Aligned_cols=13  Identities=31%  Similarity=0.417  Sum_probs=11.9

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||++|+||||.+.
T Consensus        44 ~G~~G~GKT~la~   56 (226)
T TIGR03420        44 WGESGSGKSHLLQ   56 (226)
T ss_pred             ECCCCCCHHHHHH
Confidence            7999999999984


No 62 
>PRK06526 transposase; Provisional
Probab=70.12  E-value=1.3  Score=40.76  Aligned_cols=14  Identities=29%  Similarity=0.214  Sum_probs=12.4

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||++|+||||.+.+
T Consensus       104 ~Gp~GtGKThLa~a  117 (254)
T PRK06526        104 LGPPGTGKTHLAIG  117 (254)
T ss_pred             EeCCCCchHHHHHH
Confidence            69999999999953


No 63 
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=69.83  E-value=1.2  Score=38.69  Aligned_cols=14  Identities=29%  Similarity=0.211  Sum_probs=12.4

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||++|+||||....
T Consensus        53 ~G~~G~GKThLa~a   66 (178)
T PF01695_consen   53 YGPPGTGKTHLAVA   66 (178)
T ss_dssp             EESTTSSHHHHHHH
T ss_pred             EhhHhHHHHHHHHH
Confidence            69999999999864


No 64 
>TIGR02533 type_II_gspE general secretory pathway protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis.
Probab=69.69  E-value=1.5  Score=44.18  Aligned_cols=12  Identities=58%  Similarity=0.512  Sum_probs=11.2

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+||||||.||.
T Consensus       249 GptGSGKTTtL~  260 (486)
T TIGR02533       249 GPTGSGKTTTLY  260 (486)
T ss_pred             cCCCCCHHHHHH
Confidence            899999999994


No 65 
>PRK06835 DNA replication protein DnaC; Validated
Probab=69.44  E-value=1.4  Score=42.19  Aligned_cols=14  Identities=36%  Similarity=0.508  Sum_probs=12.4

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||++|+||||-+..
T Consensus       189 ~G~~GtGKThLa~a  202 (329)
T PRK06835        189 YGNTGTGKTFLSNC  202 (329)
T ss_pred             ECCCCCcHHHHHHH
Confidence            79999999998853


No 66 
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=69.25  E-value=1.6  Score=40.35  Aligned_cols=12  Identities=58%  Similarity=0.512  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||.||.
T Consensus        87 G~tGSGKTT~l~   98 (264)
T cd01129          87 GPTGSGKTTTLY   98 (264)
T ss_pred             CCCCCcHHHHHH
Confidence            899999999994


No 67 
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=69.24  E-value=1.6  Score=37.80  Aligned_cols=11  Identities=55%  Similarity=0.540  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||||||.+|
T Consensus        32 G~tGSGKTTll   42 (186)
T cd01130          32 GGTGSGKTTLL   42 (186)
T ss_pred             CCCCCCHHHHH
Confidence            89999999987


No 68 
>TIGR00362 DnaA chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006).
Probab=69.08  E-value=1.5  Score=42.71  Aligned_cols=13  Identities=31%  Similarity=0.235  Sum_probs=12.1

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|+||||.+.
T Consensus       142 ~G~~G~GKThL~~  154 (405)
T TIGR00362       142 YGGVGLGKTHLLH  154 (405)
T ss_pred             ECCCCCcHHHHHH
Confidence            8999999999984


No 69 
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=68.83  E-value=1.7  Score=40.58  Aligned_cols=14  Identities=43%  Similarity=0.510  Sum_probs=12.0

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      .|+||+|||+|+..
T Consensus       200 vGptGvGKTTt~~k  213 (282)
T TIGR03499       200 VGPTGVGKTTTLAK  213 (282)
T ss_pred             ECCCCCCHHHHHHH
Confidence            38999999999963


No 70 
>PRK06921 hypothetical protein; Provisional
Probab=68.05  E-value=1.5  Score=40.55  Aligned_cols=14  Identities=43%  Similarity=0.503  Sum_probs=12.4

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||++|+||||.+..
T Consensus       123 ~G~~G~GKThLa~a  136 (266)
T PRK06921        123 LGQPGSGKTHLLTA  136 (266)
T ss_pred             ECCCCCcHHHHHHH
Confidence            79999999999953


No 71 
>KOG2543|consensus
Probab=67.51  E-value=1.8  Score=42.78  Aligned_cols=13  Identities=38%  Similarity=0.657  Sum_probs=12.1

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+||||||++.
T Consensus        36 yG~sgTGKT~~~r   48 (438)
T KOG2543|consen   36 YGHSGTGKTYLVR   48 (438)
T ss_pred             eccCCCchhHHHH
Confidence            8999999999984


No 72 
>PRK12377 putative replication protein; Provisional
Probab=67.14  E-value=1.7  Score=40.01  Aligned_cols=14  Identities=21%  Similarity=0.266  Sum_probs=12.4

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||++|+||||.+..
T Consensus       107 ~G~~GtGKThLa~A  120 (248)
T PRK12377        107 SGKPGTGKNHLAAA  120 (248)
T ss_pred             ECCCCCCHHHHHHH
Confidence            69999999999953


No 73 
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=67.08  E-value=1.7  Score=42.99  Aligned_cols=13  Identities=31%  Similarity=0.235  Sum_probs=12.0

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|+||||.+.
T Consensus       154 ~G~~G~GKThL~~  166 (450)
T PRK00149        154 YGGVGLGKTHLLH  166 (450)
T ss_pred             ECCCCCCHHHHHH
Confidence            8999999999984


No 74 
>PF01580 FtsK_SpoIIIE:  FtsK/SpoIIIE family;  InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies.The domain contains a putative ATP binding P-loop motif. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification []. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer []. ; GO: 0000166 nucleotide binding, 0003677 DNA binding, 0005524 ATP binding, 0007049 cell cycle, 0007059 chromosome segregation, 0051301 cell division, 0016021 integral to membrane; PDB: 2IUS_E 2IUU_A 2IUT_A.
Probab=67.03  E-value=1.5  Score=38.23  Aligned_cols=14  Identities=43%  Similarity=0.439  Sum_probs=10.3

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      +|.||||||.+|..
T Consensus        44 ~G~tgsGKS~~l~~   57 (205)
T PF01580_consen   44 AGATGSGKSTLLRT   57 (205)
T ss_dssp             E--TTSSHHHHHHH
T ss_pred             EcCCCCCccHHHHH
Confidence            49999999999963


No 75 
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=66.88  E-value=2  Score=35.27  Aligned_cols=13  Identities=46%  Similarity=0.422  Sum_probs=11.2

Q ss_pred             CCCcccccccccc
Q psy15014          2 LQTGSGKTYTMGT   14 (286)
Q Consensus         2 GqTGSGKTyTm~G   14 (286)
                      |.||||||.++..
T Consensus        31 ~~~GsGKT~~~~~   43 (201)
T smart00487       31 APTGSGKTLAALL   43 (201)
T ss_pred             CCCCCchhHHHHH
Confidence            7899999998854


No 76 
>PRK13833 conjugal transfer protein TrbB; Provisional
Probab=66.02  E-value=2  Score=41.18  Aligned_cols=12  Identities=50%  Similarity=0.410  Sum_probs=10.9

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||.+|-
T Consensus       151 G~tGSGKTTll~  162 (323)
T PRK13833        151 GGTGSGKTTLAN  162 (323)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999993


No 77 
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=65.87  E-value=1.8  Score=34.08  Aligned_cols=13  Identities=23%  Similarity=0.166  Sum_probs=11.9

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|.|||+.+.
T Consensus         4 ~G~~G~GKS~l~~   16 (107)
T PF00910_consen    4 YGPPGIGKSTLAK   16 (107)
T ss_pred             ECCCCCCHHHHHH
Confidence            8999999999984


No 78 
>PRK14088 dnaA chromosomal replication initiation protein; Provisional
Probab=65.86  E-value=1.9  Score=42.93  Aligned_cols=13  Identities=31%  Similarity=0.245  Sum_probs=12.2

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|+||||-|.
T Consensus       136 yG~~G~GKTHLl~  148 (440)
T PRK14088        136 YGGVGLGKTHLLQ  148 (440)
T ss_pred             EcCCCCcHHHHHH
Confidence            8999999999995


No 79 
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]
Probab=65.79  E-value=1.9  Score=42.68  Aligned_cols=13  Identities=31%  Similarity=0.245  Sum_probs=12.1

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|+||||-|.
T Consensus       119 ~G~~GlGKTHLl~  131 (408)
T COG0593         119 YGGVGLGKTHLLQ  131 (408)
T ss_pred             ECCCCCCHHHHHH
Confidence            8999999999994


No 80 
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=65.71  E-value=2  Score=37.99  Aligned_cols=13  Identities=23%  Similarity=0.381  Sum_probs=11.7

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|+||||-+.
T Consensus        48 ~G~~G~GKT~La~   60 (227)
T PRK08903         48 WGEAGSGRSHLLQ   60 (227)
T ss_pred             ECCCCCCHHHHHH
Confidence            7999999999884


No 81 
>PRK13851 type IV secretion system protein VirB11; Provisional
Probab=64.90  E-value=2.1  Score=41.32  Aligned_cols=11  Identities=55%  Similarity=0.459  Sum_probs=10.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||||||.+|
T Consensus       169 G~tGSGKTTll  179 (344)
T PRK13851        169 GPTGSGKTTMS  179 (344)
T ss_pred             CCCCccHHHHH
Confidence            89999999998


No 82 
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=64.86  E-value=2.3  Score=40.11  Aligned_cols=11  Identities=55%  Similarity=0.649  Sum_probs=10.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.||
T Consensus        34 GpSGsGKTTtL   44 (309)
T COG1125          34 GPSGSGKTTTL   44 (309)
T ss_pred             CCCCCcHHHHH
Confidence            89999999998


No 83 
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=64.61  E-value=3.4  Score=38.35  Aligned_cols=49  Identities=12%  Similarity=0.143  Sum_probs=27.4

Q ss_pred             EEEeccEEEEcC-CHHHHHHHHHHHHhcCCcccCCCCCCCCCCceeEEEEE
Q psy15014        203 IYVTGATSKSIR-SAQEAMNALRQGALSRTTASTQMNSQSSRSHAIFTLHI  252 (286)
Q Consensus       203 v~v~gl~~~~V~-S~eea~~lL~~G~~~R~~~sT~~N~~SSRSHaIftI~v  252 (286)
                      +++..|..-.-. +...+..+|.-|...| ..-..+.+.|.|-|.|=.-.-
T Consensus       110 lf~DDLsFe~~d~~yk~LKs~LeGgle~~-P~NvliyATSNRRHLv~E~~~  159 (249)
T PF05673_consen  110 LFCDDLSFEEGDTEYKALKSVLEGGLEAR-PDNVLIYATSNRRHLVPESFS  159 (249)
T ss_pred             EEecCCCCCCCcHHHHHHHHHhcCccccC-CCcEEEEEecchhhccchhhh
Confidence            344455433322 2445555555555444 566777888888888754333


No 84 
>PRK08116 hypothetical protein; Validated
Probab=64.55  E-value=2.1  Score=39.72  Aligned_cols=13  Identities=38%  Similarity=0.552  Sum_probs=12.0

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|+||||.+.
T Consensus       120 ~G~~GtGKThLa~  132 (268)
T PRK08116        120 WGSVGTGKTYLAA  132 (268)
T ss_pred             ECCCCCCHHHHHH
Confidence            7999999999985


No 85 
>KOG0953|consensus
Probab=64.45  E-value=7.7  Score=40.13  Aligned_cols=42  Identities=19%  Similarity=0.253  Sum_probs=28.0

Q ss_pred             CCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHH
Q psy15014          2 LQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIA   43 (286)
Q Consensus         2 GqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~   43 (286)
                      |+|+|||||--+--...-.+.--.|=+--...++|++++...
T Consensus       198 GPTNSGKTy~ALqrl~~aksGvycGPLrLLA~EV~~r~na~g  239 (700)
T KOG0953|consen  198 GPTNSGKTYRALQRLKSAKSGVYCGPLRLLAHEVYDRLNALG  239 (700)
T ss_pred             CCCCCchhHHHHHHHhhhccceecchHHHHHHHHHHHhhhcC
Confidence            999999999885432222233445656666778898887653


No 86 
>TIGR02928 orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.
Probab=63.13  E-value=2.3  Score=40.17  Aligned_cols=12  Identities=42%  Similarity=0.473  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||+++
T Consensus        46 ~G~~GtGKT~l~   57 (365)
T TIGR02928        46 YGKTGTGKTAVT   57 (365)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999988


No 87 
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB. The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.
Probab=62.97  E-value=2.5  Score=39.86  Aligned_cols=12  Identities=50%  Similarity=0.410  Sum_probs=10.9

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||.+|-
T Consensus       139 G~tGSGKTTll~  150 (299)
T TIGR02782       139 GGTGSGKTTLAN  150 (299)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999984


No 88 
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional
Probab=62.25  E-value=3.5  Score=45.06  Aligned_cols=12  Identities=50%  Similarity=0.858  Sum_probs=10.4

Q ss_pred             CCcccccccccc
Q psy15014          3 QTGSGKTYTMGT   14 (286)
Q Consensus         3 qTGSGKTyTm~G   14 (286)
                      .|||||||||.+
T Consensus        67 ~TGtGKT~~~~~   78 (986)
T PRK15483         67 ETGTGKTYVYTR   78 (986)
T ss_pred             CCCCCHHHHHHH
Confidence            599999998865


No 89 
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=62.16  E-value=2.4  Score=41.62  Aligned_cols=13  Identities=46%  Similarity=0.539  Sum_probs=11.7

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|+||+|||.|+.
T Consensus       180 vGptGvGKTTT~a  192 (388)
T PRK12723        180 VGPTGVGKTTTIA  192 (388)
T ss_pred             ECCCCCCHHHHHH
Confidence            5999999999994


No 90 
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=62.13  E-value=2.4  Score=38.13  Aligned_cols=13  Identities=31%  Similarity=0.386  Sum_probs=11.5

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|+.|+|||+.+.
T Consensus        49 ~G~~G~GKTtl~~   61 (269)
T TIGR03015        49 TGEVGAGKTTLIR   61 (269)
T ss_pred             EcCCCCCHHHHHH
Confidence            6999999998883


No 91 
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=61.91  E-value=2.6  Score=33.91  Aligned_cols=13  Identities=46%  Similarity=0.317  Sum_probs=11.5

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|+|||+.+.
T Consensus         5 ~G~~G~GKT~l~~   17 (165)
T cd01120           5 FGPTGSGKTTLAL   17 (165)
T ss_pred             eCCCCCCHHHHHH
Confidence            6999999999874


No 92 
>PRK08181 transposase; Validated
Probab=61.72  E-value=2.5  Score=39.47  Aligned_cols=14  Identities=21%  Similarity=0.294  Sum_probs=12.4

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||++|+||||-+.+
T Consensus       112 ~Gp~GtGKTHLa~A  125 (269)
T PRK08181        112 FGPPGGGKSHLAAA  125 (269)
T ss_pred             EecCCCcHHHHHHH
Confidence            69999999999854


No 93 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=61.67  E-value=2.5  Score=40.42  Aligned_cols=12  Identities=42%  Similarity=0.498  Sum_probs=11.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||+++
T Consensus        61 ~G~~GtGKT~l~   72 (394)
T PRK00411         61 YGPPGTGKTTTV   72 (394)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999998


No 94 
>PRK08939 primosomal protein DnaI; Reviewed
Probab=61.58  E-value=2.5  Score=40.03  Aligned_cols=14  Identities=29%  Similarity=0.510  Sum_probs=12.5

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||.+|+||||-+..
T Consensus       162 ~G~~G~GKThLa~A  175 (306)
T PRK08939        162 YGDFGVGKSYLLAA  175 (306)
T ss_pred             ECCCCCCHHHHHHH
Confidence            79999999999954


No 95 
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=61.27  E-value=2.4  Score=36.61  Aligned_cols=12  Identities=33%  Similarity=0.263  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+||+|||++.
T Consensus         9 ~GpsGvGKT~la   20 (171)
T PF07724_consen    9 AGPSGVGKTELA   20 (171)
T ss_dssp             ESSTTSSHHHHH
T ss_pred             ECCCCCCHHHHH
Confidence            499999999976


No 96 
>PF06309 Torsin:  Torsin;  InterPro: IPR010448 This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor
Probab=61.25  E-value=2.9  Score=34.91  Aligned_cols=11  Identities=36%  Similarity=0.531  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||+||||+-
T Consensus        60 G~tGtGKn~v~   70 (127)
T PF06309_consen   60 GWTGTGKNFVS   70 (127)
T ss_pred             cCCCCcHHHHH
Confidence            89999999976


No 97 
>PF00270 DEAD:  DEAD/DEAH box helicase;  InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0008026 ATP-dependent helicase activity; PDB: 3RRM_A 3RRN_A 3PEW_A 2KBE_A 3PEY_A 3FHO_A 2ZJA_A 2ZJ8_A 2ZJ5_A 2ZJ2_A ....
Probab=61.07  E-value=2.8  Score=34.47  Aligned_cols=13  Identities=46%  Similarity=0.432  Sum_probs=11.4

Q ss_pred             CCCcccccccccc
Q psy15014          2 LQTGSGKTYTMGT   14 (286)
Q Consensus         2 GqTGSGKTyTm~G   14 (286)
                      |+||+|||..+..
T Consensus        21 aptGsGKT~~~~~   33 (169)
T PF00270_consen   21 APTGSGKTLAYIL   33 (169)
T ss_dssp             CSTTSSHHHHHHH
T ss_pred             CCCCCccHHHHHH
Confidence            7899999999864


No 98 
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=61.04  E-value=2.7  Score=39.12  Aligned_cols=12  Identities=42%  Similarity=0.434  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||+++
T Consensus        42 ~Gp~GtGKT~la   53 (337)
T PRK12402         42 QGPPGSGKTAAV   53 (337)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999988


No 99 
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=60.90  E-value=2.6  Score=30.78  Aligned_cols=12  Identities=33%  Similarity=0.418  Sum_probs=10.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||.-|
T Consensus        29 ~G~nGsGKSTll   40 (62)
T PF13555_consen   29 TGPNGSGKSTLL   40 (62)
T ss_pred             ECCCCCCHHHHH
Confidence            489999999766


No 100
>PRK14087 dnaA chromosomal replication initiation protein; Provisional
Probab=60.71  E-value=2.7  Score=41.99  Aligned_cols=14  Identities=29%  Similarity=0.356  Sum_probs=12.5

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||.+|+||||.|..
T Consensus       147 ~G~~G~GKTHLl~A  160 (450)
T PRK14087        147 YGESGMGKTHLLKA  160 (450)
T ss_pred             ECCCCCcHHHHHHH
Confidence            89999999999943


No 101
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=60.70  E-value=2.7  Score=38.35  Aligned_cols=12  Identities=33%  Similarity=0.357  Sum_probs=11.2

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||++.
T Consensus        48 ~GppGtGKTtlA   59 (261)
T TIGR02881        48 KGNPGTGKTTVA   59 (261)
T ss_pred             EcCCCCCHHHHH
Confidence            799999999987


No 102
>TIGR00631 uvrb excinuclease ABC, B subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University)
Probab=60.55  E-value=8.4  Score=40.43  Aligned_cols=59  Identities=20%  Similarity=0.326  Sum_probs=36.7

Q ss_pred             CCCCccccccccccccCCCCCCCCcChH----HHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGII----PRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEV   70 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIi----PRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i   70 (286)
                      +|.||||||+||..-...   ...+-||    -....+|+..+...-        +...+...+||+.-|.-..
T Consensus        35 ~Gvtgs~kt~~~a~~~~~---~~~p~Lvi~~n~~~A~ql~~el~~f~--------p~~~V~~f~sy~d~y~pe~   97 (655)
T TIGR00631        35 LGVTGSGKTFTMANVIAQ---VNRPTLVIAHNKTLAAQLYNEFKEFF--------PENAVEYFVSYYDYYQPEA   97 (655)
T ss_pred             ECCCCcHHHHHHHHHHHH---hCCCEEEEECCHHHHHHHHHHHHHhC--------CCCeEEEEeeecccCCccc
Confidence            489999999999542110   0111111    124567777776652        2445778899999887765


No 103
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=60.40  E-value=2.8  Score=41.05  Aligned_cols=13  Identities=54%  Similarity=0.529  Sum_probs=11.6

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|+||+|||+|+.
T Consensus       143 vGptGvGKTTtia  155 (374)
T PRK14722        143 MGPTGVGKTTTTA  155 (374)
T ss_pred             ECCCCCCHHHHHH
Confidence            4999999999994


No 104
>PRK13900 type IV secretion system ATPase VirB11; Provisional
Probab=60.26  E-value=3  Score=40.01  Aligned_cols=12  Identities=33%  Similarity=0.196  Sum_probs=10.9

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||.+|-
T Consensus       167 G~tgSGKTTll~  178 (332)
T PRK13900        167 GGTSTGKTTFTN  178 (332)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999983


No 105
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=59.70  E-value=3.2  Score=41.12  Aligned_cols=11  Identities=55%  Similarity=0.582  Sum_probs=10.8

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+||-|||.|+
T Consensus       210 GPTGVGKTTTl  220 (407)
T COG1419         210 GPTGVGKTTTL  220 (407)
T ss_pred             CCCCCcHHHHH
Confidence            99999999999


No 106
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=59.54  E-value=2.8  Score=32.91  Aligned_cols=12  Identities=33%  Similarity=0.288  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|||||+..
T Consensus         5 ~G~~gsGKST~a   16 (121)
T PF13207_consen    5 SGPPGSGKSTLA   16 (121)
T ss_dssp             EESTTSSHHHHH
T ss_pred             ECCCCCCHHHHH
Confidence            389999999876


No 107
>PRK13894 conjugal transfer ATPase TrbB; Provisional
Probab=59.44  E-value=3.1  Score=39.71  Aligned_cols=12  Identities=50%  Similarity=0.473  Sum_probs=10.5

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||++|.
T Consensus       155 G~tGSGKTTll~  166 (319)
T PRK13894        155 GGTGSGKTTLVN  166 (319)
T ss_pred             CCCCCCHHHHHH
Confidence            899999997773


No 108
>PRK09183 transposase/IS protein; Provisional
Probab=59.33  E-value=3  Score=38.43  Aligned_cols=13  Identities=31%  Similarity=0.230  Sum_probs=11.8

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||++|+||||-+.
T Consensus       108 ~Gp~GtGKThLa~  120 (259)
T PRK09183        108 LGPSGVGKTHLAI  120 (259)
T ss_pred             EeCCCCCHHHHHH
Confidence            6999999999985


No 109
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=59.30  E-value=3  Score=38.37  Aligned_cols=14  Identities=29%  Similarity=0.195  Sum_probs=12.4

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||+.|+||||-...
T Consensus       111 ~G~~G~GKThLa~A  124 (254)
T COG1484         111 LGPPGVGKTHLAIA  124 (254)
T ss_pred             ECCCCCcHHHHHHH
Confidence            79999999999853


No 110
>PF02456 Adeno_IVa2:  Adenovirus IVa2 protein;  InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging []. During the course of lytic infection, the adenovirus major late promoter (MLP) is induced to high levels after replication of viral DNA has started. IVa2 is a transcriptional activator of the major late promoter [].; GO: 0019083 viral transcription
Probab=59.12  E-value=3  Score=40.21  Aligned_cols=12  Identities=42%  Similarity=0.490  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+|||||++-+
T Consensus        93 YGPTG~GKSqLl  104 (369)
T PF02456_consen   93 YGPTGSGKSQLL  104 (369)
T ss_pred             ECCCCCCHHHHH
Confidence            999999999987


No 111
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=59.02  E-value=3.8  Score=38.97  Aligned_cols=11  Identities=64%  Similarity=0.694  Sum_probs=10.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.|||||+.||
T Consensus       134 GaTGSGKSTtm  144 (375)
T COG5008         134 GATGSGKSTTM  144 (375)
T ss_pred             CCCCCCchhhH
Confidence            89999999999


No 112
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=58.32  E-value=2.6  Score=34.14  Aligned_cols=13  Identities=31%  Similarity=0.325  Sum_probs=11.4

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|++|+|||+.+.
T Consensus         5 ~G~~G~GKt~l~~   17 (139)
T PF07728_consen    5 VGPPGTGKTTLAR   17 (139)
T ss_dssp             EESSSSSHHHHHH
T ss_pred             ECCCCCCHHHHHH
Confidence            5999999998874


No 113
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=57.45  E-value=3.3  Score=34.62  Aligned_cols=12  Identities=42%  Similarity=0.526  Sum_probs=9.2

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|..|+|||+.+
T Consensus        30 ~G~~G~GKT~ll   41 (185)
T PF13191_consen   30 TGESGSGKTSLL   41 (185)
T ss_dssp             -B-TTSSHHHHH
T ss_pred             ECCCCCCHHHHH
Confidence            599999999987


No 114
>PF13604 AAA_30:  AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A.
Probab=57.28  E-value=3.1  Score=36.52  Aligned_cols=12  Identities=33%  Similarity=0.415  Sum_probs=10.7

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |..||||||+|.
T Consensus        25 G~aGtGKT~~l~   36 (196)
T PF13604_consen   25 GPAGTGKTTLLK   36 (196)
T ss_dssp             ESTTSTHHHHHH
T ss_pred             ECCCCCHHHHHH
Confidence            788999999984


No 115
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=56.87  E-value=3.7  Score=36.87  Aligned_cols=12  Identities=25%  Similarity=0.155  Sum_probs=10.8

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||+++-
T Consensus         6 G~sGSGKTTla~   17 (220)
T cd02025           6 GSVAVGKSTTAR   17 (220)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999983


No 116
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=56.27  E-value=3.8  Score=35.42  Aligned_cols=12  Identities=42%  Similarity=0.385  Sum_probs=10.7

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||+.+-
T Consensus         6 G~~GsGKSTl~~   17 (198)
T cd02023           6 GGSGSGKTTVAE   17 (198)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999883


No 117
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=55.76  E-value=3.6  Score=32.11  Aligned_cols=12  Identities=42%  Similarity=0.288  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|||||+..
T Consensus         4 ~G~~GsGKtTia   15 (129)
T PF13238_consen    4 SGIPGSGKTTIA   15 (129)
T ss_dssp             EESTTSSHHHHH
T ss_pred             ECCCCCCHHHHH
Confidence            389999999876


No 118
>KOG0989|consensus
Probab=55.45  E-value=4.1  Score=39.21  Aligned_cols=12  Identities=42%  Similarity=0.434  Sum_probs=11.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||.|.
T Consensus        63 yGPpGTGKTSta   74 (346)
T KOG0989|consen   63 YGPPGTGKTSTA   74 (346)
T ss_pred             eCCCCCcHhHHH
Confidence            899999999998


No 119
>PF00580 UvrD-helicase:  UvrD/REP helicase N-terminal domain;  InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. THe family includes both Rep and UvrD helcases. The Rep family helicases are composed of four structural domains []. The Rep proteins function as dimers.; GO: 0003677 DNA binding, 0004003 ATP-dependent DNA helicase activity, 0005524 ATP binding; PDB: 1UAA_B 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A 1QHG_A 1PJR_A ....
Probab=55.17  E-value=3.4  Score=37.44  Aligned_cols=13  Identities=46%  Similarity=0.473  Sum_probs=10.1

Q ss_pred             CCCcccccccccc
Q psy15014          2 LQTGSGKTYTMGT   14 (286)
Q Consensus         2 GqTGSGKTyTm~G   14 (286)
                      |..|||||+||..
T Consensus        20 a~AGSGKT~~l~~   32 (315)
T PF00580_consen   20 AGAGSGKTTTLLE   32 (315)
T ss_dssp             E-TTSSHHHHHHH
T ss_pred             eCCCCCchHHHHH
Confidence            5579999999953


No 120
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=54.89  E-value=3.1  Score=35.01  Aligned_cols=12  Identities=33%  Similarity=0.448  Sum_probs=11.1

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||.+|+|||..|
T Consensus        25 ~G~Ng~GKStil   36 (202)
T PF13476_consen   25 YGPNGSGKSTIL   36 (202)
T ss_dssp             EESTTSSHHHHH
T ss_pred             ECCCCCCHHHHH
Confidence            799999999888


No 121
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=54.83  E-value=4.2  Score=41.20  Aligned_cols=12  Identities=50%  Similarity=0.454  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+||+|||.|+.
T Consensus       263 GpnGvGKTTTia  274 (484)
T PRK06995        263 GPTGVGKTTTTA  274 (484)
T ss_pred             CCCCccHHHHHH
Confidence            999999999993


No 122
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=54.50  E-value=3.9  Score=40.79  Aligned_cols=13  Identities=46%  Similarity=0.457  Sum_probs=12.0

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|+||||-+.
T Consensus       147 ~G~~G~GKTHLl~  159 (445)
T PRK12422        147 FGPEGSGKTHLMQ  159 (445)
T ss_pred             EcCCCCCHHHHHH
Confidence            8999999999984


No 123
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=54.32  E-value=4.4  Score=36.02  Aligned_cols=12  Identities=33%  Similarity=0.520  Sum_probs=10.9

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||.+|
T Consensus        31 vGpNGaGKSTll   42 (212)
T cd03274          31 VGPNGSGKSNVI   42 (212)
T ss_pred             ECCCCCCHHHHH
Confidence            399999999998


No 124
>PRK07952 DNA replication protein DnaC; Validated
Probab=54.09  E-value=4  Score=37.49  Aligned_cols=14  Identities=21%  Similarity=0.266  Sum_probs=12.4

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||.+|+||||.+..
T Consensus       105 ~G~~GtGKThLa~a  118 (244)
T PRK07952        105 SGKPGTGKNHLAAA  118 (244)
T ss_pred             ECCCCCCHHHHHHH
Confidence            69999999999964


No 125
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=53.33  E-value=4.9  Score=39.05  Aligned_cols=11  Identities=55%  Similarity=0.516  Sum_probs=9.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+||||||+--
T Consensus       104 GPTGsGKTlLA  114 (408)
T COG1219         104 GPTGSGKTLLA  114 (408)
T ss_pred             CCCCCcHHHHH
Confidence            89999999743


No 126
>PRK13764 ATPase; Provisional
Probab=53.14  E-value=4.6  Score=42.01  Aligned_cols=12  Identities=25%  Similarity=0.243  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||+++.
T Consensus       264 G~TGSGKTTll~  275 (602)
T PRK13764        264 GAPGAGKSTFAQ  275 (602)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999994


No 127
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family. Members of this family are assumed to differ from each other in DNA site specificity.
Probab=52.99  E-value=4.6  Score=42.31  Aligned_cols=11  Identities=64%  Similarity=0.712  Sum_probs=10.1

Q ss_pred             CCccccccccc
Q psy15014          3 QTGSGKTYTMG   13 (286)
Q Consensus         3 qTGSGKTyTm~   13 (286)
                      .||||||+||.
T Consensus       271 ~TGsGKT~t~~  281 (667)
T TIGR00348       271 TQGSGKTLTML  281 (667)
T ss_pred             ecCCCccHHHH
Confidence            69999999995


No 128
>TIGR01242 26Sp45 26S proteasome subunit P45 family. Many proteins may score above the trusted cutoff because an internal
Probab=52.67  E-value=4.5  Score=38.83  Aligned_cols=12  Identities=33%  Similarity=0.382  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||+.+
T Consensus       162 ~GppGtGKT~la  173 (364)
T TIGR01242       162 YGPPGTGKTLLA  173 (364)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999888


No 129
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=52.59  E-value=4.7  Score=38.28  Aligned_cols=42  Identities=24%  Similarity=0.307  Sum_probs=27.9

Q ss_pred             CCCCcccccccc---ccccCC--------CCCCCCcChHHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTM---GTGFET--------DVSEEMLGIIPRAITHLFEGIQNI   42 (286)
Q Consensus         1 YGqTGSGKTyTm---~G~~~~--------~~~~~~~GIiPRal~~LF~~~~~~   42 (286)
                      ||++|+|||.+-   .+....        ..-.+..|=--|-+++||++..+.
T Consensus       157 yGppGTGKTm~Akalane~kvp~l~vkat~liGehVGdgar~Ihely~rA~~~  209 (368)
T COG1223         157 YGPPGTGKTMMAKALANEAKVPLLLVKATELIGEHVGDGARRIHELYERARKA  209 (368)
T ss_pred             ECCCCccHHHHHHHHhcccCCceEEechHHHHHHHhhhHHHHHHHHHHHHHhc
Confidence            899999999875   111110        011245566678999999998775


No 130
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=52.53  E-value=4.8  Score=39.15  Aligned_cols=11  Identities=36%  Similarity=0.471  Sum_probs=10.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.++
T Consensus        38 GPSGcGKTTlL   48 (352)
T COG3842          38 GPSGCGKTTLL   48 (352)
T ss_pred             CCCCCCHHHHH
Confidence            89999999998


No 131
>PF06414 Zeta_toxin:  Zeta toxin;  InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [, ].; GO: 0005524 ATP binding, 0016301 kinase activity; PDB: 2P5T_H 1GVN_B 3Q8X_D.
Probab=51.87  E-value=5.1  Score=34.94  Aligned_cols=12  Identities=42%  Similarity=0.379  Sum_probs=9.6

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      ||.|||||+.+-
T Consensus        22 G~~GsGKSt~~~   33 (199)
T PF06414_consen   22 GQPGSGKSTLAR   33 (199)
T ss_dssp             S-TTSTTHHHHH
T ss_pred             CCCCCCHHHHHH
Confidence            999999998873


No 132
>TIGR01618 phage_P_loop phage nucleotide-binding protein. This model represents an uncharacterized family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of this protein is unknown.
Probab=51.58  E-value=4.6  Score=36.61  Aligned_cols=13  Identities=38%  Similarity=0.498  Sum_probs=11.9

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||..|+|||+..-
T Consensus        18 yG~~G~GKtt~a~   30 (220)
T TIGR01618        18 YGKPGTGKTSTIK   30 (220)
T ss_pred             ECCCCCCHHHHHH
Confidence            8999999999883


No 133
>KOG1803|consensus
Probab=51.18  E-value=6.1  Score=40.99  Aligned_cols=12  Identities=42%  Similarity=0.448  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+.|+|||||+.
T Consensus       208 GPPGTGKT~Tlv  219 (649)
T KOG1803|consen  208 GPPGTGKTRTLV  219 (649)
T ss_pred             CCCCCCceeeHH
Confidence            899999999993


No 134
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=51.07  E-value=5.3  Score=39.64  Aligned_cols=13  Identities=46%  Similarity=0.547  Sum_probs=11.5

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|+||+|||+|+.
T Consensus       227 vGptGvGKTTt~~  239 (424)
T PRK05703        227 VGPTGVGKTTTLA  239 (424)
T ss_pred             ECCCCCCHHHHHH
Confidence            3899999999984


No 135
>PRK14086 dnaA chromosomal replication initiation protein; Provisional
Probab=50.75  E-value=5  Score=41.81  Aligned_cols=13  Identities=31%  Similarity=0.342  Sum_probs=12.1

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|+||||-+.
T Consensus       320 yG~sGsGKTHLL~  332 (617)
T PRK14086        320 YGESGLGKTHLLH  332 (617)
T ss_pred             ECCCCCCHHHHHH
Confidence            8999999999984


No 136
>PRK08233 hypothetical protein; Provisional
Probab=49.24  E-value=6  Score=33.16  Aligned_cols=11  Identities=36%  Similarity=0.435  Sum_probs=9.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+..
T Consensus        10 G~~GsGKtTla   20 (182)
T PRK08233         10 AVSGGGKTTLT   20 (182)
T ss_pred             CCCCCCHHHHH
Confidence            89999999865


No 137
>PHA02544 44 clamp loader, small subunit; Provisional
Probab=49.20  E-value=5.6  Score=36.88  Aligned_cols=12  Identities=33%  Similarity=0.401  Sum_probs=11.2

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||+.+
T Consensus        49 ~G~~G~GKT~la   60 (316)
T PHA02544         49 SPSPGTGKTTVA   60 (316)
T ss_pred             eCcCCCCHHHHH
Confidence            799999999988


No 138
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=48.87  E-value=6  Score=31.94  Aligned_cols=13  Identities=31%  Similarity=0.141  Sum_probs=10.9

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|++|||||.++.
T Consensus        21 ~GpSGsGKSTLl~   33 (107)
T cd00820          21 TGDSGIGKTELAL   33 (107)
T ss_pred             EcCCCCCHHHHHH
Confidence            3899999998873


No 139
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=48.64  E-value=5.5  Score=32.02  Aligned_cols=12  Identities=33%  Similarity=0.301  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|..|||||+..
T Consensus         5 ~G~pgsGKSt~a   16 (143)
T PF13671_consen    5 CGPPGSGKSTLA   16 (143)
T ss_dssp             EESTTSSHHHHH
T ss_pred             ECCCCCCHHHHH
Confidence            389999999876


No 140
>PF13173 AAA_14:  AAA domain
Probab=48.46  E-value=5.7  Score=32.04  Aligned_cols=13  Identities=31%  Similarity=0.284  Sum_probs=11.6

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|+.|+|||+.|.
T Consensus         8 ~G~R~vGKTtll~   20 (128)
T PF13173_consen    8 TGPRGVGKTTLLK   20 (128)
T ss_pred             ECCCCCCHHHHHH
Confidence            6999999999984


No 141
>PLN03025 replication factor C subunit; Provisional
Probab=48.16  E-value=5.8  Score=37.33  Aligned_cols=13  Identities=31%  Similarity=0.314  Sum_probs=11.6

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||+.|+|||++..
T Consensus        40 ~Gp~G~GKTtla~   52 (319)
T PLN03025         40 SGPPGTGKTTSIL   52 (319)
T ss_pred             ECCCCCCHHHHHH
Confidence            7999999998873


No 142
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=47.80  E-value=6.3  Score=39.19  Aligned_cols=11  Identities=55%  Similarity=0.480  Sum_probs=10.7

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||+|||.||
T Consensus       198 GpnG~GKTTtl  208 (420)
T PRK14721        198 GPTGVGKTTTT  208 (420)
T ss_pred             CCCCCCHHHHH
Confidence            89999999999


No 143
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=47.53  E-value=6.6  Score=33.33  Aligned_cols=12  Identities=42%  Similarity=0.476  Sum_probs=11.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|||||+.+
T Consensus         1 ~G~sGsGKSTla   12 (163)
T PRK11545          1 MGVSGSGKSAVA   12 (163)
T ss_pred             CCCCCCcHHHHH
Confidence            499999999988


No 144
>KOG0926|consensus
Probab=47.35  E-value=9.6  Score=41.13  Aligned_cols=37  Identities=35%  Similarity=0.534  Sum_probs=22.4

Q ss_pred             CCCccccccccc-----cccCCCCCCCCcChH----HHHHHHHHHHH
Q psy15014          2 LQTGSGKTYTMG-----TGFETDVSEEMLGII----PRAITHLFEGI   39 (286)
Q Consensus         2 GqTGSGKTyTm~-----G~~~~~~~~~~~GIi----PRal~~LF~~~   39 (286)
                      |+||||||.-+-     -|+..... ++.|||    ||-+..|-...
T Consensus       278 GeTGsGKTTQvPQFLYEAGf~s~~~-~~~gmIGITqPRRVAaiamAk  323 (1172)
T KOG0926|consen  278 GETGSGKTTQVPQFLYEAGFASEQS-SSPGMIGITQPRRVAAIAMAK  323 (1172)
T ss_pred             cCCCCCccccchHHHHHcccCCccC-CCCCeeeecCchHHHHHHHHH
Confidence            999999999881     12322222 235665    78777665443


No 145
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=47.24  E-value=6  Score=37.33  Aligned_cols=12  Identities=33%  Similarity=0.230  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||+..
T Consensus        57 ~GppG~GKT~la   68 (328)
T PRK00080         57 YGPPGLGKTTLA   68 (328)
T ss_pred             ECCCCccHHHHH
Confidence            899999999987


No 146
>PF05729 NACHT:  NACHT domain
Probab=47.03  E-value=6.4  Score=31.95  Aligned_cols=13  Identities=31%  Similarity=0.378  Sum_probs=11.3

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|..|+|||..|.
T Consensus         6 ~G~~G~GKStll~   18 (166)
T PF05729_consen    6 SGEPGSGKSTLLR   18 (166)
T ss_pred             ECCCCCChHHHHH
Confidence            5999999999884


No 147
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=46.95  E-value=5.9  Score=34.34  Aligned_cols=11  Identities=45%  Similarity=0.428  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+.-
T Consensus         6 G~sgSGKTTla   16 (194)
T PF00485_consen    6 GPSGSGKTTLA   16 (194)
T ss_dssp             ESTTSSHHHHH
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 148
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=46.35  E-value=6.3  Score=36.35  Aligned_cols=12  Identities=33%  Similarity=0.230  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||+..
T Consensus        36 ~Gp~G~GKT~la   47 (305)
T TIGR00635        36 YGPPGLGKTTLA   47 (305)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999987


No 149
>CHL00181 cbbX CbbX; Provisional
Probab=46.02  E-value=6.7  Score=36.71  Aligned_cols=12  Identities=33%  Similarity=0.365  Sum_probs=10.9

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||.+|+|||+..
T Consensus        65 ~G~pGtGKT~lA   76 (287)
T CHL00181         65 TGSPGTGKTTVA   76 (287)
T ss_pred             ECCCCCCHHHHH
Confidence            699999999876


No 150
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=45.86  E-value=7.1  Score=37.79  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.++
T Consensus        36 GPSGcGKSTlL   46 (338)
T COG3839          36 GPSGCGKSTLL   46 (338)
T ss_pred             CCCCCCHHHHH
Confidence            89999999998


No 151
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=45.33  E-value=6.7  Score=36.56  Aligned_cols=12  Identities=33%  Similarity=0.379  Sum_probs=10.7

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||.+|+|||+.-
T Consensus        64 ~G~pGTGKT~lA   75 (284)
T TIGR02880        64 TGNPGTGKTTVA   75 (284)
T ss_pred             EcCCCCCHHHHH
Confidence            699999999865


No 152
>PF12774 AAA_6:  Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=45.09  E-value=6.5  Score=35.81  Aligned_cols=41  Identities=20%  Similarity=0.193  Sum_probs=24.2

Q ss_pred             CCCCcccccccc------ccccCCCCCCCCcChHHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTM------GTGFETDVSEEMLGIIPRAITHLFEGIQNI   42 (286)
Q Consensus         1 YGqTGSGKTyTm------~G~~~~~~~~~~~GIiPRal~~LF~~~~~~   42 (286)
                      +|++|+|||.|+      +|-.- -.-.-..++=.-.+..||..+...
T Consensus        38 ~GpagtGKtetik~La~~lG~~~-~vfnc~~~~~~~~l~ril~G~~~~   84 (231)
T PF12774_consen   38 SGPAGTGKTETIKDLARALGRFV-VVFNCSEQMDYQSLSRILKGLAQS   84 (231)
T ss_dssp             ESSTTSSHHHHHHHHHHCTT--E-EEEETTSSS-HHHHHHHHHHHHHH
T ss_pred             cCCCCCCchhHHHHHHHHhCCeE-EEecccccccHHHHHHHHHHHhhc
Confidence            699999999999      33100 001133455566777777776553


No 153
>TIGR00376 DNA helicase, putative. The gene product may represent a DNA helicase. Eukaryotic members of this family have been characterized as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterized as helicases.
Probab=45.05  E-value=6.6  Score=41.03  Aligned_cols=13  Identities=38%  Similarity=0.381  Sum_probs=11.6

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|+.|+|||||+.
T Consensus       179 ~GpPGTGKT~t~~  191 (637)
T TIGR00376       179 HGPPGTGKTRTLV  191 (637)
T ss_pred             EcCCCCCHHHHHH
Confidence            4899999999995


No 154
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=44.46  E-value=7.5  Score=38.81  Aligned_cols=12  Identities=50%  Similarity=0.548  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+||+|||.|+.
T Consensus       248 GptGvGKTTTia  259 (436)
T PRK11889        248 GPTGVGKTTTLA  259 (436)
T ss_pred             CCCCCcHHHHHH
Confidence            899999999994


No 155
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.
Probab=44.23  E-value=7.7  Score=36.53  Aligned_cols=11  Identities=55%  Similarity=0.513  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||||||..|
T Consensus       151 G~tGsGKTTll  161 (308)
T TIGR02788       151 GGTGSGKTTFL  161 (308)
T ss_pred             CCCCCCHHHHH
Confidence            89999999987


No 156
>cd01127 TrwB Bacterial conjugation protein TrwB,  ATP binding domain. TrwB is a homohexamer encoded by conjugative plasmids in Gram-negative bacteria. TrwB also has an all alpha domain which has been hypothesized to be responsible for DNA binding. TrwB is a component of Type IV secretion and is responsible for the horizontal transfer of DNA between bacteria.
Probab=44.17  E-value=7.4  Score=38.15  Aligned_cols=12  Identities=42%  Similarity=0.601  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|.||||||..|
T Consensus        48 ~g~tGsGKt~~i   59 (410)
T cd01127          48 IGTTGTGKTTQI   59 (410)
T ss_pred             EcCCCCCHHHHH
Confidence            599999999887


No 157
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=43.88  E-value=6  Score=33.97  Aligned_cols=12  Identities=42%  Similarity=0.437  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||..|
T Consensus        26 ~G~rg~GKTsLl   37 (234)
T PF01637_consen   26 YGPRGSGKTSLL   37 (234)
T ss_dssp             EESTTSSHHHHH
T ss_pred             EcCCcCCHHHHH
Confidence            799999999988


No 158
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=43.80  E-value=7.9  Score=32.73  Aligned_cols=11  Identities=27%  Similarity=0.425  Sum_probs=10.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus         8 G~sGsGKttl~   18 (179)
T TIGR02322         8 GPSGAGKDTLL   18 (179)
T ss_pred             CCCCCCHHHHH
Confidence            89999999988


No 159
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=43.59  E-value=7.8  Score=37.78  Aligned_cols=41  Identities=22%  Similarity=0.333  Sum_probs=23.7

Q ss_pred             CCCCcccccccccc---ccCC--------CCCCCCcChHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTMGT---GFET--------DVSEEMLGIIPRAITHLFEGIQN   41 (286)
Q Consensus         1 YGqTGSGKTyTm~G---~~~~--------~~~~~~~GIiPRal~~LF~~~~~   41 (286)
                      ||++|+|||+..--   ....        .......|-.++.+..+|.....
T Consensus       171 ~GppGtGKT~lAkaia~~~~~~~i~v~~~~l~~~~~g~~~~~i~~~f~~a~~  222 (389)
T PRK03992        171 YGPPGTGKTLLAKAVAHETNATFIRVVGSELVQKFIGEGARLVRELFELARE  222 (389)
T ss_pred             ECCCCCChHHHHHHHHHHhCCCEEEeehHHHhHhhccchHHHHHHHHHHHHh
Confidence            89999999987611   0000        00111234456778888887654


No 160
>PRK05480 uridine/cytidine kinase; Provisional
Probab=43.52  E-value=8  Score=33.74  Aligned_cols=11  Identities=45%  Similarity=0.444  Sum_probs=9.8

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+..
T Consensus        13 G~sGsGKTTl~   23 (209)
T PRK05480         13 GGSGSGKTTVA   23 (209)
T ss_pred             CCCCCCHHHHH
Confidence            89999999766


No 161
>PF03215 Rad17:  Rad17 cell cycle checkpoint protein
Probab=43.44  E-value=7.6  Score=39.65  Aligned_cols=12  Identities=42%  Similarity=0.487  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|+|||.|+
T Consensus        51 tGP~G~GKtttv   62 (519)
T PF03215_consen   51 TGPSGCGKTTTV   62 (519)
T ss_pred             ECCCCCCHHHHH
Confidence            699999999998


No 162
>PTZ00301 uridine kinase; Provisional
Probab=43.27  E-value=8.4  Score=34.48  Aligned_cols=11  Identities=36%  Similarity=0.377  Sum_probs=9.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+.-
T Consensus        10 G~SgSGKTTla   20 (210)
T PTZ00301         10 GASGSGKSSLS   20 (210)
T ss_pred             CCCcCCHHHHH
Confidence            89999999864


No 163
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=42.97  E-value=7.7  Score=35.65  Aligned_cols=12  Identities=33%  Similarity=0.368  Sum_probs=11.2

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||+++
T Consensus        44 ~G~~G~GKt~~~   55 (319)
T PRK00440         44 AGPPGTGKTTAA   55 (319)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999887


No 164
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional
Probab=42.85  E-value=7.5  Score=43.34  Aligned_cols=13  Identities=46%  Similarity=0.555  Sum_probs=10.9

Q ss_pred             CCCcccccccccc
Q psy15014          2 LQTGSGKTYTMGT   14 (286)
Q Consensus         2 GqTGSGKTyTm~G   14 (286)
                      -.||||||+||..
T Consensus       440 maTGSGKT~tai~  452 (1123)
T PRK11448        440 MATGTGKTRTAIA  452 (1123)
T ss_pred             eCCCCCHHHHHHH
Confidence            3799999999864


No 165
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.
Probab=42.72  E-value=7.9  Score=38.86  Aligned_cols=12  Identities=33%  Similarity=0.432  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||+.+
T Consensus        94 ~GppGtGKT~la  105 (495)
T TIGR01241        94 VGPPGTGKTLLA  105 (495)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999987


No 166
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=42.72  E-value=8.5  Score=38.14  Aligned_cols=13  Identities=54%  Similarity=0.547  Sum_probs=11.6

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|++|+|||+|+.
T Consensus       212 vGptGvGKTTt~a  224 (407)
T PRK12726        212 IGQTGVGKTTTLV  224 (407)
T ss_pred             ECCCCCCHHHHHH
Confidence            3899999999995


No 167
>PF10236 DAP3:  Mitochondrial ribosomal death-associated protein 3;  InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry represents a family of conserved proteins which were originally described as death-associated-protein-3 (DAP-3). The proteins carry a P-loop DNA-binding motif, and induce apoptosis []. DAP3 has been shown to be a pro-apoptotic factor in the mitochondrial matrix [] and to be crucial for mitochondrial biogenesis and so has also been designated as MRP-S29 (mitochondrial ribosomal protein subunit 29). 
Probab=42.57  E-value=8.1  Score=36.58  Aligned_cols=13  Identities=31%  Similarity=0.450  Sum_probs=11.9

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||+.|||||.+|.
T Consensus        29 ~G~~GsGKS~~L~   41 (309)
T PF10236_consen   29 TGERGSGKSVLLA   41 (309)
T ss_pred             ECCCCCCHHHHHH
Confidence            7999999999994


No 168
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=42.55  E-value=8.2  Score=39.13  Aligned_cols=13  Identities=46%  Similarity=0.309  Sum_probs=11.2

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.||||||-.++
T Consensus         3 ~g~TGsGKT~v~l   15 (505)
T TIGR00595         3 FGVTGSGKTEVYL   15 (505)
T ss_pred             cCCCCCCHHHHHH
Confidence            6999999998764


No 169
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=42.38  E-value=8.5  Score=36.07  Aligned_cols=11  Identities=36%  Similarity=0.471  Sum_probs=10.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+.|+|||.+|
T Consensus        38 G~NGAGKTTll   48 (293)
T COG1131          38 GPNGAGKTTLL   48 (293)
T ss_pred             CCCCCCHHHHH
Confidence            89999999998


No 170
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=41.75  E-value=9.1  Score=33.71  Aligned_cols=12  Identities=33%  Similarity=0.454  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..|
T Consensus        34 ~G~NGsGKSTll   45 (213)
T cd03279          34 CGPTGAGKSTIL   45 (213)
T ss_pred             ECCCCCCHHHHH
Confidence            399999999988


No 171
>PRK06547 hypothetical protein; Provisional
Probab=41.61  E-value=8.7  Score=33.19  Aligned_cols=12  Identities=42%  Similarity=0.357  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|.+|||||+.-
T Consensus        21 ~G~~GsGKTt~a   32 (172)
T PRK06547         21 DGRSGSGKTTLA   32 (172)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999876


No 172
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=41.54  E-value=8.9  Score=36.57  Aligned_cols=12  Identities=50%  Similarity=0.617  Sum_probs=11.0

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |++|+|||.|+.
T Consensus       121 GpnGsGKTTt~~  132 (318)
T PRK10416        121 GVNGVGKTTTIG  132 (318)
T ss_pred             CCCCCcHHHHHH
Confidence            899999999984


No 173
>KOG0335|consensus
Probab=41.52  E-value=11  Score=38.10  Aligned_cols=13  Identities=54%  Similarity=0.516  Sum_probs=11.4

Q ss_pred             CCCcccccccccc
Q psy15014          2 LQTGSGKTYTMGT   14 (286)
Q Consensus         2 GqTGSGKTyTm~G   14 (286)
                      +|||||||+--+.
T Consensus       118 AqTGsGKT~aFLi  130 (482)
T KOG0335|consen  118 AQTGSGKTAAFLI  130 (482)
T ss_pred             ccCCCcchHHHHH
Confidence            6999999998865


No 174
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=41.38  E-value=9.2  Score=40.91  Aligned_cols=12  Identities=50%  Similarity=0.484  Sum_probs=11.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|+||+|||.|+
T Consensus       191 VGpnGvGKTTTi  202 (767)
T PRK14723        191 VGPTGVGKTTTT  202 (767)
T ss_pred             ECCCCCcHHHHH
Confidence            399999999999


No 175
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=41.36  E-value=8.4  Score=42.23  Aligned_cols=12  Identities=42%  Similarity=0.434  Sum_probs=11.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||.|+
T Consensus       787 yG~PGTGKTATV  798 (1164)
T PTZ00112        787 SGMPGTGKTATV  798 (1164)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999998


No 176
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=41.26  E-value=9.6  Score=31.69  Aligned_cols=10  Identities=40%  Similarity=0.411  Sum_probs=8.8

Q ss_pred             CCCccccccc
Q psy15014          2 LQTGSGKTYT   11 (286)
Q Consensus         2 GqTGSGKTyT   11 (286)
                      |.+|||||+.
T Consensus         5 G~~GsGKSTl   14 (163)
T TIGR01313         5 GVAGSGKSTI   14 (163)
T ss_pred             CCCCCCHHHH
Confidence            8999999865


No 177
>PRK07261 topology modulation protein; Provisional
Probab=41.18  E-value=9.6  Score=32.59  Aligned_cols=11  Identities=36%  Similarity=0.353  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+-.
T Consensus         7 G~~GsGKSTla   17 (171)
T PRK07261          7 GYSGSGKSTLA   17 (171)
T ss_pred             cCCCCCHHHHH
Confidence            99999999876


No 178
>PF01745 IPT:  Isopentenyl transferase;  InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [].; GO: 0004161 dimethylallyltranstransferase activity, 0009058 biosynthetic process; PDB: 2ZE8_C 2ZE5_A 2ZE7_A 2ZE6_A.
Probab=40.94  E-value=8  Score=35.46  Aligned_cols=12  Identities=42%  Similarity=0.437  Sum_probs=9.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+||+|||..-
T Consensus         7 ~GpT~tGKt~~a   18 (233)
T PF01745_consen    7 VGPTGTGKTALA   18 (233)
T ss_dssp             E-STTSSHHHHH
T ss_pred             ECCCCCChhHHH
Confidence            599999999865


No 179
>PF05872 DUF853:  Bacterial protein of unknown function (DUF853);  InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold. This family is restricted to bacterial proteins, none of which have currently been characterised.
Probab=40.64  E-value=11  Score=38.14  Aligned_cols=11  Identities=55%  Similarity=0.682  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||+|||-|+
T Consensus        26 GATGTGKTvTL   36 (502)
T PF05872_consen   26 GATGTGKTVTL   36 (502)
T ss_pred             ccCCCCceehH
Confidence            88999999998


No 180
>TIGR00064 ftsY signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.
Probab=40.62  E-value=9.3  Score=35.52  Aligned_cols=12  Identities=42%  Similarity=0.448  Sum_probs=11.0

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |++|+|||.|..
T Consensus        79 G~~G~GKTTt~a   90 (272)
T TIGR00064        79 GVNGVGKTTTIA   90 (272)
T ss_pred             CCCCCcHHHHHH
Confidence            899999999984


No 181
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=40.09  E-value=9.8  Score=29.66  Aligned_cols=12  Identities=25%  Similarity=0.346  Sum_probs=10.6

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||..+-
T Consensus         3 G~~gsGKstl~~   14 (163)
T cd00880           3 GRTNAGKSSLLN   14 (163)
T ss_pred             CCCCCCHHHHHH
Confidence            899999998883


No 182
>TIGR00554 panK_bact pantothenate kinase, bacterial type. Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.
Probab=39.77  E-value=9.9  Score=35.91  Aligned_cols=11  Identities=27%  Similarity=0.199  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+++
T Consensus        69 G~~GSGKSTla   79 (290)
T TIGR00554        69 GSVAVGKSTTA   79 (290)
T ss_pred             CCCCCCHHHHH
Confidence            89999999988


No 183
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=39.73  E-value=9.9  Score=34.73  Aligned_cols=19  Identities=26%  Similarity=0.379  Sum_probs=13.8

Q ss_pred             EcCCHHHHHHHHHHHHhcC
Q psy15014        212 SIRSAQEAMNALRQGALSR  230 (286)
Q Consensus       212 ~V~S~eea~~lL~~G~~~R  230 (286)
                      ...+.++++.+|..-.+.+
T Consensus       174 D~~t~~~V~~ll~~~~~~~  192 (226)
T COG1136         174 DSKTAKEVLELLRELNKER  192 (226)
T ss_pred             ChHHHHHHHHHHHHHHHhc
Confidence            4567889999998766543


No 184
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional
Probab=39.65  E-value=9.3  Score=38.19  Aligned_cols=41  Identities=22%  Similarity=0.342  Sum_probs=23.9

Q ss_pred             CCCCcccccccccc---ccC--------CCCCCCCcChHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTMGT---GFE--------TDVSEEMLGIIPRAITHLFEGIQN   41 (286)
Q Consensus         1 YGqTGSGKTyTm~G---~~~--------~~~~~~~~GIiPRal~~LF~~~~~   41 (286)
                      ||++|+|||.+.--   ...        ......-.|--++.+..+|.....
T Consensus       223 ~GPPGTGKT~LAraIA~el~~~fi~V~~seL~~k~~Ge~~~~vr~lF~~A~~  274 (438)
T PTZ00361        223 YGPPGTGKTLLAKAVANETSATFLRVVGSELIQKYLGDGPKLVRELFRVAEE  274 (438)
T ss_pred             ECCCCCCHHHHHHHHHHhhCCCEEEEecchhhhhhcchHHHHHHHHHHHHHh
Confidence            89999999998721   000        000112235557778888876543


No 185
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]
Probab=39.47  E-value=9.9  Score=37.00  Aligned_cols=14  Identities=21%  Similarity=0.048  Sum_probs=12.2

Q ss_pred             EEEEEcccccccch
Q psy15014         62 FLELYNEEVSGLEH   75 (286)
Q Consensus        62 ~~EIYnE~i~DLL~   75 (286)
                      +=||+..+.+|||.
T Consensus       254 VGEVRG~Ea~dLL~  267 (355)
T COG4962         254 VGEVRGVEALDLLQ  267 (355)
T ss_pred             EEEecCccHHHHHH
Confidence            46999999999996


No 186
>TIGR02746 TraC-F-type type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.
Probab=39.08  E-value=10  Score=40.10  Aligned_cols=12  Identities=33%  Similarity=0.592  Sum_probs=11.1

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||++|.
T Consensus       437 G~tGsGKS~~~~  448 (797)
T TIGR02746       437 GGSGAGKSFFMQ  448 (797)
T ss_pred             cCCCCCHHHHHH
Confidence            899999999993


No 187
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=38.77  E-value=11  Score=30.17  Aligned_cols=12  Identities=33%  Similarity=0.293  Sum_probs=10.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..-
T Consensus         5 ~G~~GsGKst~a   16 (147)
T cd02020           5 DGPAGSGKSTVA   16 (147)
T ss_pred             ECCCCCCHHHHH
Confidence            389999999854


No 188
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB. This molybdenum cofactor biosynthesis enzyme is similar to the urease accessory protein UreG and to the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocenters of their respective target enzymes.
Probab=38.39  E-value=11  Score=32.00  Aligned_cols=12  Identities=33%  Similarity=0.249  Sum_probs=10.4

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||..+.
T Consensus         6 G~~gsGKTtl~~   17 (155)
T TIGR00176         6 GPKNSGKTTLIE   17 (155)
T ss_pred             CCCCCCHHHHHH
Confidence            889999998773


No 189
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=38.38  E-value=11  Score=33.05  Aligned_cols=11  Identities=45%  Similarity=0.444  Sum_probs=9.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+.+
T Consensus        13 G~sGsGKSTl~   23 (207)
T TIGR00235        13 GGSGSGKTTVA   23 (207)
T ss_pred             CCCCCCHHHHH
Confidence            89999999655


No 190
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=38.34  E-value=11  Score=30.83  Aligned_cols=12  Identities=42%  Similarity=0.407  Sum_probs=10.2

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|..|||||+.-
T Consensus         5 ~G~~GsGKST~a   16 (150)
T cd02021           5 MGVSGSGKSTVG   16 (150)
T ss_pred             EcCCCCCHHHHH
Confidence            489999999875


No 191
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=38.23  E-value=10  Score=41.61  Aligned_cols=10  Identities=70%  Similarity=0.757  Sum_probs=9.3

Q ss_pred             Cccccccccc
Q psy15014          4 TGSGKTYTMG   13 (286)
Q Consensus         4 TGSGKTyTm~   13 (286)
                      +|||||.||+
T Consensus       282 qGSGKTlTm~  291 (962)
T COG0610         282 QGSGKTLTMF  291 (962)
T ss_pred             cCCchHHHHH
Confidence            7999999996


No 192
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional
Probab=38.11  E-value=10  Score=37.30  Aligned_cols=41  Identities=22%  Similarity=0.297  Sum_probs=24.1

Q ss_pred             CCCCcccccccccc---ccCCC--------CCCCCcChHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTMGT---GFETD--------VSEEMLGIIPRAITHLFEGIQN   41 (286)
Q Consensus         1 YGqTGSGKTyTm~G---~~~~~--------~~~~~~GIiPRal~~LF~~~~~   41 (286)
                      ||+.|+|||+..-.   .....        ......|--++.+.++|.....
T Consensus       185 ~GppGTGKT~LAkalA~~l~~~fi~i~~s~l~~k~~ge~~~~lr~lf~~A~~  236 (398)
T PTZ00454        185 YGPPGTGKTMLAKAVAHHTTATFIRVVGSEFVQKYLGEGPRMVRDVFRLARE  236 (398)
T ss_pred             ECCCCCCHHHHHHHHHHhcCCCEEEEehHHHHHHhcchhHHHHHHHHHHHHh
Confidence            89999999998721   00000        0011234456778888877654


No 193
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=37.99  E-value=10  Score=37.83  Aligned_cols=13  Identities=46%  Similarity=0.440  Sum_probs=11.6

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|.+|+|||.|..
T Consensus       101 vG~~GsGKTTtaa  113 (437)
T PRK00771        101 VGLQGSGKTTTAA  113 (437)
T ss_pred             ECCCCCcHHHHHH
Confidence            5999999999984


No 194
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=37.89  E-value=10  Score=33.39  Aligned_cols=12  Identities=42%  Similarity=0.567  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|+|||..+
T Consensus        28 ~G~NGsGKTTLl   39 (204)
T cd03240          28 VGQNGAGKTTII   39 (204)
T ss_pred             ECCCCCCHHHHH
Confidence            599999999887


No 195
>PRK14974 cell division protein FtsY; Provisional
Probab=37.73  E-value=11  Score=36.26  Aligned_cols=12  Identities=42%  Similarity=0.518  Sum_probs=11.0

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|+|||.|+.
T Consensus       147 G~~GvGKTTtia  158 (336)
T PRK14974        147 GVNGTGKTTTIA  158 (336)
T ss_pred             cCCCCCHHHHHH
Confidence            899999999984


No 196
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=37.10  E-value=11  Score=31.62  Aligned_cols=12  Identities=33%  Similarity=0.249  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|.+|+|||...
T Consensus         5 ~G~~G~GKT~l~   16 (187)
T cd01124           5 SGGPGTGKTTFA   16 (187)
T ss_pred             EcCCCCCHHHHH
Confidence            699999999865


No 197
>PF02702 KdpD:  Osmosensitive K+ channel His kinase sensor domain;  InterPro: IPR003852 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. Signal transducing histidine kinases are the key elements in two-component signal transduction systems, which control complex processes such as the initiation of development in microorganisms [, ]. Examples of histidine kinases are EnvZ, which plays a central role in osmoregulation [], and CheA, which plays a central role in the chemotaxis system []. Histidine kinases usually have an N-terminal ligand-binding domain and a C-terminal kinase domain, but other domains may also be present. The kinase domain is responsible for the autophosphorylation of the histidine with ATP, the phosphotransfer from the kinase to an aspartate of the response regulator, and (with bifunctional enzymes) the phosphotransfer from aspartyl phosphate back to ADP or to water []. The kinase core has a unique fold, distinct from that of the Ser/Thr/Tyr kinase superfamily.  HKs can be roughly divided into two classes: orthodox and hybrid kinases [, ]. Most orthodox HKs, typified by the Escherichia coli EnvZ protein, function as periplasmic membrane receptors and have a signal peptide and transmembrane segment(s) that separate the protein into a periplasmic N-terminal sensing domain and a highly conserved cytoplasmic C-terminal kinase core. Members of this family, however, have an integral membrane sensor domain. Not all orthodox kinases are membrane bound, e.g., the nitrogen regulatory kinase NtrB (GlnL) is a soluble cytoplasmic HK []. Hybrid kinases contain multiple phosphodonor and phosphoacceptor sites and use multi-step phospho-relay schemes instead of promoting a single phosphoryl transfer. In addition to the sensor domain and kinase core, they contain a CheY-like receiver domain and a His-containing phosphotransfer (HPt) domain. This entry represents the N-terminal domain found in KdpD sensor kinase proteins, which regulate the kdpFABC operon responsible for potassium transport []. The N-terminal domain forms part of the cytoplasmic region of the protein, which may be the sensor domain responsible for sensing turgor pressure [].; GO: 0000155 two-component sensor activity, 0004673 protein histidine kinase activity, 0000160 two-component signal transduction system (phosphorelay), 0016020 membrane; PDB: 2R8R_B.
Probab=37.06  E-value=11  Score=34.22  Aligned_cols=12  Identities=50%  Similarity=0.725  Sum_probs=9.9

Q ss_pred             CCcccccccccc
Q psy15014          3 QTGSGKTYTMGT   14 (286)
Q Consensus         3 qTGSGKTyTm~G   14 (286)
                      ..|.||||.|+-
T Consensus        13 apGVGKTy~ML~   24 (211)
T PF02702_consen   13 APGVGKTYAMLQ   24 (211)
T ss_dssp             STTSSHHHHHHH
T ss_pred             CCCCCHHHHHHH
Confidence            369999999963


No 198
>PRK00300 gmk guanylate kinase; Provisional
Probab=37.01  E-value=12  Score=32.33  Aligned_cols=11  Identities=27%  Similarity=0.434  Sum_probs=9.7

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        12 G~sGsGKstl~   22 (205)
T PRK00300         12 GPSGAGKSTLV   22 (205)
T ss_pred             CCCCCCHHHHH
Confidence            89999999765


No 199
>PF13304 AAA_21:  AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A.
Probab=36.85  E-value=11  Score=31.57  Aligned_cols=12  Identities=33%  Similarity=0.537  Sum_probs=0.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|..|||||.-+
T Consensus         5 iG~N~sGKS~il   16 (303)
T PF13304_consen    5 IGPNGSGKSNIL   16 (303)
T ss_dssp             ------------
T ss_pred             cccccccccccc
Confidence            699999999887


No 200
>PRK06217 hypothetical protein; Validated
Probab=36.71  E-value=12  Score=31.97  Aligned_cols=11  Identities=36%  Similarity=0.250  Sum_probs=9.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+--
T Consensus         8 G~~GsGKSTla   18 (183)
T PRK06217          8 GASGSGTTTLG   18 (183)
T ss_pred             CCCCCCHHHHH
Confidence            89999999754


No 201
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=36.67  E-value=12  Score=32.48  Aligned_cols=12  Identities=42%  Similarity=0.376  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||.+|||||--.
T Consensus        18 ~G~~GsGKT~l~   29 (209)
T TIGR02237        18 YGPPGSGKTNIC   29 (209)
T ss_pred             ECCCCCCHHHHH
Confidence            699999999765


No 202
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion. These proteins aid the transfer of DNA from the plasmid into the host bacterial chromosome. They contain an ATP binding domain. VirD4 is involved in DNA transfer to plant cells and is required for virulence.
Probab=36.41  E-value=15  Score=35.46  Aligned_cols=13  Identities=31%  Similarity=0.225  Sum_probs=11.2

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|.||||||+++.
T Consensus         5 ~g~tGsGKt~~~v   17 (384)
T cd01126           5 FAPTRSGKGVGFV   17 (384)
T ss_pred             ecCCCCCCccEEE
Confidence            4899999999874


No 203
>PF07693 KAP_NTPase:  KAP family P-loop domain;  InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side [].
Probab=36.28  E-value=12  Score=34.68  Aligned_cols=42  Identities=17%  Similarity=0.197  Sum_probs=27.4

Q ss_pred             CCCCcccccccccc------c----------cCCCCCCCCcChHHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTMGT------G----------FETDVSEEMLGIIPRAITHLFEGIQNI   42 (286)
Q Consensus         1 YGqTGSGKTyTm~G------~----------~~~~~~~~~~GIiPRal~~LF~~~~~~   42 (286)
                      ||.-|||||+-|--      .          ++.+......-++...+..|+..+...
T Consensus        26 ~G~WGsGKSs~l~~l~~~L~~~~~~~~~~i~fn~w~~~~~~~~~~~~~~~l~~~l~~~   83 (325)
T PF07693_consen   26 YGEWGSGKSSFLNMLKEELKEDNKEKYIFIYFNAWEYDGEDDLWASFLEELFDQLEKH   83 (325)
T ss_pred             ECCCCCCHHHHHHHHHHHHhcccccceeeEEEccccCCCcchHHHHHHHHHHHHHHHh
Confidence            69999999999821      0          111122333567777788888887765


No 204
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).
Probab=36.23  E-value=12  Score=39.36  Aligned_cols=11  Identities=55%  Similarity=0.564  Sum_probs=10.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||||||++|
T Consensus       441 G~tGsGKS~~~  451 (785)
T TIGR00929       441 GPTGSGKTTLL  451 (785)
T ss_pred             CCCCCCHHHHH
Confidence            89999999999


No 205
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=36.02  E-value=12  Score=35.49  Aligned_cols=12  Identities=42%  Similarity=0.338  Sum_probs=10.9

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||+.|.
T Consensus       150 G~t~sGKTt~ln  161 (312)
T COG0630         150 GGTASGKTTLLN  161 (312)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999994


No 206
>TIGR02173 cyt_kin_arch cytidylate kinase, putative. Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.
Probab=35.97  E-value=12  Score=30.96  Aligned_cols=12  Identities=42%  Similarity=0.351  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+.|||||+..
T Consensus         6 ~G~~GSGKstia   17 (171)
T TIGR02173         6 SGPPGSGKTTVA   17 (171)
T ss_pred             ECCCCCCHHHHH
Confidence            599999999776


No 207
>PTZ00424 helicase 45; Provisional
Probab=35.96  E-value=12  Score=35.82  Aligned_cols=11  Identities=55%  Similarity=0.767  Sum_probs=9.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      ++||||||.+.
T Consensus        72 apTGsGKT~~~   82 (401)
T PTZ00424         72 AQSGTGKTATF   82 (401)
T ss_pred             CCCCChHHHHH
Confidence            68999999865


No 208
>PF02562 PhoH:  PhoH-like protein;  InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [].; GO: 0005524 ATP binding; PDB: 3B85_A.
Probab=35.96  E-value=14  Score=33.20  Aligned_cols=13  Identities=31%  Similarity=0.332  Sum_probs=9.3

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|+.||||||.-.
T Consensus        25 ~G~AGTGKT~LA~   37 (205)
T PF02562_consen   25 NGPAGTGKTFLAL   37 (205)
T ss_dssp             E--TTSSTTHHHH
T ss_pred             ECCCCCcHHHHHH
Confidence            3899999998875


No 209
>PRK10536 hypothetical protein; Provisional
Probab=35.94  E-value=13  Score=34.75  Aligned_cols=13  Identities=31%  Similarity=0.486  Sum_probs=11.1

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|..||||||...
T Consensus        80 ~G~aGTGKT~La~   92 (262)
T PRK10536         80 TGEAGCGKTWISA   92 (262)
T ss_pred             ECCCCCCHHHHHH
Confidence            3899999999874


No 210
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=35.76  E-value=13  Score=33.05  Aligned_cols=11  Identities=36%  Similarity=0.477  Sum_probs=10.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        30 GpNGsGKStll   40 (243)
T cd03272          30 GRNGSGKSNFF   40 (243)
T ss_pred             CCCCCCHHHHH
Confidence            89999999998


No 211
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=35.27  E-value=13  Score=31.95  Aligned_cols=11  Identities=36%  Similarity=0.459  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus         9 G~sGsGKsTl~   19 (186)
T PRK10078          9 GPSGSGKDSLL   19 (186)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 212
>PRK13909 putative recombination protein RecB; Provisional
Probab=35.17  E-value=12  Score=40.57  Aligned_cols=10  Identities=50%  Similarity=1.019  Sum_probs=8.2

Q ss_pred             Cccccccccc
Q psy15014          4 TGSGKTYTMG   13 (286)
Q Consensus         4 TGSGKTyTm~   13 (286)
                      -||||||||.
T Consensus         7 AGsGKT~~L~   16 (910)
T PRK13909          7 AGSGKTFALS   16 (910)
T ss_pred             CCCchhHHHH
Confidence            4899999983


No 213
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=35.16  E-value=12  Score=29.17  Aligned_cols=12  Identities=17%  Similarity=0.238  Sum_probs=10.7

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|||||..|
T Consensus         7 ~G~~~~GKstl~   18 (161)
T TIGR00231         7 VGDPNVGKSTLL   18 (161)
T ss_pred             ECCCCCCHHHHH
Confidence            489999999887


No 214
>PF02463 SMC_N:  RecF/RecN/SMC N terminal domain;  InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []. The domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.; PDB: 3HTK_A 1W1W_C 2WD5_A 3L51_A 1XEW_Y 3KTA_B 3NWC_B 1XEX_A 1GXL_C 1GXK_A ....
Probab=35.09  E-value=11  Score=32.98  Aligned_cols=12  Identities=33%  Similarity=0.512  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|||||--+
T Consensus        30 ~G~NGsGKS~il   41 (220)
T PF02463_consen   30 VGPNGSGKSNIL   41 (220)
T ss_dssp             EESTTSSHHHHH
T ss_pred             EcCCCCCHHHHH
Confidence            599999999766


No 215
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=35.08  E-value=12  Score=27.08  Aligned_cols=14  Identities=29%  Similarity=0.249  Sum_probs=11.0

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      +|..|+|||.+...
T Consensus         5 ~g~~G~Gktt~~~~   18 (99)
T cd01983           5 TGKGGVGKTTLAAN   18 (99)
T ss_pred             ECCCCCCHHHHHHH
Confidence            47779999988853


No 216
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage.  When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task.  This CD represents the nucleotide binding domain of RecF.  RecF  belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=35.02  E-value=12  Score=34.28  Aligned_cols=12  Identities=25%  Similarity=0.349  Sum_probs=10.9

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|||||--|
T Consensus        27 ~G~NGsGKS~ll   38 (270)
T cd03242          27 VGENAQGKTNLL   38 (270)
T ss_pred             ECCCCCCHHHHH
Confidence            699999999877


No 217
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=34.99  E-value=13  Score=32.23  Aligned_cols=11  Identities=36%  Similarity=0.428  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        28 G~nG~GKSTLl   38 (176)
T cd03238          28 GVSGSGKSTLV   38 (176)
T ss_pred             CCCCCCHHHHH
Confidence            89999999888


No 218
>PHA00729 NTP-binding motif containing protein
Probab=34.92  E-value=13  Score=34.00  Aligned_cols=13  Identities=38%  Similarity=0.281  Sum_probs=11.1

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|.+|+||||-..
T Consensus        23 tG~pGvGKT~LA~   35 (226)
T PHA00729         23 FGKQGSGKTTYAL   35 (226)
T ss_pred             ECCCCCCHHHHHH
Confidence            5999999998763


No 219
>TIGR03689 pup_AAA proteasome ATPase. In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity.
Probab=34.57  E-value=13  Score=37.95  Aligned_cols=12  Identities=33%  Similarity=0.362  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||...
T Consensus       222 yGPPGTGKT~LA  233 (512)
T TIGR03689       222 YGPPGCGKTLIA  233 (512)
T ss_pred             ECCCCCcHHHHH
Confidence            899999999765


No 220
>smart00488 DEXDc2 DEAD-like helicases superfamily.
Probab=34.21  E-value=13  Score=34.65  Aligned_cols=13  Identities=38%  Similarity=0.514  Sum_probs=10.7

Q ss_pred             CCCcccccccccc
Q psy15014          2 LQTGSGKTYTMGT   14 (286)
Q Consensus         2 GqTGSGKTyTm~G   14 (286)
                      .+||+|||.+.+-
T Consensus        34 apTGtGKTl~~L~   46 (289)
T smart00488       34 SPTGTGKTLSLLC   46 (289)
T ss_pred             CCCCcchhHHHHH
Confidence            3799999998853


No 221
>smart00489 DEXDc3 DEAD-like helicases superfamily.
Probab=34.21  E-value=13  Score=34.65  Aligned_cols=13  Identities=38%  Similarity=0.514  Sum_probs=10.7

Q ss_pred             CCCcccccccccc
Q psy15014          2 LQTGSGKTYTMGT   14 (286)
Q Consensus         2 GqTGSGKTyTm~G   14 (286)
                      .+||+|||.+.+-
T Consensus        34 apTGtGKTl~~L~   46 (289)
T smart00489       34 SPTGTGKTLSLLC   46 (289)
T ss_pred             CCCCcchhHHHHH
Confidence            3799999998853


No 222
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional
Probab=34.16  E-value=15  Score=34.91  Aligned_cols=11  Identities=27%  Similarity=0.290  Sum_probs=9.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+||||||---
T Consensus        11 GpTasGKS~LA   21 (300)
T PRK14729         11 GPTAVGKSNIL   21 (300)
T ss_pred             CCCccCHHHHH
Confidence            99999999754


No 223
>PF05707 Zot:  Zonular occludens toxin (Zot);  InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot). Zot is elaborated by bacteriophage present in toxigenic strains of Vibrio cholerae. Zot is a single polypeptide chain of 44.8 kDa, with the ability to reversibly alter intestinal epithelial tight junctions, allowing the passage of macromolecules through mucosal barriers.; PDB: 2R2A_B.
Probab=34.14  E-value=13  Score=32.44  Aligned_cols=13  Identities=38%  Similarity=0.478  Sum_probs=9.2

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|..||||||.+.
T Consensus         6 ~G~pGsGKS~~av   18 (193)
T PF05707_consen    6 TGKPGSGKSYYAV   18 (193)
T ss_dssp             E--TTSSHHHHHH
T ss_pred             EcCCCCcHhHHHH
Confidence            3899999999774


No 224
>PF12775 AAA_7:  P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=34.13  E-value=14  Score=34.37  Aligned_cols=13  Identities=31%  Similarity=0.442  Sum_probs=11.3

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|++|+|||-+|.
T Consensus        39 ~G~~GtGKT~li~   51 (272)
T PF12775_consen   39 VGPSGTGKTSLIQ   51 (272)
T ss_dssp             ESSTTSSHHHHHH
T ss_pred             ECCCCCchhHHHH
Confidence            3999999999884


No 225
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=33.97  E-value=14  Score=35.75  Aligned_cols=12  Identities=25%  Similarity=0.509  Sum_probs=11.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|||||.++
T Consensus        34 lGpSGaGKsTlL   45 (345)
T COG1118          34 LGPSGAGKSTLL   45 (345)
T ss_pred             ECCCCCcHHHHH
Confidence            699999999987


No 226
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family. Members of this protein family are predicted ATP-binding proteins apparently associated with DNA conjugal transfer. Members are found both in plasmids and in bacterial chromosomal regions that appear to derive from integrative elements such as conjugative transposons. More distant homologs, outside the scope of this family, include type IV secretion/conjugal transfer proteins such as TraC, VirB4 and TrsE. The granularity of this protein family definition is chosen so as to represent one distinctive clade and act as a marker through which to define and recognize the class of mobile element it serves.
Probab=33.92  E-value=14  Score=40.16  Aligned_cols=12  Identities=42%  Similarity=0.634  Sum_probs=11.1

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.||||||++|
T Consensus       481 ~G~TGSGKS~l~  492 (893)
T TIGR03744       481 LGPTGAGKSATL  492 (893)
T ss_pred             ECCCCCCHHHHH
Confidence            399999999999


No 227
>PRK11784 tRNA 2-selenouridine synthase; Provisional
Probab=33.88  E-value=14  Score=35.81  Aligned_cols=12  Identities=50%  Similarity=0.423  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.||||||++|
T Consensus       147 ~G~TGsGKT~iL  158 (345)
T PRK11784        147 GGNTGSGKTELL  158 (345)
T ss_pred             CCCCcccHHHHH
Confidence            389999999888


No 228
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=33.76  E-value=13  Score=32.60  Aligned_cols=12  Identities=33%  Similarity=0.504  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..|
T Consensus        28 ~G~nGsGKStll   39 (197)
T cd03278          28 VGPNGSGKSNII   39 (197)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999888


No 229
>TIGR00609 recB exodeoxyribonuclease V, beta subunit. All proteins in this family for which functions are known are DNA-DNA helicases that are used as part of an exonuclease-helicase complex (made up of RecBCD homologs) that function to generate substrates for the initiation of recombination and recombinational repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=33.74  E-value=13  Score=41.31  Aligned_cols=38  Identities=13%  Similarity=0.307  Sum_probs=22.7

Q ss_pred             hhh-cccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEE
Q psy15014        161 LAS-LNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIY  204 (286)
Q Consensus       161 ~~~-~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~  204 (286)
                      +|+ .|.-+..+..+...|.....      ...+-+.-|++..||
T Consensus       301 LVDEFQDTd~~Q~~il~~L~~~~~------~~~L~~VGDpKQSIY  339 (1087)
T TIGR00609       301 LIDEFQDTDPQQYRIFSKLFIAQK------TTSLFLIGDPKQAIY  339 (1087)
T ss_pred             EEECCcCCCHHHHHHHHHHHhCCC------CCeEEEEECCccccc
Confidence            355 56556656555555542210      136888888888887


No 230
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=33.73  E-value=14  Score=36.91  Aligned_cols=12  Identities=50%  Similarity=0.601  Sum_probs=11.0

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|+|||.|+.
T Consensus       230 GptGvGKTTtaa  241 (432)
T PRK12724        230 GPTGSGKTTSIA  241 (432)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999984


No 231
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional
Probab=33.64  E-value=14  Score=38.04  Aligned_cols=12  Identities=50%  Similarity=0.598  Sum_probs=10.9

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||+|||+|+.
T Consensus       357 GPtGvGKTTtaa  368 (559)
T PRK12727        357 GPTGAGKTTTIA  368 (559)
T ss_pred             CCCCCCHHHHHH
Confidence            899999999983


No 232
>PF04665 Pox_A32:  Poxvirus A32 protein;  InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein. This is thought to be an ATPase involved in viral DNA packaging [].
Probab=33.45  E-value=15  Score=33.93  Aligned_cols=12  Identities=42%  Similarity=0.498  Sum_probs=10.3

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||..+.
T Consensus        20 G~sGSGKT~li~   31 (241)
T PF04665_consen   20 GKSGSGKTTLIK   31 (241)
T ss_pred             CCCCCCHHHHHH
Confidence            899999998763


No 233
>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif (motif II). This domain contains the ATP- binding region.
Probab=33.41  E-value=14  Score=31.46  Aligned_cols=11  Identities=64%  Similarity=0.761  Sum_probs=9.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      ++||+|||.+.
T Consensus        43 ~~TG~GKT~~~   53 (203)
T cd00268          43 AQTGSGKTAAF   53 (203)
T ss_pred             CCCCCcHHHHH
Confidence            68999999874


No 234
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=33.25  E-value=15  Score=34.33  Aligned_cols=11  Identities=45%  Similarity=0.576  Sum_probs=10.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.+|
T Consensus        26 G~NGaGKSTLl   36 (302)
T TIGR01188        26 GPNGAGKTTTI   36 (302)
T ss_pred             CCCCCCHHHHH
Confidence            89999999988


No 235
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=33.16  E-value=15  Score=26.56  Aligned_cols=11  Identities=36%  Similarity=0.413  Sum_probs=9.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |..|||||..+
T Consensus         6 G~~gsGKst~~   16 (69)
T cd02019           6 GGSGSGKSTVA   16 (69)
T ss_pred             CCCCCCHHHHH
Confidence            88999997665


No 236
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=33.07  E-value=15  Score=32.80  Aligned_cols=11  Identities=27%  Similarity=0.323  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+.+
T Consensus        40 G~~GsGKTTl~   50 (229)
T PRK09270         40 GPPGAGKSTLA   50 (229)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 237
>PRK00131 aroK shikimate kinase; Reviewed
Probab=33.05  E-value=14  Score=30.41  Aligned_cols=12  Identities=25%  Similarity=0.221  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|..|||||+.-
T Consensus        10 ~G~~GsGKstla   21 (175)
T PRK00131         10 IGFMGAGKSTIG   21 (175)
T ss_pred             EcCCCCCHHHHH
Confidence            499999999874


No 238
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=32.95  E-value=15  Score=31.91  Aligned_cols=11  Identities=36%  Similarity=0.474  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        34 G~nGsGKSTLl   44 (211)
T cd03225          34 GPNGSGKSTLL   44 (211)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 239
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=32.88  E-value=15  Score=32.24  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        37 G~nGsGKSTLl   47 (220)
T cd03293          37 GPSGCGKSTLL   47 (220)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 240
>PF10412 TrwB_AAD_bind:  Type IV secretion-system coupling protein DNA-binding domain;  InterPro: IPR019476  The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein. It is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells []. This protein forms hexamers from six structurally very similar protomers []. This hexamer contains a central channel running from the cytosolic pole (formed by the all-alpha domains) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB all-alpha domain appears to be the DNA-binding domain of the structure. ; PDB: 1E9S_D 1E9R_F 1GKI_B 1GL7_G 1GL6_A.
Probab=32.79  E-value=13  Score=36.31  Aligned_cols=12  Identities=50%  Similarity=0.540  Sum_probs=9.4

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||.+|.
T Consensus        22 G~~GsGKT~~i~   33 (386)
T PF10412_consen   22 GATGSGKTQAIR   33 (386)
T ss_dssp             E-TTSSHHHHHH
T ss_pred             CCCCCCHHHHHH
Confidence            899999998764


No 241
>KOG2373|consensus
Probab=32.74  E-value=18  Score=35.66  Aligned_cols=12  Identities=50%  Similarity=0.504  Sum_probs=10.5

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+||||||.-|.
T Consensus       280 GpTGsGKTTFls  291 (514)
T KOG2373|consen  280 GPTGSGKTTFLS  291 (514)
T ss_pred             cCCCCCceeEeh
Confidence            899999998773


No 242
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=32.72  E-value=16  Score=31.56  Aligned_cols=12  Identities=42%  Similarity=0.338  Sum_probs=10.3

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||+...
T Consensus         6 G~sgsGKttla~   17 (179)
T cd02028           6 GPSGSGKTTFAK   17 (179)
T ss_pred             CCCCCCHHHHHH
Confidence            889999998773


No 243
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=32.71  E-value=14  Score=32.39  Aligned_cols=12  Identities=33%  Similarity=0.515  Sum_probs=10.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|+|||..|
T Consensus        27 ~G~NGsGKStll   38 (198)
T cd03276          27 VGNNGSGKSAIL   38 (198)
T ss_pred             ECCCCCcHHHHH
Confidence            599999999777


No 244
>PRK10876 recB exonuclease V subunit beta; Provisional
Probab=32.53  E-value=14  Score=41.50  Aligned_cols=14  Identities=21%  Similarity=0.472  Sum_probs=9.3

Q ss_pred             CCceEEEcCCCcEE
Q psy15014        191 SNIKIHEDSGHSIY  204 (286)
Q Consensus       191 ~~l~i~e~~~~~v~  204 (286)
                      ..+-+.-|++..||
T Consensus       407 ~~l~~VGDpkQsIY  420 (1181)
T PRK10876        407 TALLLIGDPKQAIY  420 (1181)
T ss_pred             CeEEEEeCCccccc
Confidence            35667777776666


No 245
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=32.52  E-value=15  Score=32.44  Aligned_cols=11  Identities=27%  Similarity=0.513  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        38 G~nGsGKSTLl   48 (233)
T cd03258          38 GRSGAGKSTLI   48 (233)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 246
>TIGR01587 cas3_core CRISPR-associated helicase Cas3. This model represents the highly conserved core region of an alignment of Cas3, a protein found in association with CRISPR repeat elements in a broad range of bacteria and archaea. Cas3 appears to be a helicase, with regions found by pfam00270 (DEAD/DEAH box helicase) and pfam00271 (Helicase conserved C-terminal domain). Some but not all members have an N-terminal HD domain region (pfam01966) that is not included within this model.
Probab=32.42  E-value=16  Score=34.42  Aligned_cols=11  Identities=45%  Similarity=0.465  Sum_probs=9.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      ++||||||...
T Consensus         6 apTGsGKT~~~   16 (358)
T TIGR01587         6 APTGYGKTEAA   16 (358)
T ss_pred             eCCCCCHHHHH
Confidence            68999999764


No 247
>PF06048 DUF927:  Domain of unknown function (DUF927);  InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=32.39  E-value=14  Score=34.42  Aligned_cols=12  Identities=42%  Similarity=0.445  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+|++|||.+|
T Consensus       199 ~G~Ss~GKTt~~  210 (286)
T PF06048_consen  199 YGQSSSGKTTAL  210 (286)
T ss_pred             EeCCCCCHHHHH
Confidence            799999999988


No 248
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=32.17  E-value=16  Score=31.59  Aligned_cols=11  Identities=36%  Similarity=0.561  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        31 G~nGsGKSTLl   41 (206)
T TIGR03608        31 GESGSGKSTLL   41 (206)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 249
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=32.17  E-value=12  Score=31.80  Aligned_cols=13  Identities=38%  Similarity=0.197  Sum_probs=11.4

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|++|+|||+.+.
T Consensus        38 ~g~~g~GKT~~~~   50 (193)
T PF13481_consen   38 AGPPGSGKTTLAL   50 (193)
T ss_dssp             EECSTSSHHHHHH
T ss_pred             EeCCCCCHHHHHH
Confidence            5899999999884


No 250
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=31.96  E-value=16  Score=31.30  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        25 G~nGsGKSTLl   35 (190)
T TIGR01166        25 GANGAGKSTLL   35 (190)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 251
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=31.94  E-value=16  Score=29.00  Aligned_cols=11  Identities=18%  Similarity=0.229  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|+|||..+
T Consensus        10 G~~g~GKttl~   20 (168)
T cd04163          10 GRPNVGKSTLL   20 (168)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 252
>PRK13873 conjugal transfer ATPase TrbE; Provisional
Probab=31.87  E-value=16  Score=39.14  Aligned_cols=12  Identities=33%  Similarity=0.526  Sum_probs=11.1

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|+||||||+.|
T Consensus       447 ~G~tGsGKS~l~  458 (811)
T PRK13873        447 VGPTGAGKSVLL  458 (811)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999999


No 253
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=31.45  E-value=16  Score=31.86  Aligned_cols=11  Identities=36%  Similarity=0.504  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        37 G~nGsGKSTLl   47 (218)
T cd03255          37 GPSGSGKSTLL   47 (218)
T ss_pred             cCCCCCHHHHH
Confidence            89999999876


No 254
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=31.43  E-value=16  Score=30.68  Aligned_cols=12  Identities=25%  Similarity=0.302  Sum_probs=10.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..+
T Consensus         7 ~G~~GsGKsTl~   18 (180)
T TIGR03263         7 SGPSGVGKSTLV   18 (180)
T ss_pred             ECCCCCCHHHHH
Confidence            399999999865


No 255
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional
Probab=31.40  E-value=16  Score=35.63  Aligned_cols=11  Identities=55%  Similarity=0.800  Sum_probs=9.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      ++||||||.+.
T Consensus        52 ApTGsGKTla~   62 (423)
T PRK04837         52 AQTGTGKTMAF   62 (423)
T ss_pred             CCCCchHHHHH
Confidence            58999999864


No 256
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=31.37  E-value=16  Score=30.62  Aligned_cols=13  Identities=38%  Similarity=0.358  Sum_probs=11.1

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|.+|+|||.++.
T Consensus         6 ~G~~G~GKTt~~~   18 (173)
T cd03115           6 VGLQGVGKTTTAA   18 (173)
T ss_pred             ECCCCCCHHHHHH
Confidence            3899999999874


No 257
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=31.33  E-value=16  Score=30.01  Aligned_cols=11  Identities=27%  Similarity=0.407  Sum_probs=9.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+||||||.-+
T Consensus         6 GpsGsGKstl~   16 (137)
T cd00071           6 GPSGVGKSTLL   16 (137)
T ss_pred             CCCCCCHHHHH
Confidence            89999999755


No 258
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=31.31  E-value=16  Score=31.71  Aligned_cols=11  Identities=36%  Similarity=0.501  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        35 G~nGsGKSTLl   45 (214)
T TIGR02673        35 GPSGAGKTTLL   45 (214)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 259
>COG3587 Restriction endonuclease [Defense mechanisms]
Probab=31.09  E-value=18  Score=39.14  Aligned_cols=10  Identities=70%  Similarity=1.155  Sum_probs=8.7

Q ss_pred             CCcccccccc
Q psy15014          3 QTGSGKTYTM   12 (286)
Q Consensus         3 qTGSGKTyTm   12 (286)
                      .||+|||||-
T Consensus        82 ETGTGKTy~Y   91 (985)
T COG3587          82 ETGTGKTYTY   91 (985)
T ss_pred             ecCCCceeeH
Confidence            4999999986


No 260
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=31.08  E-value=17  Score=31.56  Aligned_cols=11  Identities=36%  Similarity=0.416  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        33 G~nGsGKSTLl   43 (205)
T cd03226          33 GKNGAGKTTLA   43 (205)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 261
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=31.04  E-value=14  Score=29.40  Aligned_cols=11  Identities=36%  Similarity=0.474  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-+
T Consensus        18 G~nGsGKStLl   28 (137)
T PF00005_consen   18 GPNGSGKSTLL   28 (137)
T ss_dssp             ESTTSSHHHHH
T ss_pred             ccCCCccccce
Confidence            89999999877


No 262
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=30.85  E-value=17  Score=31.74  Aligned_cols=11  Identities=27%  Similarity=0.486  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        36 G~nGsGKSTLl   46 (216)
T TIGR00960        36 GHSGAGKSTFL   46 (216)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 263
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=30.72  E-value=17  Score=32.18  Aligned_cols=11  Identities=27%  Similarity=0.471  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        34 G~nGsGKSTLl   44 (241)
T cd03256          34 GPSGAGKSTLL   44 (241)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 264
>PRK04195 replication factor C large subunit; Provisional
Probab=30.66  E-value=16  Score=36.60  Aligned_cols=12  Identities=33%  Similarity=0.260  Sum_probs=11.2

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||+..
T Consensus        45 ~GppG~GKTtla   56 (482)
T PRK04195         45 YGPPGVGKTSLA   56 (482)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999887


No 265
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=30.59  E-value=17  Score=36.08  Aligned_cols=12  Identities=50%  Similarity=0.542  Sum_probs=10.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+||+|||+..
T Consensus       114 ~Gp~GtGKT~lA  125 (412)
T PRK05342        114 IGPTGSGKTLLA  125 (412)
T ss_pred             EcCCCCCHHHHH
Confidence            599999999866


No 266
>PRK13342 recombination factor protein RarA; Reviewed
Probab=30.51  E-value=16  Score=35.75  Aligned_cols=12  Identities=33%  Similarity=0.307  Sum_probs=11.1

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||+..
T Consensus        42 ~GppGtGKTtLA   53 (413)
T PRK13342         42 WGPPGTGKTTLA   53 (413)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999887


No 267
>PRK08118 topology modulation protein; Reviewed
Probab=30.49  E-value=18  Score=30.81  Aligned_cols=11  Identities=36%  Similarity=0.332  Sum_probs=9.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |..|||||+-.
T Consensus         8 G~~GsGKSTla   18 (167)
T PRK08118          8 GSGGSGKSTLA   18 (167)
T ss_pred             CCCCCCHHHHH
Confidence            89999999543


No 268
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=30.35  E-value=16  Score=38.80  Aligned_cols=13  Identities=31%  Similarity=0.215  Sum_probs=11.6

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||++|+|||++..
T Consensus        58 ~GPpGtGKTTLA~   70 (725)
T PRK13341         58 YGPPGVGKTTLAR   70 (725)
T ss_pred             ECCCCCCHHHHHH
Confidence            7999999998873


No 269
>PRK13891 conjugal transfer protein TrbE; Provisional
Probab=30.29  E-value=17  Score=39.21  Aligned_cols=12  Identities=33%  Similarity=0.531  Sum_probs=11.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|+||||||+.|
T Consensus       494 ~G~tGsGKS~l~  505 (852)
T PRK13891        494 FGPTGAGKSTHL  505 (852)
T ss_pred             ECCCCCCHHHHH
Confidence            399999999999


No 270
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=30.27  E-value=17  Score=31.52  Aligned_cols=11  Identities=45%  Similarity=0.516  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        32 G~nGsGKSTLl   42 (211)
T cd03264          32 GPNGAGKTTLM   42 (211)
T ss_pred             CCCCCCHHHHH
Confidence            89999999987


No 271
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=30.19  E-value=17  Score=36.65  Aligned_cols=12  Identities=33%  Similarity=0.468  Sum_probs=11.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||.+|+||||..
T Consensus       200 ~GppGtGKT~lA  211 (459)
T PRK11331        200 QGPPGVGKTFVA  211 (459)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999877


No 272
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=29.94  E-value=18  Score=31.73  Aligned_cols=11  Identities=45%  Similarity=0.576  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        33 G~nGsGKSTLl   43 (220)
T cd03265          33 GPNGAGKTTTI   43 (220)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 273
>CHL00195 ycf46 Ycf46; Provisional
Probab=29.87  E-value=17  Score=36.86  Aligned_cols=41  Identities=12%  Similarity=0.222  Sum_probs=24.1

Q ss_pred             CCCCcccccccccc---ccC--------CCCCCCCcChHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTMGT---GFE--------TDVSEEMLGIIPRAITHLFEGIQN   41 (286)
Q Consensus         1 YGqTGSGKTyTm~G---~~~--------~~~~~~~~GIiPRal~~LF~~~~~   41 (286)
                      ||+.|+|||.+.--   ...        ...-..-.|--.+.+..+|+..+.
T Consensus       265 ~GPpGTGKTllAkaiA~e~~~~~~~l~~~~l~~~~vGese~~l~~~f~~A~~  316 (489)
T CHL00195        265 VGIQGTGKSLTAKAIANDWQLPLLRLDVGKLFGGIVGESESRMRQMIRIAEA  316 (489)
T ss_pred             ECCCCCcHHHHHHHHHHHhCCCEEEEEhHHhcccccChHHHHHHHHHHHHHh
Confidence            89999999987611   000        000112345556778888877654


No 274
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=29.81  E-value=18  Score=30.75  Aligned_cols=11  Identities=36%  Similarity=0.504  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-|
T Consensus        33 G~nGsGKSTLl   43 (178)
T cd03229          33 GPSGSGKSTLL   43 (178)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 275
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional
Probab=29.76  E-value=18  Score=35.63  Aligned_cols=11  Identities=55%  Similarity=0.724  Sum_probs=9.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      ++||||||.+.
T Consensus        48 a~TGsGKT~a~   58 (460)
T PRK11776         48 AKTGSGKTAAF   58 (460)
T ss_pred             CCCCCcHHHHH
Confidence            68999999763


No 276
>PRK13537 nodulation ABC transporter NodI; Provisional
Probab=29.76  E-value=18  Score=33.94  Aligned_cols=12  Identities=42%  Similarity=0.614  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|+.|+|||.+|
T Consensus        39 lGpNGaGKSTLl   50 (306)
T PRK13537         39 LGPNGAGKTTTL   50 (306)
T ss_pred             ECCCCCCHHHHH
Confidence            389999999988


No 277
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=29.67  E-value=20  Score=38.58  Aligned_cols=11  Identities=55%  Similarity=0.552  Sum_probs=9.8

Q ss_pred             CCccccccccc
Q psy15014          3 QTGSGKTYTMG   13 (286)
Q Consensus         3 qTGSGKTyTm~   13 (286)
                      .||+|||||-+
T Consensus       193 ATGTGKTrTAi  203 (875)
T COG4096         193 ATGTGKTRTAI  203 (875)
T ss_pred             ecCCCcceeHH
Confidence            59999999986


No 278
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=29.56  E-value=18  Score=31.89  Aligned_cols=11  Identities=45%  Similarity=0.395  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||||||.+.
T Consensus         7 G~tGsGKSs~~   17 (212)
T PF04548_consen    7 GKTGSGKSSLG   17 (212)
T ss_dssp             CSTTSSHHHHH
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 279
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=29.48  E-value=17  Score=32.78  Aligned_cols=12  Identities=42%  Similarity=0.559  Sum_probs=10.7

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|||||..|
T Consensus        28 ~G~NGsGKStll   39 (247)
T cd03275          28 IGPNGSGKSNLM   39 (247)
T ss_pred             ECCCCCCHHHHH
Confidence            599999999887


No 280
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=29.48  E-value=19  Score=32.51  Aligned_cols=12  Identities=33%  Similarity=0.412  Sum_probs=10.7

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..+
T Consensus        31 vG~NGsGKStll   42 (251)
T cd03273          31 TGLNGSGKSNIL   42 (251)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999887


No 281
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=29.39  E-value=20  Score=30.13  Aligned_cols=11  Identities=36%  Similarity=0.286  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |..|||||+..
T Consensus        10 G~~GsGKsTl~   20 (188)
T TIGR01360        10 GGPGSGKGTQC   20 (188)
T ss_pred             CCCCCCHHHHH
Confidence            89999999976


No 282
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=29.28  E-value=17  Score=33.24  Aligned_cols=12  Identities=33%  Similarity=0.504  Sum_probs=10.7

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|||||.-+
T Consensus        36 ~G~nGsGKSTL~   47 (235)
T COG1122          36 IGPNGSGKSTLL   47 (235)
T ss_pred             ECCCCCCHHHHH
Confidence            599999999877


No 283
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=29.25  E-value=18  Score=38.15  Aligned_cols=12  Identities=33%  Similarity=0.382  Sum_probs=10.9

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||+.+
T Consensus       218 ~GppGtGKT~la  229 (733)
T TIGR01243       218 YGPPGTGKTLLA  229 (733)
T ss_pred             ECCCCCChHHHH
Confidence            799999999876


No 284
>PRK04040 adenylate kinase; Provisional
Probab=29.16  E-value=17  Score=31.76  Aligned_cols=12  Identities=33%  Similarity=0.346  Sum_probs=10.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|..|||||+..
T Consensus         8 ~G~pG~GKtt~~   19 (188)
T PRK04040          8 TGVPGVGKTTVL   19 (188)
T ss_pred             EeCCCCCHHHHH
Confidence            599999999876


No 285
>PRK04296 thymidine kinase; Provisional
Probab=29.14  E-value=15  Score=32.01  Aligned_cols=14  Identities=21%  Similarity=0.119  Sum_probs=11.4

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      ||..|+|||..+.+
T Consensus         8 tG~~GsGKTT~~l~   21 (190)
T PRK04296          8 YGAMNSGKSTELLQ   21 (190)
T ss_pred             ECCCCCHHHHHHHH
Confidence            69999999977653


No 286
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.
Probab=29.11  E-value=19  Score=34.64  Aligned_cols=12  Identities=50%  Similarity=0.506  Sum_probs=10.5

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.||||||.+|.
T Consensus       185 G~tGsGKTTll~  196 (340)
T TIGR03819       185 GGTGSGKTTLLS  196 (340)
T ss_pred             CCCCCCHHHHHH
Confidence            899999998773


No 287
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=29.08  E-value=19  Score=33.61  Aligned_cols=11  Identities=45%  Similarity=0.601  Sum_probs=10.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+.|+|||.+|
T Consensus        35 G~NGaGKTTLl   45 (301)
T TIGR03522        35 GPNGAGKSTTM   45 (301)
T ss_pred             CCCCCCHHHHH
Confidence            89999999998


No 288
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional
Probab=29.05  E-value=19  Score=38.80  Aligned_cols=11  Identities=36%  Similarity=0.434  Sum_probs=10.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||||||++|
T Consensus       456 G~sGsGKS~l~  466 (844)
T PRK13721        456 GTSGAGKTGLI  466 (844)
T ss_pred             cCCCCCHHHHH
Confidence            89999999999


No 289
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=29.05  E-value=19  Score=31.75  Aligned_cols=34  Identities=12%  Similarity=-0.004  Sum_probs=21.2

Q ss_pred             EEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCC
Q psy15014        203 IYVTGATSKSIRSAQEAMNALRQGALSRTTASTQ  236 (286)
Q Consensus       203 v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~  236 (286)
                      +.+.+-..+...+.+++.+++..-..+|.+-.|.
T Consensus       174 ~~l~~G~i~~~~~~~~~~~~~~~~~~~~~~~~~~  207 (213)
T PRK15177        174 GVLLHGKITMCEDLAQATALFEQYQSNQATIQTE  207 (213)
T ss_pred             EEEECCeEEEeCCHHHHHHHHHHHHHhhhhhccc
Confidence            4444445556677777777777777777655543


No 290
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=29.04  E-value=19  Score=31.23  Aligned_cols=11  Identities=36%  Similarity=0.504  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        33 G~nGsGKSTLl   43 (213)
T cd03262          33 GPSGSGKSTLL   43 (213)
T ss_pred             CCCCCCHHHHH
Confidence            89999999776


No 291
>PRK10246 exonuclease subunit SbcC; Provisional
Probab=29.03  E-value=33  Score=37.99  Aligned_cols=12  Identities=42%  Similarity=0.470  Sum_probs=10.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.||||||..+
T Consensus        36 ~G~tGaGKStil   47 (1047)
T PRK10246         36 TGPTGAGKTTLL   47 (1047)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999865


No 292
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=28.99  E-value=18  Score=31.46  Aligned_cols=11  Identities=36%  Similarity=0.504  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        32 G~nGsGKSTLl   42 (177)
T cd03222          32 GPNGTGKTTAV   42 (177)
T ss_pred             CCCCChHHHHH
Confidence            89999999877


No 293
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=28.97  E-value=19  Score=31.92  Aligned_cols=11  Identities=36%  Similarity=0.516  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        42 G~nGsGKSTLl   52 (233)
T PRK11629         42 GSSGSGKSTLL   52 (233)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 294
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=28.90  E-value=19  Score=33.56  Aligned_cols=11  Identities=27%  Similarity=0.356  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        37 G~NGaGKSTLl   47 (303)
T TIGR01288        37 GPNGAGKSTIA   47 (303)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 295
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=28.86  E-value=18  Score=35.92  Aligned_cols=12  Identities=50%  Similarity=0.542  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+||+|||+..
T Consensus       122 ~GP~GsGKT~lA  133 (413)
T TIGR00382       122 IGPTGSGKTLLA  133 (413)
T ss_pred             ECCCCcCHHHHH
Confidence            599999999877


No 296
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=28.80  E-value=19  Score=31.87  Aligned_cols=11  Identities=36%  Similarity=0.504  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        33 G~nGsGKSTLl   43 (235)
T cd03261          33 GPSGSGKSTLL   43 (235)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 297
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=28.76  E-value=19  Score=31.25  Aligned_cols=11  Identities=36%  Similarity=0.471  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        34 G~nGsGKSTLl   44 (204)
T PRK13538         34 GPNGAGKTSLL   44 (204)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 298
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=28.71  E-value=19  Score=31.29  Aligned_cols=11  Identities=36%  Similarity=0.471  Sum_probs=9.8

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        33 G~nGsGKSTLl   43 (213)
T cd03259          33 GPSGCGKTTLL   43 (213)
T ss_pred             CCCCCCHHHHH
Confidence            89999999766


No 299
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=28.61  E-value=20  Score=34.73  Aligned_cols=11  Identities=45%  Similarity=0.474  Sum_probs=10.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |..|+|||.|+
T Consensus       146 GVNG~GKTTTI  156 (340)
T COG0552         146 GVNGVGKTTTI  156 (340)
T ss_pred             ecCCCchHhHH
Confidence            78999999999


No 300
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=28.50  E-value=21  Score=35.21  Aligned_cols=39  Identities=23%  Similarity=0.300  Sum_probs=25.0

Q ss_pred             CCCCcccccccc--------------ccccCCCCCCCCcChHHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTM--------------GTGFETDVSEEMLGIIPRAITHLFEGIQNI   42 (286)
Q Consensus         1 YGqTGSGKTyTm--------------~G~~~~~~~~~~~GIiPRal~~LF~~~~~~   42 (286)
                      ||+.|+|||---              .|.   +.-.---|==+|.+++||....+.
T Consensus       191 YGPPGTGKTLLAkAVA~~T~AtFIrvvgS---ElVqKYiGEGaRlVRelF~lArek  243 (406)
T COG1222         191 YGPPGTGKTLLAKAVANQTDATFIRVVGS---ELVQKYIGEGARLVRELFELAREK  243 (406)
T ss_pred             eCCCCCcHHHHHHHHHhccCceEEEeccH---HHHHHHhccchHHHHHHHHHHhhc
Confidence            999999998543              110   000011233389999999998876


No 301
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=28.49  E-value=20  Score=31.58  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        33 G~nGsGKSTLl   43 (227)
T cd03260          33 GPSGCGKSTLL   43 (227)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 302
>PRK06696 uridine kinase; Validated
Probab=28.40  E-value=21  Score=31.68  Aligned_cols=11  Identities=45%  Similarity=0.196  Sum_probs=9.7

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+..
T Consensus        29 G~sgsGKSTlA   39 (223)
T PRK06696         29 GITASGKTTFA   39 (223)
T ss_pred             CCCCCCHHHHH
Confidence            89999999865


No 303
>TIGR00073 hypB hydrogenase accessory protein HypB. HypB is implicated in insertion of nickel into the large subunit of NiFe hydrogenases.
Probab=28.35  E-value=20  Score=31.40  Aligned_cols=11  Identities=45%  Similarity=0.564  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |..|||||..+
T Consensus        29 G~~gsGKTTli   39 (207)
T TIGR00073        29 SSPGSGKTTLI   39 (207)
T ss_pred             CCCCCCHHHHH
Confidence            88999999977


No 304
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=28.26  E-value=20  Score=31.34  Aligned_cols=11  Identities=36%  Similarity=0.510  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        37 G~nGsGKSTLl   47 (220)
T cd03245          37 GRVGSGKSTLL   47 (220)
T ss_pred             CCCCCCHHHHH
Confidence            89999999988


No 305
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional
Probab=28.22  E-value=20  Score=33.81  Aligned_cols=12  Identities=25%  Similarity=0.440  Sum_probs=10.8

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||..+.
T Consensus        13 G~~GsGKtt~~~   24 (288)
T PRK05416         13 GLSGAGKSVALR   24 (288)
T ss_pred             CCCCCcHHHHHH
Confidence            899999999983


No 306
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=28.06  E-value=21  Score=31.45  Aligned_cols=12  Identities=42%  Similarity=0.387  Sum_probs=10.7

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||.+|||||.-+
T Consensus        25 ~G~~GsGKT~l~   36 (235)
T cd01123          25 FGEFGSGKTQLC   36 (235)
T ss_pred             ECCCCCCHHHHH
Confidence            699999999876


No 307
>PHA02653 RNA helicase NPH-II; Provisional
Probab=28.04  E-value=24  Score=37.32  Aligned_cols=11  Identities=45%  Similarity=0.380  Sum_probs=9.4

Q ss_pred             CCCCccccccc
Q psy15014          1 MLQTGSGKTYT   11 (286)
Q Consensus         1 YGqTGSGKTyT   11 (286)
                      .|+||||||.-
T Consensus       185 ~A~TGSGKTtq  195 (675)
T PHA02653        185 TGGTGVGKTSQ  195 (675)
T ss_pred             ECCCCCCchhH
Confidence            38999999975


No 308
>PRK07667 uridine kinase; Provisional
Probab=27.94  E-value=21  Score=30.98  Aligned_cols=11  Identities=36%  Similarity=0.199  Sum_probs=9.7

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+..
T Consensus        24 G~~gsGKStla   34 (193)
T PRK07667         24 GLSRSGKTTFV   34 (193)
T ss_pred             CCCCCCHHHHH
Confidence            89999999865


No 309
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=27.88  E-value=20  Score=31.04  Aligned_cols=11  Identities=27%  Similarity=0.471  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-|
T Consensus        34 G~nGsGKSTLl   44 (214)
T cd03292          34 GPSGAGKSTLL   44 (214)
T ss_pred             CCCCCCHHHHH
Confidence            89999999776


No 310
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=27.87  E-value=20  Score=31.06  Aligned_cols=11  Identities=45%  Similarity=0.576  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-|
T Consensus        33 G~nGsGKSTLl   43 (210)
T cd03269          33 GPNGAGKTTTI   43 (210)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 311
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=27.83  E-value=20  Score=31.14  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        32 G~nGsGKSTLl   42 (213)
T cd03235          32 GPNGAGKSTLL   42 (213)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 312
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=27.75  E-value=21  Score=31.20  Aligned_cols=11  Identities=27%  Similarity=0.471  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-+
T Consensus        30 G~nGsGKSTLl   40 (214)
T cd03297          30 GASGAGKSTLL   40 (214)
T ss_pred             CCCCCCHHHHH
Confidence            89999999776


No 313
>PRK06762 hypothetical protein; Provisional
Probab=27.72  E-value=22  Score=29.61  Aligned_cols=11  Identities=45%  Similarity=0.447  Sum_probs=9.1

Q ss_pred             CCCCccccccc
Q psy15014          1 MLQTGSGKTYT   11 (286)
Q Consensus         1 YGqTGSGKTyT   11 (286)
                      .|..|||||+-
T Consensus         8 ~G~~GsGKST~   18 (166)
T PRK06762          8 RGNSGSGKTTI   18 (166)
T ss_pred             ECCCCCCHHHH
Confidence            38999999973


No 314
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=27.68  E-value=21  Score=31.22  Aligned_cols=11  Identities=45%  Similarity=0.628  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        35 G~nGsGKSTLl   45 (220)
T cd03263          35 GHNGAGKTTTL   45 (220)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 315
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=27.66  E-value=21  Score=34.45  Aligned_cols=12  Identities=33%  Similarity=0.509  Sum_probs=10.9

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..|
T Consensus        36 ~GpsGsGKSTLL   47 (353)
T TIGR03265        36 LGPSGCGKTTLL   47 (353)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999988


No 316
>PF00063 Myosin_head:  Myosin head (motor domain);  InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril. Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....
Probab=27.64  E-value=18  Score=37.84  Aligned_cols=11  Identities=55%  Similarity=0.555  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.|+
T Consensus        92 GeSGsGKTe~~  102 (689)
T PF00063_consen   92 GESGSGKTETS  102 (689)
T ss_dssp             ESTTSSHHHHH
T ss_pred             cccccccccch
Confidence            89999999996


No 317
>PRK13536 nodulation factor exporter subunit NodI; Provisional
Probab=27.50  E-value=21  Score=34.22  Aligned_cols=11  Identities=27%  Similarity=0.356  Sum_probs=10.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+.|+|||.+|
T Consensus        74 GpNGaGKSTLl   84 (340)
T PRK13536         74 GPNGAGKSTIA   84 (340)
T ss_pred             CCCCCCHHHHH
Confidence            89999999988


No 318
>PRK13853 type IV secretion system protein VirB4; Provisional
Probab=27.44  E-value=19  Score=38.47  Aligned_cols=12  Identities=42%  Similarity=0.451  Sum_probs=11.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+||||||..|
T Consensus       432 ~G~tGsGKS~l~  443 (789)
T PRK13853        432 FGPIGRGKTTLM  443 (789)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999998


No 319
>TIGR00602 rad24 checkpoint protein rad24. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.41  E-value=20  Score=37.64  Aligned_cols=12  Identities=33%  Similarity=0.484  Sum_probs=11.3

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||.++
T Consensus       116 ~GP~GsGKTTl~  127 (637)
T TIGR00602       116 TGPSGCGKSTTI  127 (637)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999988


No 320
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=27.40  E-value=22  Score=34.12  Aligned_cols=12  Identities=42%  Similarity=0.526  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||.+|||||..+
T Consensus        30 FG~SGsGKTsli   41 (352)
T COG4148          30 FGPSGSGKTSLI   41 (352)
T ss_pred             ecCCCCChhhHH
Confidence            699999999876


No 321
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=27.38  E-value=21  Score=30.38  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        32 G~nGsGKStLl   42 (180)
T cd03214          32 GPNGAGKSTLL   42 (180)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 322
>PF03969 AFG1_ATPase:  AFG1-like ATPase;  InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP. AFG1 also has substantial homology to these proteins outside the ATPase domain []. This family of proteins contains a P-loop motif.; GO: 0005524 ATP binding
Probab=27.36  E-value=22  Score=34.65  Aligned_cols=43  Identities=12%  Similarity=0.164  Sum_probs=22.6

Q ss_pred             CCCCccccccccccccCC-CCCCCCcChHHHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTMGTGFET-DVSEEMLGIIPRAITHLFEGIQNIA   43 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~-~~~~~~~GIiPRal~~LF~~~~~~~   43 (286)
                      ||.-|.|||+-|--=++. +.....+-=.-..+.++++.+....
T Consensus        68 ~G~vG~GKT~Lmd~f~~~lp~~~k~R~HFh~Fm~~vh~~l~~~~  111 (362)
T PF03969_consen   68 WGPVGRGKTMLMDLFYDSLPIKRKRRVHFHEFMLDVHSRLHQLR  111 (362)
T ss_pred             ECCCCCchhHHHHHHHHhCCccccccccccHHHHHHHHHHHHHh
Confidence            799999999999211100 0001111112345666776666644


No 323
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=27.33  E-value=21  Score=30.74  Aligned_cols=11  Identities=36%  Similarity=0.353  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+.+
T Consensus        10 G~sGsGKSTl~   20 (176)
T PRK09825         10 GVSGSGKSLIG   20 (176)
T ss_pred             CCCCCCHHHHH
Confidence            89999999976


No 324
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=27.29  E-value=21  Score=31.74  Aligned_cols=11  Identities=45%  Similarity=0.534  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        35 G~nGsGKSTLl   45 (239)
T cd03296          35 GPSGSGKTTLL   45 (239)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 325
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=27.27  E-value=21  Score=31.67  Aligned_cols=11  Identities=27%  Similarity=0.404  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-|
T Consensus        34 G~nGsGKSTLl   44 (236)
T TIGR03864        34 GPNGAGKSTLF   44 (236)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 326
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=27.20  E-value=21  Score=30.08  Aligned_cols=12  Identities=33%  Similarity=0.340  Sum_probs=10.1

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|..|||||+.-
T Consensus         5 ~G~pGsGKst~a   16 (183)
T TIGR01359         5 LGGPGSGKGTQC   16 (183)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999864


No 327
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=27.19  E-value=21  Score=31.96  Aligned_cols=11  Identities=27%  Similarity=0.413  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        39 G~nGsGKSTLl   49 (253)
T PRK14242         39 GPSGCGKSTFL   49 (253)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 328
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.
Probab=27.12  E-value=22  Score=31.25  Aligned_cols=11  Identities=45%  Similarity=0.232  Sum_probs=9.7

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+..
T Consensus         6 G~sgsGKTtla   16 (187)
T cd02024           6 GVTNSGKTTLA   16 (187)
T ss_pred             CCCCCCHHHHH
Confidence            88999999876


No 329
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=27.06  E-value=22  Score=31.34  Aligned_cols=11  Identities=36%  Similarity=0.561  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        43 G~nGsGKSTLl   53 (228)
T PRK10584         43 GESGSGKSTLL   53 (228)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 330
>PF13166 AAA_13:  AAA domain
Probab=27.04  E-value=22  Score=36.97  Aligned_cols=10  Identities=40%  Similarity=0.521  Sum_probs=9.2

Q ss_pred             CCCCcccccc
Q psy15014          1 MLQTGSGKTY   10 (286)
Q Consensus         1 YGqTGSGKTy   10 (286)
                      ||..|||||.
T Consensus        22 YG~NGsGKSt   31 (712)
T PF13166_consen   22 YGRNGSGKST   31 (712)
T ss_pred             ECCCCCCHHH
Confidence            9999999994


No 331
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=27.04  E-value=22  Score=29.40  Aligned_cols=11  Identities=27%  Similarity=0.492  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|+|||..|
T Consensus        33 G~nGsGKStLl   43 (144)
T cd03221          33 GRNGAGKSTLL   43 (144)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 332
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=27.01  E-value=22  Score=30.93  Aligned_cols=11  Identities=45%  Similarity=0.585  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-|
T Consensus        33 G~nGsGKSTLl   43 (213)
T cd03301          33 GPSGCGKTTTL   43 (213)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 333
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=26.90  E-value=22  Score=31.03  Aligned_cols=11  Identities=45%  Similarity=0.504  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        35 G~nGsGKSTLl   45 (207)
T PRK13539         35 GPNGSGKTTLL   45 (207)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 334
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=26.87  E-value=22  Score=31.34  Aligned_cols=12  Identities=42%  Similarity=0.581  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|||||.-|
T Consensus        32 ~G~nGsGKSTLl   43 (232)
T cd03218          32 LGPNGAGKTTTF   43 (232)
T ss_pred             ECCCCCCHHHHH
Confidence            389999999887


No 335
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=26.80  E-value=22  Score=27.11  Aligned_cols=12  Identities=33%  Similarity=0.476  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|..|+|||..+
T Consensus         2 iG~~~~GKStl~   13 (157)
T cd00882           2 VGDSGVGKTSLL   13 (157)
T ss_pred             CCcCCCcHHHHH
Confidence            389999999877


No 336
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=26.74  E-value=40  Score=31.21  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=8.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|+||+.-+
T Consensus        40 GPSGcGKST~L   50 (253)
T COG1117          40 GPSGCGKSTLL   50 (253)
T ss_pred             CCCCcCHHHHH
Confidence            78888887544


No 337
>TIGR02688 conserved hypothetical protein TIGR02688. Members of this family are uncharacterized proteins sporadically distributed in bacteria and archaea, about 470 amino acids in length. Several members of this family appear in public databases with annotation as ATP-dependent protease La, despite the lack of similarity to families TIGR00763 (ATP-dependent protease La) or pfam02190 (ATP-dependent protease La (LON) domain). This protein is repeatedly found downstream of another uncharacterized protein of about 880 amino acids in length, described by model TIGR02687.
Probab=26.65  E-value=23  Score=35.66  Aligned_cols=14  Identities=29%  Similarity=0.610  Sum_probs=11.5

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      .|++|+||||.-.+
T Consensus       215 lGp~GTGKThla~~  228 (449)
T TIGR02688       215 LGPKGTGKSYIYNN  228 (449)
T ss_pred             ECCCCCCHHHHHHH
Confidence            49999999987743


No 338
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=26.55  E-value=22  Score=32.83  Aligned_cols=11  Identities=55%  Similarity=0.613  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        40 G~nGsGKSTLl   50 (286)
T PRK13646         40 GQTGSGKSTLI   50 (286)
T ss_pred             CCCCCCHHHHH
Confidence            89999999988


No 339
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=26.52  E-value=22  Score=31.37  Aligned_cols=12  Identities=33%  Similarity=0.468  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|||||..|
T Consensus        32 ~G~nGsGKSTLl   43 (236)
T cd03219          32 IGPNGAGKTTLF   43 (236)
T ss_pred             ECCCCCCHHHHH
Confidence            389999999877


No 340
>PRK10875 recD exonuclease V subunit alpha; Provisional
Probab=26.51  E-value=21  Score=37.28  Aligned_cols=11  Identities=45%  Similarity=0.525  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |..|+|||+|+
T Consensus       174 GgpGTGKTt~v  184 (615)
T PRK10875        174 GGPGTGKTTTV  184 (615)
T ss_pred             eCCCCCHHHHH
Confidence            78999999997


No 341
>TIGR02858 spore_III_AA stage III sporulation protein AA. Members of this protein are the stage III sporulation protein AA, encoded by one of several genes in the spoIIIA locus. It seems that this protein is found in a species if and only if that species is capable of endospore formation.
Probab=26.47  E-value=20  Score=33.40  Aligned_cols=12  Identities=25%  Similarity=0.315  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|.+|||||..|
T Consensus       117 ~g~~g~GKttl~  128 (270)
T TIGR02858       117 ISPPQCGKTTLL  128 (270)
T ss_pred             EcCCCCCHHHHH
Confidence            489999999988


No 342
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).
Probab=26.35  E-value=22  Score=32.56  Aligned_cols=12  Identities=33%  Similarity=0.302  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|.+|+|||...
T Consensus        27 ~G~~GtGKT~lA   38 (262)
T TIGR02640        27 RGPAGTGKTTLA   38 (262)
T ss_pred             EcCCCCCHHHHH
Confidence            599999999876


No 343
>PLN02165 adenylate isopentenyltransferase
Probab=26.34  E-value=24  Score=34.12  Aligned_cols=11  Identities=45%  Similarity=0.410  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+||||||...
T Consensus        50 GPTGSGKStLA   60 (334)
T PLN02165         50 GATGSGKSRLS   60 (334)
T ss_pred             CCCCCcHHHHH
Confidence            99999999776


No 344
>PLN02796 D-glycerate 3-kinase
Probab=26.33  E-value=22  Score=34.54  Aligned_cols=11  Identities=36%  Similarity=0.486  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||+.+
T Consensus       107 G~sGSGKSTLa  117 (347)
T PLN02796        107 APQGCGKTTLV  117 (347)
T ss_pred             CCCCCcHHHHH
Confidence            88999999986


No 345
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional
Probab=26.21  E-value=22  Score=34.25  Aligned_cols=12  Identities=33%  Similarity=0.244  Sum_probs=10.9

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||.++
T Consensus        44 ~Gp~G~GKTtla   55 (363)
T PRK14961         44 SGTRGVGKTTIA   55 (363)
T ss_pred             ecCCCCCHHHHH
Confidence            799999999876


No 346
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=26.20  E-value=23  Score=30.98  Aligned_cols=11  Identities=36%  Similarity=0.516  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-|
T Consensus        38 G~nGsGKSTLl   48 (221)
T TIGR02211        38 GSSGSGKSTLL   48 (221)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 347
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=26.20  E-value=23  Score=31.02  Aligned_cols=11  Identities=36%  Similarity=0.456  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-|
T Consensus        38 G~nGsGKSTLl   48 (228)
T cd03257          38 GESGSGKSTLA   48 (228)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 348
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=26.15  E-value=23  Score=31.21  Aligned_cols=12  Identities=33%  Similarity=0.498  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..|
T Consensus        32 ~G~nGsGKSTLl   43 (230)
T TIGR03410        32 LGRNGVGKTTLL   43 (230)
T ss_pred             ECCCCCCHHHHH
Confidence            389999999877


No 349
>PHA02244 ATPase-like protein
Probab=26.14  E-value=22  Score=34.98  Aligned_cols=12  Identities=33%  Similarity=0.263  Sum_probs=10.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+||+|||+-.
T Consensus       125 ~GppGtGKTtLA  136 (383)
T PHA02244        125 KGGAGSGKNHIA  136 (383)
T ss_pred             ECCCCCCHHHHH
Confidence            599999999876


No 350
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=26.09  E-value=24  Score=32.55  Aligned_cols=11  Identities=36%  Similarity=0.504  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-+
T Consensus        35 GpSGSGKSTlL   45 (240)
T COG1126          35 GPSGSGKSTLL   45 (240)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 351
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=26.06  E-value=28  Score=32.86  Aligned_cols=11  Identities=45%  Similarity=0.549  Sum_probs=10.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+.|.|||.|.
T Consensus        35 G~NGAGKTTtf   45 (300)
T COG4152          35 GPNGAGKTTTF   45 (300)
T ss_pred             cCCCCCccchH
Confidence            89999999997


No 352
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=26.04  E-value=24  Score=38.27  Aligned_cols=12  Identities=25%  Similarity=0.468  Sum_probs=10.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|+||||||.-|
T Consensus        31 ~G~nGsGKSSIl   42 (908)
T COG0419          31 VGPNGAGKSSIL   42 (908)
T ss_pred             ECCCCCcHHHHH
Confidence            499999998655


No 353
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=26.04  E-value=20  Score=27.86  Aligned_cols=12  Identities=17%  Similarity=0.271  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|+|||.-+
T Consensus         5 iG~~~~GKSTli   16 (116)
T PF01926_consen    5 IGRPNVGKSTLI   16 (116)
T ss_dssp             EESTTSSHHHHH
T ss_pred             ECCCCCCHHHHH
Confidence            389999999877


No 354
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=25.95  E-value=23  Score=31.66  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        34 G~nGsGKSTLl   44 (247)
T TIGR00972        34 GPSGCGKSTLL   44 (247)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 355
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=25.91  E-value=23  Score=28.25  Aligned_cols=11  Identities=18%  Similarity=0.262  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|+|||..+
T Consensus         6 G~~g~GKTtL~   16 (170)
T cd01876           6 GRSNVGKSSLI   16 (170)
T ss_pred             cCCCCCHHHHH
Confidence            89999999877


No 356
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=25.90  E-value=25  Score=36.96  Aligned_cols=11  Identities=45%  Similarity=0.546  Sum_probs=10.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.|+
T Consensus        93 GESGsGKTet~  103 (653)
T cd01379          93 GESGSGKTESA  103 (653)
T ss_pred             cCCCCCchHHH
Confidence            89999999998


No 357
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=25.83  E-value=23  Score=34.11  Aligned_cols=11  Identities=36%  Similarity=0.510  Sum_probs=10.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        39 GpsGsGKSTLL   49 (351)
T PRK11432         39 GPSGCGKTTVL   49 (351)
T ss_pred             CCCCCcHHHHH
Confidence            89999999998


No 358
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit. This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. A related family in the Gram-positive bacteria separates in a phylogenetic tree, has an additional N-terminal extension of about 200 residues, and is not supported as a member of a RecBCD complex by neighboring genes. The related family is consequently described by a different model.
Probab=25.81  E-value=23  Score=36.77  Aligned_cols=11  Identities=45%  Similarity=0.525  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |-.|||||||+
T Consensus       167 GgpGTGKTt~v  177 (586)
T TIGR01447       167 GGPGTGKTTTV  177 (586)
T ss_pred             cCCCCCHHHHH
Confidence            78899999997


No 359
>TIGR01425 SRP54_euk signal recognition particle protein SRP54. This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model.
Probab=25.72  E-value=23  Score=35.34  Aligned_cols=11  Identities=55%  Similarity=0.449  Sum_probs=10.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|+|||.|.
T Consensus       107 G~~GvGKTTta  117 (429)
T TIGR01425       107 GLQGSGKTTTC  117 (429)
T ss_pred             CCCCCCHHHHH
Confidence            89999999998


No 360
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=25.72  E-value=23  Score=30.84  Aligned_cols=11  Identities=36%  Similarity=0.522  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-|
T Consensus        33 G~nGsGKSTLl   43 (222)
T cd03224          33 GRNGAGKTTLL   43 (222)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 361
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=25.58  E-value=26  Score=26.90  Aligned_cols=11  Identities=36%  Similarity=0.462  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |..|+|||.-+
T Consensus         6 G~~g~GKTsLi   16 (119)
T PF08477_consen    6 GDSGVGKTSLI   16 (119)
T ss_dssp             CSTTSSHHHHH
T ss_pred             CcCCCCHHHHH
Confidence            89999999877


No 362
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=25.47  E-value=24  Score=32.57  Aligned_cols=11  Identities=45%  Similarity=0.552  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        44 G~nGsGKSTLl   54 (289)
T PRK13645         44 GTTGSGKSTMI   54 (289)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 363
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=25.46  E-value=24  Score=34.08  Aligned_cols=12  Identities=25%  Similarity=0.448  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..+
T Consensus        36 lG~sGsGKSTLL   47 (356)
T PRK11650         36 VGPSGCGKSTLL   47 (356)
T ss_pred             ECCCCCcHHHHH
Confidence            389999999988


No 364
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=25.32  E-value=25  Score=31.19  Aligned_cols=11  Identities=36%  Similarity=0.347  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-|
T Consensus        33 G~nGsGKSTLl   43 (243)
T TIGR01978        33 GPNGSGKSTLS   43 (243)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 365
>PRK10867 signal recognition particle protein; Provisional
Probab=25.30  E-value=24  Score=35.22  Aligned_cols=12  Identities=50%  Similarity=0.570  Sum_probs=10.8

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||.|..
T Consensus       107 G~~GsGKTTtaa  118 (433)
T PRK10867        107 GLQGAGKTTTAG  118 (433)
T ss_pred             CCCCCcHHHHHH
Confidence            899999999883


No 366
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=25.29  E-value=25  Score=32.40  Aligned_cols=12  Identities=33%  Similarity=0.529  Sum_probs=10.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||-.|
T Consensus        27 ~G~nGsGKS~il   38 (276)
T cd03241          27 TGETGAGKSILL   38 (276)
T ss_pred             EcCCCCCHHHHH
Confidence            499999999877


No 367
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=25.29  E-value=25  Score=30.68  Aligned_cols=12  Identities=33%  Similarity=0.362  Sum_probs=10.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|.+|||||...
T Consensus        25 ~G~~GsGKT~l~   36 (218)
T cd01394          25 YGPPGTGKTNIA   36 (218)
T ss_pred             ECCCCCCHHHHH
Confidence            699999999876


No 368
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=25.28  E-value=24  Score=34.37  Aligned_cols=12  Identities=25%  Similarity=0.481  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..|
T Consensus        51 lGpsGsGKSTLL   62 (377)
T PRK11607         51 LGASGCGKSTLL   62 (377)
T ss_pred             ECCCCCcHHHHH
Confidence            389999999997


No 369
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=25.25  E-value=24  Score=31.27  Aligned_cols=11  Identities=27%  Similarity=0.471  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-|
T Consensus        35 G~nGsGKSTLl   45 (243)
T TIGR02315        35 GPSGAGKSTLL   45 (243)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 370
>KOG0745|consensus
Probab=25.25  E-value=27  Score=35.37  Aligned_cols=25  Identities=28%  Similarity=0.359  Sum_probs=16.8

Q ss_pred             EEcCCHHHHHHHHHHHHhcCCcccC
Q psy15014        211 KSIRSAQEAMNALRQGALSRTTAST  235 (286)
Q Consensus       211 ~~V~S~eea~~lL~~G~~~R~~~sT  235 (286)
                      |.+.=-++|++.+.+-.-.|.+++-
T Consensus       471 V~L~fTe~Al~~IAq~Al~r~TGAR  495 (564)
T KOG0745|consen  471 VELHFTEKALEAIAQLALKRKTGAR  495 (564)
T ss_pred             eeEEecHHHHHHHHHHHHhhccchH
Confidence            4444457788888777777777654


No 371
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=25.16  E-value=24  Score=31.30  Aligned_cols=11  Identities=36%  Similarity=0.504  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        34 G~nGsGKSTLl   44 (240)
T PRK09493         34 GPSGSGKSTLL   44 (240)
T ss_pred             CCCCCCHHHHH
Confidence            89999999875


No 372
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair]
Probab=25.13  E-value=25  Score=39.28  Aligned_cols=10  Identities=40%  Similarity=0.979  Sum_probs=7.3

Q ss_pred             Cccccccccc
Q psy15014          4 TGSGKTYTMG   13 (286)
Q Consensus         4 TGSGKTyTm~   13 (286)
                      .||||||||.
T Consensus        25 AGSGKT~vL~   34 (1139)
T COG1074          25 AGTGKTFVLA   34 (1139)
T ss_pred             CCCCchhHHH
Confidence            4788888873


No 373
>CHL00176 ftsH cell division protein; Validated
Probab=25.11  E-value=23  Score=37.11  Aligned_cols=12  Identities=33%  Similarity=0.432  Sum_probs=11.2

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||+..
T Consensus       222 ~GPpGTGKT~LA  233 (638)
T CHL00176        222 VGPPGTGKTLLA  233 (638)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999987


No 374
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=25.09  E-value=25  Score=30.35  Aligned_cols=11  Identities=36%  Similarity=0.383  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        33 G~nGsGKSTLl   43 (198)
T TIGR01189        33 GPNGIGKTTLL   43 (198)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 375
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=25.07  E-value=25  Score=32.41  Aligned_cols=11  Identities=45%  Similarity=0.594  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        40 G~nGsGKSTLl   50 (279)
T PRK13650         40 GHNGSGKSTTV   50 (279)
T ss_pred             CCCCCCHHHHH
Confidence            89999999988


No 376
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=25.05  E-value=25  Score=31.32  Aligned_cols=11  Identities=27%  Similarity=0.471  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-|
T Consensus        35 G~nGsGKSTLl   45 (242)
T PRK11124         35 GPSGAGKSSLL   45 (242)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 377
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=24.99  E-value=25  Score=30.78  Aligned_cols=11  Identities=36%  Similarity=0.483  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        34 G~nGsGKSTLl   44 (218)
T cd03290          34 GQVGCGKSSLL   44 (218)
T ss_pred             CCCCCCHHHHH
Confidence            89999999888


No 378
>TIGR00959 ffh signal recognition particle protein. This model represents Ffh (Fifty-Four Homolog), the protein component that forms the bacterial (and organellar) signal recognition particle together with a 4.5S RNA. Ffh is a GTPase homologous to eukaryotic SRP54 and also to the GTPase FtsY (TIGR00064) that is the receptor for the signal recognition particle.
Probab=24.98  E-value=24  Score=35.13  Aligned_cols=12  Identities=58%  Similarity=0.595  Sum_probs=10.7

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||.|..
T Consensus       106 G~~GsGKTTtaa  117 (428)
T TIGR00959       106 GLQGSGKTTTCG  117 (428)
T ss_pred             CCCCCcHHHHHH
Confidence            899999999973


No 379
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=24.95  E-value=25  Score=30.31  Aligned_cols=11  Identities=27%  Similarity=0.410  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        33 G~nGsGKSTLl   43 (195)
T PRK13541         33 GANGCGKSSLL   43 (195)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 380
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=24.94  E-value=24  Score=28.62  Aligned_cols=12  Identities=33%  Similarity=0.310  Sum_probs=10.2

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|..|||||+--
T Consensus         5 ~G~~GsGKstla   16 (154)
T cd00464           5 IGMMGAGKTTVG   16 (154)
T ss_pred             EcCCCCCHHHHH
Confidence            489999999765


No 381
>smart00053 DYNc Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and  plasma membrane following an exocytic event.
Probab=24.77  E-value=2.1e+02  Score=26.24  Aligned_cols=53  Identities=19%  Similarity=0.159  Sum_probs=34.0

Q ss_pred             EEcCCHHHHHHHHHHHHhcCCcccCCCCCCCCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCc
Q psy15014        211 KSIRSAQEAMNALRQGALSRTTASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSA  281 (286)
Q Consensus       211 ~~V~S~eea~~lL~~G~~~R~~~sT~~N~~SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~  281 (286)
                      ..+.+++++.+.+...... ..++   +  ..-|.-++.|+|.....            -.|.||||.|=.
T Consensus        84 ~~~~~~~~v~~~i~~~~~~-~~~~---~--~~~s~~~i~l~i~~p~~------------~~ltLIDlPGl~  136 (240)
T smart00053       84 KKFTDFDEVRNEIEAETDR-VTGT---N--KGISPVPINLRVYSPHV------------LNLTLIDLPGIT  136 (240)
T ss_pred             cccCCHHHHHHHHHHHHHH-hcCC---C--CcccCcceEEEEeCCCC------------CceEEEeCCCcc
Confidence            4557899999998876543 1111   1  23456677777765332            258999999954


No 382
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=24.72  E-value=25  Score=31.88  Aligned_cols=11  Identities=36%  Similarity=0.471  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        34 G~nGsGKSTLl   44 (255)
T PRK11248         34 GPSGCGKTTLL   44 (255)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 383
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=24.67  E-value=25  Score=31.41  Aligned_cols=11  Identities=27%  Similarity=0.413  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        36 G~nGsGKSTLl   46 (250)
T PRK14240         36 GPSGCGKSTFL   46 (250)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 384
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=24.67  E-value=25  Score=30.49  Aligned_cols=11  Identities=36%  Similarity=0.504  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-+
T Consensus        31 G~nGsGKSTLl   41 (211)
T cd03298          31 GPSGSGKSTLL   41 (211)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 385
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=24.61  E-value=25  Score=29.72  Aligned_cols=12  Identities=33%  Similarity=0.368  Sum_probs=9.9

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|..|||||+..
T Consensus         5 ~G~pGsGKst~a   16 (194)
T cd01428           5 LGPPGSGKGTQA   16 (194)
T ss_pred             ECCCCCCHHHHH
Confidence            489999999655


No 386
>PF03668 ATP_bind_2:  P-loop ATPase protein family;  InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins. This is a family of putative P-loop ATPases [], as they contain an ATP-binding site and display ATPase and GTPase activities.; GO: 0005524 ATP binding
Probab=24.57  E-value=58  Score=30.83  Aligned_cols=11  Identities=27%  Similarity=0.486  Sum_probs=10.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus         8 GlSGaGKs~Al   18 (284)
T PF03668_consen    8 GLSGAGKSTAL   18 (284)
T ss_pred             CCCcCCHHHHH
Confidence            89999999999


No 387
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=24.55  E-value=27  Score=29.08  Aligned_cols=12  Identities=33%  Similarity=0.329  Sum_probs=9.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|||||+..
T Consensus         5 ~G~~GsGKSTla   16 (149)
T cd02027           5 TGLSGSGKSTIA   16 (149)
T ss_pred             EcCCCCCHHHHH
Confidence            389999998754


No 388
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=24.50  E-value=24  Score=32.50  Aligned_cols=12  Identities=33%  Similarity=0.230  Sum_probs=10.1

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|.|||.--
T Consensus        56 ~GPPG~GKTTLA   67 (233)
T PF05496_consen   56 YGPPGLGKTTLA   67 (233)
T ss_dssp             ESSTTSSHHHHH
T ss_pred             ECCCccchhHHH
Confidence            899999998643


No 389
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=24.48  E-value=25  Score=31.07  Aligned_cols=11  Identities=36%  Similarity=0.453  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        35 G~nGsGKSTLl   45 (237)
T cd03252          35 GRSGSGKSTLT   45 (237)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 390
>KOG0726|consensus
Probab=24.46  E-value=22  Score=34.44  Aligned_cols=42  Identities=21%  Similarity=0.322  Sum_probs=25.8

Q ss_pred             CCCCcccccccccc-----------ccCCCCCCCCcChHHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTMGT-----------GFETDVSEEMLGIIPRAITHLFEGIQNI   42 (286)
Q Consensus         1 YGqTGSGKTyTm~G-----------~~~~~~~~~~~GIiPRal~~LF~~~~~~   42 (286)
                      ||..|+|||-----           --..+.-....|==||.+++||+..++.
T Consensus       225 yG~PGTGKTLLAKAVANqTSATFlRvvGseLiQkylGdGpklvRqlF~vA~e~  277 (440)
T KOG0726|consen  225 YGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEH  277 (440)
T ss_pred             eCCCCCchhHHHHHHhcccchhhhhhhhHHHHHHHhccchHHHHHHHHHHHhc
Confidence            99999999853310           0000001123344599999999998775


No 391
>TIGR00101 ureG urease accessory protein UreG. This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.
Probab=24.35  E-value=26  Score=30.86  Aligned_cols=11  Identities=45%  Similarity=0.471  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |..|||||..+
T Consensus         8 G~~GsGKTTll   18 (199)
T TIGR00101         8 GPVGSGKTALI   18 (199)
T ss_pred             CCCCCCHHHHH
Confidence            89999999987


No 392
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=24.35  E-value=26  Score=32.97  Aligned_cols=11  Identities=64%  Similarity=0.616  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        40 G~nGsGKSTLl   50 (305)
T PRK13651         40 GQTGSGKTTFI   50 (305)
T ss_pred             CCCCCcHHHHH
Confidence            89999999887


No 393
>PF14532 Sigma54_activ_2:  Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H.
Probab=24.35  E-value=24  Score=28.75  Aligned_cols=12  Identities=25%  Similarity=0.396  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|..||||++..
T Consensus        27 ~GE~GtGK~~~A   38 (138)
T PF14532_consen   27 TGEPGTGKSLLA   38 (138)
T ss_dssp             ECCTTSSHHHHH
T ss_pred             EcCCCCCHHHHH
Confidence            599999999876


No 394
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=24.33  E-value=26  Score=34.19  Aligned_cols=12  Identities=33%  Similarity=0.545  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..|
T Consensus        46 lGpsGsGKSTLL   57 (375)
T PRK09452         46 LGPSGCGKTTVL   57 (375)
T ss_pred             ECCCCCcHHHHH
Confidence            489999999888


No 395
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms.  SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes.  The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge.  SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.
Probab=24.29  E-value=24  Score=30.45  Aligned_cols=12  Identities=33%  Similarity=0.479  Sum_probs=10.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|||||-.|
T Consensus        28 ~G~NGsGKSnil   39 (178)
T cd03239          28 VGPNGSGKSNIV   39 (178)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999877


No 396
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=24.27  E-value=26  Score=30.78  Aligned_cols=11  Identities=45%  Similarity=0.522  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        36 G~nGsGKSTLl   46 (229)
T cd03254          36 GPTGAGKTTLI   46 (229)
T ss_pred             CCCCCCHHHHH
Confidence            89999999988


No 397
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional
Probab=24.26  E-value=25  Score=32.11  Aligned_cols=12  Identities=33%  Similarity=0.174  Sum_probs=10.6

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||+.+.
T Consensus         8 G~~gsGKTtl~~   19 (229)
T PRK14494          8 GFKDSGKTTLIE   19 (229)
T ss_pred             CCCCChHHHHHH
Confidence            789999999884


No 398
>PRK04182 cytidylate kinase; Provisional
Probab=24.25  E-value=27  Score=28.97  Aligned_cols=11  Identities=45%  Similarity=0.425  Sum_probs=9.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||...
T Consensus         7 G~~GsGKstia   17 (180)
T PRK04182          7 GPPGSGKTTVA   17 (180)
T ss_pred             CCCCCCHHHHH
Confidence            89999999854


No 399
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=24.21  E-value=26  Score=31.10  Aligned_cols=11  Identities=27%  Similarity=0.483  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        18 G~nGsGKSTLl   28 (230)
T TIGR01184        18 GHSGCGKSTLL   28 (230)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 400
>PRK03839 putative kinase; Provisional
Probab=24.16  E-value=27  Score=29.52  Aligned_cols=12  Identities=33%  Similarity=0.271  Sum_probs=9.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|..|||||+.-
T Consensus         6 ~G~pGsGKsT~~   17 (180)
T PRK03839          6 TGTPGVGKTTVS   17 (180)
T ss_pred             ECCCCCCHHHHH
Confidence            389999999653


No 401
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=24.12  E-value=26  Score=31.75  Aligned_cols=11  Identities=36%  Similarity=0.347  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        32 G~NGsGKSTLl   42 (246)
T cd03237          32 GPNGIGKTTFI   42 (246)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 402
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=23.96  E-value=25  Score=31.09  Aligned_cols=11  Identities=27%  Similarity=0.456  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        36 G~nGsGKSTLl   46 (238)
T cd03249          36 GSSGCGKSTVV   46 (238)
T ss_pred             eCCCCCHHHHH
Confidence            89999999987


No 403
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit. This model describes spermidine/putrescine ABC transporter, ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Polyamines like spermidine and putrescine play vital role in cell proliferation, differentiation, and ion homeostasis. The concentration of polyamines within the cell are regulated by biosynthesis, degradation and transport (uptake and efflux included).
Probab=23.84  E-value=27  Score=33.09  Aligned_cols=12  Identities=33%  Similarity=0.509  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..|
T Consensus         2 ~G~nGsGKSTLl   13 (325)
T TIGR01187         2 LGPSGCGKTTLL   13 (325)
T ss_pred             cCCCCCCHHHHH
Confidence            389999999877


No 404
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=23.84  E-value=27  Score=33.59  Aligned_cols=12  Identities=33%  Similarity=0.410  Sum_probs=10.6

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |.+|||||.|..
T Consensus        38 GESGsGKS~~~~   49 (316)
T COG0444          38 GESGSGKSVLAK   49 (316)
T ss_pred             cCCCCCHHHHHH
Confidence            899999998873


No 405
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=23.83  E-value=28  Score=29.47  Aligned_cols=11  Identities=18%  Similarity=0.175  Sum_probs=9.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||...
T Consensus         9 G~~gsGKst~a   19 (175)
T cd00227           9 GGSSAGKSSIA   19 (175)
T ss_pred             CCCCCCHHHHH
Confidence            89999999765


No 406
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=23.83  E-value=26  Score=37.07  Aligned_cols=42  Identities=19%  Similarity=0.301  Sum_probs=25.4

Q ss_pred             CCCCcccccccccc---ccCC--------CCCCCCcChHHHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTMGT---GFET--------DVSEEMLGIIPRAITHLFEGIQNI   42 (286)
Q Consensus         1 YGqTGSGKTyTm~G---~~~~--------~~~~~~~GIiPRal~~LF~~~~~~   42 (286)
                      ||+.|+|||+..--   ....        +.-....|=-.+.+..+|......
T Consensus       493 ~GppGtGKT~lakalA~e~~~~fi~v~~~~l~~~~vGese~~i~~~f~~A~~~  545 (733)
T TIGR01243       493 FGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIFRKARQA  545 (733)
T ss_pred             ECCCCCCHHHHHHHHHHhcCCCEEEEehHHHhhcccCcHHHHHHHHHHHHHhc
Confidence            89999999987511   0000        001123455577888999887653


No 407
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=23.82  E-value=26  Score=33.27  Aligned_cols=11  Identities=36%  Similarity=0.543  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        40 G~sGsGKSTL~   50 (326)
T PRK11022         40 GESGSGKSVSS   50 (326)
T ss_pred             CCCCChHHHHH
Confidence            89999999886


No 408
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=23.76  E-value=27  Score=28.84  Aligned_cols=11  Identities=36%  Similarity=0.474  Sum_probs=9.8

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|+|||..|
T Consensus        32 G~nGsGKStll   42 (157)
T cd00267          32 GPNGSGKSTLL   42 (157)
T ss_pred             CCCCCCHHHHH
Confidence            89999999766


No 409
>KOG0922|consensus
Probab=23.75  E-value=33  Score=36.12  Aligned_cols=11  Identities=45%  Similarity=0.622  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||||||.-+
T Consensus        73 GeTGsGKSTQi   83 (674)
T KOG0922|consen   73 GETGSGKSTQI   83 (674)
T ss_pred             cCCCCCccccH
Confidence            89999999877


No 410
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=23.75  E-value=27  Score=31.43  Aligned_cols=11  Identities=27%  Similarity=0.410  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        35 G~nGsGKSTLl   45 (255)
T PRK11231         35 GPNGCGKSTLL   45 (255)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 411
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=23.70  E-value=26  Score=37.12  Aligned_cols=12  Identities=42%  Similarity=0.293  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+||+|||++.
T Consensus       490 ~Gp~GvGKT~lA  501 (731)
T TIGR02639       490 TGPTGVGKTELA  501 (731)
T ss_pred             ECCCCccHHHHH
Confidence            599999999876


No 412
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=23.70  E-value=27  Score=27.63  Aligned_cols=11  Identities=18%  Similarity=0.229  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|+|||..+
T Consensus         8 G~~~~GKstli   18 (157)
T cd04164           8 GKPNVGKSSLL   18 (157)
T ss_pred             CCCCCCHHHHH
Confidence            89999999776


No 413
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=23.66  E-value=27  Score=33.47  Aligned_cols=11  Identities=36%  Similarity=0.543  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        31 G~nGsGKSTLl   41 (352)
T PRK11144         31 GRSGAGKTSLI   41 (352)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 414
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD. The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM).
Probab=23.62  E-value=26  Score=36.21  Aligned_cols=12  Identities=42%  Similarity=0.526  Sum_probs=9.9

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|.||||||..|
T Consensus       182 ~G~tGsGKs~~i  193 (566)
T TIGR02759       182 HGTTGSGKSVAI  193 (566)
T ss_pred             EcCCCCCHHHHH
Confidence            589999999655


No 415
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Probab=23.59  E-value=27  Score=33.80  Aligned_cols=12  Identities=33%  Similarity=0.548  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..|
T Consensus        37 lGpsGsGKSTLL   48 (362)
T TIGR03258        37 IGKSGCGKTTLL   48 (362)
T ss_pred             ECCCCCCHHHHH
Confidence            489999999888


No 416
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=23.58  E-value=27  Score=31.41  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        29 G~nGsGKSTLl   39 (248)
T PRK03695         29 GPNGAGKSTLL   39 (248)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 417
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=23.57  E-value=27  Score=31.08  Aligned_cols=11  Identities=64%  Similarity=0.694  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-|
T Consensus        34 G~nGsGKSTLl   44 (242)
T cd03295          34 GPSGSGKTTTM   44 (242)
T ss_pred             CCCCCCHHHHH
Confidence            89999999776


No 418
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=23.56  E-value=28  Score=30.56  Aligned_cols=11  Identities=27%  Similarity=0.153  Sum_probs=10.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+.|+|||..|
T Consensus        32 GpNg~GKSTll   42 (199)
T cd03283          32 GSNMSGKSTFL   42 (199)
T ss_pred             CCCCCChHHHH
Confidence            89999999988


No 419
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=23.56  E-value=29  Score=30.32  Aligned_cols=12  Identities=42%  Similarity=0.387  Sum_probs=10.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||.+|+|||..+
T Consensus        25 ~G~~GsGKT~l~   36 (226)
T cd01393          25 FGEFGSGKTQLC   36 (226)
T ss_pred             eCCCCCChhHHH
Confidence            699999999876


No 420
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=23.54  E-value=30  Score=32.90  Aligned_cols=11  Identities=45%  Similarity=0.265  Sum_probs=9.5

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+||||||.--
T Consensus        11 GptgsGKt~la   21 (307)
T PRK00091         11 GPTASGKTALA   21 (307)
T ss_pred             CCCCcCHHHHH
Confidence            99999999754


No 421
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis.
Probab=23.51  E-value=27  Score=32.76  Aligned_cols=12  Identities=33%  Similarity=0.307  Sum_probs=11.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||.+.
T Consensus        42 ~G~~G~GKt~~a   53 (355)
T TIGR02397        42 SGPRGTGKTSIA   53 (355)
T ss_pred             ECCCCCCHHHHH
Confidence            899999999876


No 422
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional
Probab=23.51  E-value=27  Score=31.69  Aligned_cols=11  Identities=27%  Similarity=0.413  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        54 G~nGsGKSTLl   64 (268)
T PRK14248         54 GPSGCGKSTFL   64 (268)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 423
>TIGR00611 recf recF protein. All proteins in this family for which functions are known are DNA binding proteins that assist the filamentation of RecA onto DNA for the initiation of recombination or recombinational repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.48  E-value=25  Score=34.05  Aligned_cols=12  Identities=33%  Similarity=0.465  Sum_probs=11.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||..|
T Consensus        29 ~G~NGsGKT~lL   40 (365)
T TIGR00611        29 VGPNGQGKTNLL   40 (365)
T ss_pred             ECCCCCCHHHHH
Confidence            699999999877


No 424
>PRK10865 protein disaggregation chaperone; Provisional
Probab=23.43  E-value=26  Score=37.94  Aligned_cols=12  Identities=42%  Similarity=0.382  Sum_probs=11.0

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+||+|||++.
T Consensus       604 ~Gp~G~GKT~lA  615 (857)
T PRK10865        604 LGPTGVGKTELC  615 (857)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999987


No 425
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional
Probab=23.43  E-value=28  Score=31.18  Aligned_cols=11  Identities=27%  Similarity=0.413  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        37 G~nGsGKSTLl   47 (251)
T PRK14251         37 GPSGCGKSTFL   47 (251)
T ss_pred             CCCCCCHHHHH
Confidence            89999999766


No 426
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=23.42  E-value=28  Score=31.29  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        39 G~nGsGKSTLl   49 (253)
T PRK14261         39 GPSGCGKSTLL   49 (253)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 427
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=23.38  E-value=28  Score=30.16  Aligned_cols=11  Identities=55%  Similarity=0.631  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-+
T Consensus        33 G~nGsGKSTLl   43 (208)
T cd03268          33 GPNGAGKTTTM   43 (208)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 428
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit. This model represents the ATPase subunit of HslVU, while the proteasome-related peptidase subunit is HslV. Residues 54-61 of the model contain a P-loop ATP-binding motif. Cys-287 of E. coli (position 308 in the seed alignment), studied in PubMed:98389714, is Ser in other members of the seed alignment.
Probab=23.25  E-value=27  Score=35.02  Aligned_cols=12  Identities=42%  Similarity=0.399  Sum_probs=10.8

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|+|||+..
T Consensus        53 iGppG~GKT~lA   64 (441)
T TIGR00390        53 IGPTGVGKTEIA   64 (441)
T ss_pred             ECCCCCCHHHHH
Confidence            699999999876


No 429
>TIGR00643 recG ATP-dependent DNA helicase RecG.
Probab=23.24  E-value=27  Score=36.26  Aligned_cols=11  Identities=45%  Similarity=0.513  Sum_probs=9.7

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+||||||...
T Consensus       263 g~TGSGKT~va  273 (630)
T TIGR00643       263 GDVGSGKTLVA  273 (630)
T ss_pred             CCCCCcHHHHH
Confidence            79999999865


No 430
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=23.22  E-value=27  Score=31.44  Aligned_cols=12  Identities=17%  Similarity=0.119  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|++|+|||...
T Consensus        30 ~G~~G~GKTtl~   41 (230)
T PRK08533         30 EGDESTGKSILS   41 (230)
T ss_pred             ECCCCCCHHHHH
Confidence            599999999884


No 431
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=23.19  E-value=28  Score=29.33  Aligned_cols=11  Identities=27%  Similarity=0.447  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-+
T Consensus        34 G~nGsGKSTLl   44 (166)
T cd03223          34 GPSGTGKSSLF   44 (166)
T ss_pred             CCCCCCHHHHH
Confidence            89999999886


No 432
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=23.18  E-value=31  Score=30.05  Aligned_cols=11  Identities=27%  Similarity=0.323  Sum_probs=9.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||+--
T Consensus         7 G~pGaGK~T~A   17 (178)
T COG0563           7 GPPGAGKSTLA   17 (178)
T ss_pred             CCCCCCHHHHH
Confidence            89999998643


No 433
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=23.18  E-value=28  Score=30.30  Aligned_cols=11  Identities=27%  Similarity=0.332  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        40 G~nGsGKSTLl   50 (202)
T cd03233          40 GRPGSGCSTLL   50 (202)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 434
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=23.14  E-value=28  Score=30.67  Aligned_cols=11  Identities=36%  Similarity=0.468  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+.|||||..|
T Consensus        35 G~nGsGKSTLl   45 (234)
T cd03251          35 GPSGSGKSTLV   45 (234)
T ss_pred             CCCCCCHHHHH
Confidence            89999999987


No 435
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=23.05  E-value=28  Score=31.50  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        35 G~nGsGKSTLl   45 (258)
T PRK13548         35 GPNGAGKSTLL   45 (258)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 436
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=23.00  E-value=29  Score=30.54  Aligned_cols=13  Identities=38%  Similarity=0.235  Sum_probs=10.9

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      ||.+|||||..+.
T Consensus        29 ~G~~GsGKT~l~~   41 (225)
T PRK09361         29 YGPPGSGKTNICL   41 (225)
T ss_pred             ECCCCCCHHHHHH
Confidence            6999999997763


No 437
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=22.99  E-value=27  Score=33.97  Aligned_cols=13  Identities=38%  Similarity=0.567  Sum_probs=11.4

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      +|.+||||||.+-
T Consensus        44 ~G~~GtGKs~~ar   56 (350)
T CHL00081         44 MGDRGTGKSTTIR   56 (350)
T ss_pred             EcCCCCCHHHHHH
Confidence            5899999999984


No 438
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=22.97  E-value=29  Score=31.68  Aligned_cols=11  Identities=27%  Similarity=0.374  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        34 G~nGsGKSTLl   44 (271)
T PRK13638         34 GANGCGKSTLF   44 (271)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 439
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=22.96  E-value=29  Score=31.01  Aligned_cols=11  Identities=45%  Similarity=0.534  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        36 G~nGsGKSTLl   46 (250)
T PRK11264         36 GPSGSGKTTLL   46 (250)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 440
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=22.94  E-value=28  Score=31.34  Aligned_cols=11  Identities=45%  Similarity=0.591  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        39 G~nGsGKSTLl   49 (258)
T PRK11701         39 GESGSGKTTLL   49 (258)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 441
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=22.92  E-value=29  Score=31.52  Aligned_cols=11  Identities=27%  Similarity=0.404  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        37 G~NGsGKSTLl   47 (251)
T PRK09544         37 GPNGAGKSTLV   47 (251)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 442
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=22.92  E-value=29  Score=30.00  Aligned_cols=11  Identities=36%  Similarity=0.459  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|+|||..+
T Consensus        38 G~nG~GKSTLl   48 (204)
T cd03250          38 GPVGSGKSSLL   48 (204)
T ss_pred             CCCCCCHHHHH
Confidence            89999999976


No 443
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=22.91  E-value=29  Score=29.28  Aligned_cols=11  Identities=36%  Similarity=0.504  Sum_probs=9.8

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-+
T Consensus        35 G~nGsGKstLl   45 (171)
T cd03228          35 GPSGSGKSTLL   45 (171)
T ss_pred             CCCCCCHHHHH
Confidence            89999999776


No 444
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=22.89  E-value=29  Score=30.55  Aligned_cols=12  Identities=33%  Similarity=0.373  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|.+|+|||+..
T Consensus        26 ~G~~G~GKT~l~   37 (229)
T TIGR03881        26 TGEPGTGKTIFC   37 (229)
T ss_pred             ECCCCCChHHHH
Confidence            599999999865


No 445
>KOG1970|consensus
Probab=22.85  E-value=33  Score=35.65  Aligned_cols=11  Identities=36%  Similarity=0.519  Sum_probs=10.7

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|+|||.|+
T Consensus       117 GPsGcGKSTtv  127 (634)
T KOG1970|consen  117 GPSGCGKSTTV  127 (634)
T ss_pred             CCCCCCchhHH
Confidence            99999999998


No 446
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=22.83  E-value=29  Score=33.44  Aligned_cols=12  Identities=42%  Similarity=0.567  Sum_probs=10.7

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|++|||||..+
T Consensus        34 lGpsGsGKSTLL   45 (353)
T PRK10851         34 LGPSGSGKTTLL   45 (353)
T ss_pred             ECCCCCCHHHHH
Confidence            389999999887


No 447
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]
Probab=22.79  E-value=30  Score=33.12  Aligned_cols=12  Identities=42%  Similarity=0.224  Sum_probs=10.7

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|+|+||||...
T Consensus         9 ~GPTAsGKT~la   20 (308)
T COG0324           9 AGPTASGKTALA   20 (308)
T ss_pred             ECCCCcCHHHHH
Confidence            499999999976


No 448
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=22.75  E-value=29  Score=31.69  Aligned_cols=11  Identities=36%  Similarity=0.462  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        57 G~nGsGKSTLl   67 (269)
T cd03294          57 GLSGSGKSTLL   67 (269)
T ss_pred             CCCCCCHHHHH
Confidence            89999999886


No 449
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=22.67  E-value=29  Score=30.98  Aligned_cols=11  Identities=27%  Similarity=0.462  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        36 G~nGsGKSTLl   46 (241)
T PRK14250         36 GPSGAGKSTLI   46 (241)
T ss_pred             CCCCCCHHHHH
Confidence            89999999776


No 450
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional
Probab=22.59  E-value=30  Score=39.28  Aligned_cols=11  Identities=55%  Similarity=0.661  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+||||||.-+
T Consensus        96 GeTGSGKTTql  106 (1294)
T PRK11131         96 GETGSGKTTQL  106 (1294)
T ss_pred             CCCCCCHHHHH
Confidence            89999999865


No 451
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=22.53  E-value=29  Score=33.56  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        36 G~nGsGKSTLL   46 (369)
T PRK11000         36 GPSGCGKSTLL   46 (369)
T ss_pred             CCCCCcHHHHH
Confidence            89999999888


No 452
>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=22.45  E-value=29  Score=29.05  Aligned_cols=12  Identities=25%  Similarity=0.351  Sum_probs=10.6

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |..|+|||.++.
T Consensus         6 G~~GsGKTt~~~   17 (148)
T cd03114           6 GVPGAGKSTLID   17 (148)
T ss_pred             CCCCCcHHHHHH
Confidence            889999999884


No 453
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=22.40  E-value=30  Score=30.94  Aligned_cols=11  Identities=36%  Similarity=0.347  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        40 G~nGsGKSTLl   50 (252)
T CHL00131         40 GPNGSGKSTLS   50 (252)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 454
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=22.39  E-value=30  Score=29.24  Aligned_cols=12  Identities=33%  Similarity=0.434  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|||||.-+
T Consensus        34 ~G~nGsGKStLl   45 (173)
T cd03246          34 IGPSGSGKSTLA   45 (173)
T ss_pred             ECCCCCCHHHHH
Confidence            389999999877


No 455
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]
Probab=22.37  E-value=35  Score=31.37  Aligned_cols=12  Identities=33%  Similarity=0.562  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|..|+|||.++
T Consensus        34 LG~NGAGKTT~L   45 (245)
T COG4555          34 LGENGAGKTTLL   45 (245)
T ss_pred             EcCCCCCchhHH
Confidence            489999999886


No 456
>PRK14530 adenylate kinase; Provisional
Probab=22.33  E-value=31  Score=30.27  Aligned_cols=11  Identities=27%  Similarity=0.262  Sum_probs=9.6

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-.
T Consensus        10 G~pGsGKsT~~   20 (215)
T PRK14530         10 GAPGAGKGTQS   20 (215)
T ss_pred             CCCCCCHHHHH
Confidence            89999999765


No 457
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=22.30  E-value=30  Score=30.74  Aligned_cols=12  Identities=42%  Similarity=0.581  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|||||..+
T Consensus        35 ~G~nGsGKSTLl   46 (241)
T PRK10895         35 LGPNGAGKTTTF   46 (241)
T ss_pred             ECCCCCCHHHHH
Confidence            389999999877


No 458
>PRK13830 conjugal transfer protein TrbE; Provisional
Probab=22.29  E-value=30  Score=37.25  Aligned_cols=13  Identities=38%  Similarity=0.506  Sum_probs=11.4

Q ss_pred             CCCCccccccccc
Q psy15014          1 MLQTGSGKTYTMG   13 (286)
Q Consensus         1 YGqTGSGKTyTm~   13 (286)
                      .|+||||||..|-
T Consensus       462 ~G~tGsGKS~l~~  474 (818)
T PRK13830        462 FGPTGSGKSTLLA  474 (818)
T ss_pred             ECCCCCCHHHHHH
Confidence            3899999999993


No 459
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=22.23  E-value=30  Score=30.54  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-+
T Consensus        40 G~nGsGKSTLl   50 (225)
T PRK10247         40 GPSGCGKSTLL   50 (225)
T ss_pred             CCCCCCHHHHH
Confidence            89999999776


No 460
>PF08423 Rad51:  Rad51;  InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51. It is critical for DNA binding []. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain.; PDB: 2ZUC_A 2Z43_C 2ZUD_B 2DFL_A 2ZUB_A 2BKE_A 2KZ3_A 2CVH_B 2CVF_B 1SZP_D ....
Probab=22.22  E-value=25  Score=32.23  Aligned_cols=11  Identities=45%  Similarity=0.561  Sum_probs=9.6

Q ss_pred             CCCCccccccc
Q psy15014          1 MLQTGSGKTYT   11 (286)
Q Consensus         1 YGqTGSGKTyT   11 (286)
                      ||..|||||--
T Consensus        44 ~G~~gsGKTql   54 (256)
T PF08423_consen   44 VGESGSGKTQL   54 (256)
T ss_dssp             EESTTSSHHHH
T ss_pred             EEecccccchH
Confidence            79999999954


No 461
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=22.20  E-value=30  Score=29.04  Aligned_cols=11  Identities=36%  Similarity=0.543  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-+
T Consensus        33 G~nGsGKSTLl   43 (163)
T cd03216          33 GENGAGKSTLM   43 (163)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 462
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=22.17  E-value=30  Score=31.76  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        38 G~nGsGKSTLl   48 (274)
T PRK13647         38 GPNGAGKSTLL   48 (274)
T ss_pred             CCCCCcHHHHH
Confidence            89999999988


No 463
>TIGR00750 lao LAO/AO transport system ATPase. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however.
Probab=22.17  E-value=31  Score=32.28  Aligned_cols=12  Identities=25%  Similarity=0.376  Sum_probs=10.6

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |..|+|||.++.
T Consensus        41 G~~G~GKttl~~   52 (300)
T TIGR00750        41 GTPGAGKSTLLE   52 (300)
T ss_pred             CCCCCCHHHHHH
Confidence            889999999883


No 464
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional
Probab=22.17  E-value=30  Score=30.93  Aligned_cols=11  Identities=27%  Similarity=0.413  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        35 G~nGsGKSTLl   45 (246)
T PRK14269         35 GASGCGKSTFL   45 (246)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 465
>PRK05541 adenylylsulfate kinase; Provisional
Probab=22.14  E-value=31  Score=29.02  Aligned_cols=11  Identities=45%  Similarity=0.380  Sum_probs=9.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |..|||||...
T Consensus        14 G~~GsGKst~a   24 (176)
T PRK05541         14 GLAGSGKTTIA   24 (176)
T ss_pred             cCCCCCHHHHH
Confidence            88999998765


No 466
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family. Members of this protein family resemble the widely distributed ATP-dependent protease La, also called Lon and LonA. It resembles even more closely LonB, which is a LonA paralog found in genomes if and only if the species is capable of endospore formation (as in Bacillus subtilis, Clostridium tetani, and select other members of the Firmicutes) and expressed specifically in the forespore compartment. Members of this family are restricted to a subset of spore-forming species, and are very likely to participate in the program of endospore formation. We propose the designation LonC.
Probab=22.12  E-value=28  Score=36.19  Aligned_cols=12  Identities=33%  Similarity=0.313  Sum_probs=10.9

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||++|+|||+..
T Consensus       181 ~Gp~GtGKTTLA  192 (615)
T TIGR02903       181 YGPPGVGKTTAA  192 (615)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999876


No 467
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=22.09  E-value=30  Score=30.94  Aligned_cols=11  Identities=27%  Similarity=0.413  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        36 G~nGsGKSTLl   46 (250)
T PRK14245         36 GPSGCGKSTFL   46 (250)
T ss_pred             CCCCCCHHHHH
Confidence            89999999886


No 468
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=22.06  E-value=32  Score=29.86  Aligned_cols=12  Identities=17%  Similarity=0.061  Sum_probs=10.9

Q ss_pred             CCCccccccccc
Q psy15014          2 LQTGSGKTYTMG   13 (286)
Q Consensus         2 GqTGSGKTyTm~   13 (286)
                      |+.|+|||..|-
T Consensus        36 G~Ng~GKStll~   47 (202)
T cd03243          36 GPNMGGKSTYLR   47 (202)
T ss_pred             CCCCCccHHHHH
Confidence            899999999984


No 469
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=22.03  E-value=31  Score=31.69  Aligned_cols=11  Identities=27%  Similarity=0.404  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        37 G~NGsGKSTLl   47 (277)
T PRK13652         37 GPNGAGKSTLF   47 (277)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 470
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=22.03  E-value=30  Score=32.06  Aligned_cols=11  Identities=45%  Similarity=0.576  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..|
T Consensus        40 G~nGsGKSTLl   50 (290)
T PRK13634         40 GHTGSGKSTLL   50 (290)
T ss_pred             CCCCCcHHHHH
Confidence            89999999887


No 471
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=22.02  E-value=31  Score=30.64  Aligned_cols=12  Identities=25%  Similarity=0.274  Sum_probs=10.1

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|.+|||||+-.
T Consensus        31 ~G~~GsGKt~l~   42 (234)
T PRK06067         31 EGDHGTGKSVLS   42 (234)
T ss_pred             ECCCCCChHHHH
Confidence            599999998765


No 472
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=22.01  E-value=31  Score=30.31  Aligned_cols=11  Identities=36%  Similarity=0.507  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |+.|||||+.+
T Consensus        47 G~nGsGKSTLl   57 (226)
T cd03248          47 GPSGSGKSTVV   57 (226)
T ss_pred             CCCCCCHHHHH
Confidence            89999999987


No 473
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=22.01  E-value=31  Score=30.92  Aligned_cols=11  Identities=36%  Similarity=0.561  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-+
T Consensus        36 G~nGsGKSTLl   46 (253)
T TIGR02323        36 GESGSGKSTLL   46 (253)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 474
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=21.95  E-value=31  Score=30.64  Aligned_cols=11  Identities=45%  Similarity=0.537  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|+|||..|
T Consensus        35 G~nGsGKSTLl   45 (242)
T TIGR03411        35 GPNGAGKTTMM   45 (242)
T ss_pred             CCCCCCHHHHH
Confidence            89999999886


No 475
>PRK10908 cell division protein FtsE; Provisional
Probab=21.94  E-value=31  Score=30.25  Aligned_cols=11  Identities=27%  Similarity=0.513  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-+
T Consensus        35 G~nGsGKSTLl   45 (222)
T PRK10908         35 GHSGAGKSTLL   45 (222)
T ss_pred             CCCCCCHHHHH
Confidence            89999999776


No 476
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=21.91  E-value=31  Score=30.02  Aligned_cols=11  Identities=45%  Similarity=0.585  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-+
T Consensus        38 G~nGsGKSTLl   48 (218)
T cd03266          38 GPNGAGKTTTL   48 (218)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 477
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=21.86  E-value=31  Score=30.83  Aligned_cols=11  Identities=36%  Similarity=0.471  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-|
T Consensus        36 G~nGsGKSTLl   46 (250)
T PRK14262         36 GPSGCGKTTLL   46 (250)
T ss_pred             CCCCCCHHHHH
Confidence            89999999987


No 478
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional
Probab=21.80  E-value=29  Score=33.04  Aligned_cols=12  Identities=33%  Similarity=0.254  Sum_probs=10.9

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||+.|+|||++.
T Consensus        45 ~G~~G~GKt~~a   56 (367)
T PRK14970         45 CGPRGVGKTTCA   56 (367)
T ss_pred             ECCCCCCHHHHH
Confidence            899999999776


No 479
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=21.76  E-value=31  Score=30.95  Aligned_cols=11  Identities=27%  Similarity=0.413  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        40 G~nGsGKSTLl   50 (254)
T PRK14273         40 GPSGCGKSTFL   50 (254)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 480
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=21.75  E-value=31  Score=29.37  Aligned_cols=12  Identities=25%  Similarity=0.188  Sum_probs=10.4

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      .|.+|||||.-+
T Consensus        32 ~G~nGsGKSTLl   43 (182)
T cd03215          32 AGLVGNGQTELA   43 (182)
T ss_pred             ECCCCCCHHHHH
Confidence            389999999877


No 481
>PF00158 Sigma54_activat:  Sigma-54 interaction domain;  InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor. These have a conserved domain of about 230 residues involved in the ATP-dependent [, ] interaction with sigma-54. About half of the proteins in which this domain is found (algB, dcdT, flbD, hoxA, hupR1, hydG, ntrC, pgtA and pilR) belong to signal transduction two-component systems [] and possess a domain that can be phosphorylated by a sensor-kinase protein in their N-terminal section. Almost all of these proteins possess a helix-turn-helix DNA-binding domain in their C-terminal section. The domain which interacts with the sigma-54 factor has an ATPase activity. This may be required to promote a conformational change necessary for the interaction []. The domain contains an atypical ATP-binding motif A (P-loop) as well as a form of motif B. The two ATP-binding motifs are located in the N-terminal section of the domain.; GO: 0005524 ATP binding, 0008134 transcription factor binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1NY6_K 3M0E_G 1NY5_A 1OJL_A 3DZD_B 2C9C_A 2C98_A 2C96_A 2BJV_A 2C99_A ....
Probab=21.75  E-value=29  Score=29.82  Aligned_cols=32  Identities=13%  Similarity=0.349  Sum_probs=20.0

Q ss_pred             CCCcEEEeccEEEEcCCHHHHHHHHHHHHhcC
Q psy15014        199 SGHSIYVTGATSKSIRSAQEAMNALRQGALSR  230 (286)
Q Consensus       199 ~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R  230 (286)
                      .++..|+.++...+...-..++++|+.+.-.|
T Consensus        93 ~~GtL~Ld~I~~L~~~~Q~~Ll~~l~~~~~~~  124 (168)
T PF00158_consen   93 NGGTLFLDEIEDLPPELQAKLLRVLEEGKFTR  124 (168)
T ss_dssp             TTSEEEEETGGGS-HHHHHHHHHHHHHSEEEC
T ss_pred             cceEEeecchhhhHHHHHHHHHHHHhhchhcc
Confidence            34667777777777666666777776554433


No 482
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=21.72  E-value=31  Score=31.38  Aligned_cols=11  Identities=36%  Similarity=0.431  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        42 G~nGsGKSTLl   52 (269)
T PRK13648         42 GHNGSGKSTIA   52 (269)
T ss_pred             CCCCCCHHHHH
Confidence            89999999887


No 483
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=21.72  E-value=31  Score=36.99  Aligned_cols=12  Identities=42%  Similarity=0.329  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+||+|||+..
T Consensus       494 ~GP~GvGKT~lA  505 (758)
T PRK11034        494 AGPTGVGKTEVT  505 (758)
T ss_pred             ECCCCCCHHHHH
Confidence            599999999765


No 484
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=21.72  E-value=31  Score=31.52  Aligned_cols=11  Identities=55%  Similarity=0.643  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||..+
T Consensus        40 G~nGsGKSTLl   50 (280)
T PRK13649         40 GHTGSGKSTIM   50 (280)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 485
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=21.67  E-value=31  Score=31.47  Aligned_cols=11  Identities=27%  Similarity=0.480  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        46 G~nGsGKSTLl   56 (269)
T PRK14259         46 GPSGCGKSTVL   56 (269)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 486
>TIGR02236 recomb_radA DNA repair and recombination protein RadA. This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
Probab=21.64  E-value=32  Score=32.04  Aligned_cols=12  Identities=42%  Similarity=0.407  Sum_probs=10.5

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      ||.+|||||.-+
T Consensus       101 ~G~~g~GKT~l~  112 (310)
T TIGR02236       101 FGEFGSGKTQIC  112 (310)
T ss_pred             ECCCCCCHHHHH
Confidence            799999999765


No 487
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=21.47  E-value=35  Score=36.01  Aligned_cols=11  Identities=36%  Similarity=0.486  Sum_probs=10.4

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.|.
T Consensus        99 GESGaGKTe~~  109 (677)
T smart00242       99 GESGAGKTENT  109 (677)
T ss_pred             cCCCCcchHHH
Confidence            89999999997


No 488
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=21.46  E-value=32  Score=31.11  Aligned_cols=11  Identities=27%  Similarity=0.440  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-+
T Consensus        46 G~nGsGKSTLl   56 (260)
T PRK10744         46 GPSGCGKSTLL   56 (260)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 489
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=21.46  E-value=32  Score=30.84  Aligned_cols=11  Identities=36%  Similarity=0.525  Sum_probs=10.1

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..|
T Consensus        33 G~nGsGKSTLl   43 (252)
T TIGR03005        33 GPSGSGKSTIL   43 (252)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 490
>KOG0990|consensus
Probab=21.45  E-value=41  Score=32.72  Aligned_cols=41  Identities=32%  Similarity=0.345  Sum_probs=27.7

Q ss_pred             CCCCccccccccccc-------cCCC------CCCCCcCh-HHHHHHHHHHHHHH
Q psy15014          1 MLQTGSGKTYTMGTG-------FETD------VSEEMLGI-IPRAITHLFEGIQN   41 (286)
Q Consensus         1 YGqTGSGKTyTm~G~-------~~~~------~~~~~~GI-iPRal~~LF~~~~~   41 (286)
                      ||+.|+|||-||.-.       +.-.      ....++|| ++|-=..+|...+.
T Consensus        68 YgPPGtGktsti~a~a~~ly~~~~~~~m~lelnaSd~rgid~vr~qi~~fast~~  122 (360)
T KOG0990|consen   68 YGPPGTGKTSTILANARDFYSPHPTTSMLLELNASDDRGIDPVRQQIHLFASTQQ  122 (360)
T ss_pred             cCCCCCCCCCchhhhhhhhcCCCCchhHHHHhhccCccCCcchHHHHHHHHhhcc
Confidence            999999999999421       1100      12356677 67888888888764


No 491
>PF02810 SEC-C:  SEC-C motif;  InterPro: IPR004027 The SEC-C motif found in the C terminus of the SecA protein, in the middle of some SWI2 ATPases and also solo in several proteins. The motif is predicted to chelate zinc with the CXC and C[HC] pairs that constitute the most conserved feature of the motif. It is predicted to be a potential nucleic acid binding domain.; PDB: 1OZB_J 1TM6_A 2I9W_A 2JQ5_A.
Probab=21.45  E-value=38  Score=19.48  Aligned_cols=8  Identities=63%  Similarity=1.086  Sum_probs=6.3

Q ss_pred             Cccccccc
Q psy15014          4 TGSGKTYT   11 (286)
Q Consensus         4 TGSGKTyT   11 (286)
                      -||||+|.
T Consensus         7 CgSg~~y~   14 (21)
T PF02810_consen    7 CGSGKKYK   14 (21)
T ss_dssp             TSCSSBHH
T ss_pred             CCCCchHH
Confidence            48999884


No 492
>TIGR00618 sbcc exonuclease SbcC. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.41  E-value=30  Score=38.07  Aligned_cols=12  Identities=42%  Similarity=0.509  Sum_probs=10.6

Q ss_pred             CCCCcccccccc
Q psy15014          1 MLQTGSGKTYTM   12 (286)
Q Consensus         1 YGqTGSGKTyTm   12 (286)
                      +|+||||||..+
T Consensus        32 ~G~nGaGKSTil   43 (1042)
T TIGR00618        32 CGKTGAGKTTLL   43 (1042)
T ss_pred             ECCCCCCHHHHH
Confidence            599999999776


No 493
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=21.39  E-value=31  Score=30.70  Aligned_cols=14  Identities=29%  Similarity=0.145  Sum_probs=11.5

Q ss_pred             CCCCcccccccccc
Q psy15014          1 MLQTGSGKTYTMGT   14 (286)
Q Consensus         1 YGqTGSGKTyTm~G   14 (286)
                      .|.+|||||..+.+
T Consensus        27 ~G~sGsGKSTL~~~   40 (226)
T cd03270          27 TGVSGSGKSSLAFD   40 (226)
T ss_pred             EcCCCCCHHHHHHH
Confidence            38999999999743


No 494
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=21.37  E-value=32  Score=29.12  Aligned_cols=11  Identities=36%  Similarity=0.555  Sum_probs=9.9

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||.-+
T Consensus        35 G~nGsGKStLl   45 (178)
T cd03247          35 GRSGSGKSTLL   45 (178)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 495
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=21.36  E-value=32  Score=31.69  Aligned_cols=11  Identities=36%  Similarity=0.410  Sum_probs=10.3

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|+|||..+
T Consensus        40 G~nGaGKSTLl   50 (279)
T PRK13635         40 GHNGSGKSTLA   50 (279)
T ss_pred             CCCCCcHHHHH
Confidence            89999999987


No 496
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=21.30  E-value=32  Score=29.70  Aligned_cols=11  Identities=36%  Similarity=0.483  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.+|||||..+
T Consensus        34 G~nGsGKSTLl   44 (200)
T PRK13540         34 GSNGAGKTTLL   44 (200)
T ss_pred             CCCCCCHHHHH
Confidence            89999999876


No 497
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=21.27  E-value=32  Score=30.39  Aligned_cols=11  Identities=27%  Similarity=0.471  Sum_probs=10.0

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |++|||||.-|
T Consensus        32 G~nGsGKSTLl   42 (232)
T PRK10771         32 GPSGAGKSTLL   42 (232)
T ss_pred             CCCCCCHHHHH
Confidence            89999999877


No 498
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=21.27  E-value=34  Score=29.41  Aligned_cols=11  Identities=45%  Similarity=0.468  Sum_probs=10.2

Q ss_pred             CCCcccccccc
Q psy15014          2 LQTGSGKTYTM   12 (286)
Q Consensus         2 GqTGSGKTyTm   12 (286)
                      |.||+|||.++
T Consensus         7 G~~g~GKSsl~   17 (196)
T cd01852           7 GKTGAGKSATG   17 (196)
T ss_pred             CCCCCCHHHHH
Confidence            89999999987


No 499
>KOG1882|consensus
Probab=21.26  E-value=1.4e+02  Score=27.94  Aligned_cols=42  Identities=12%  Similarity=0.258  Sum_probs=29.0

Q ss_pred             CCCCCCCceeEEEEEEEeeecccCCCCCce-eEEEEEEEeCCCCcCcc
Q psy15014        238 NSQSSRSHAIFTLHIQQKRLVKVEDPEGEI-GEFLLFLTFPTGSASEF  284 (286)
Q Consensus       238 N~~SSRSHaIftI~v~~~~~~~~~~~~~~~-~~s~L~lVDLAGS~~~~  284 (286)
                      ...+|.-||||+.++.....     ++|.. ..-+.+++||-.+-..|
T Consensus       211 hpScSKQHaviQyR~v~~~r-----~dGt~grrvkpYiiDLgS~NgTf  253 (293)
T KOG1882|consen  211 HPSCSKQHAVIQYRLVEFTR-----ADGTVGRRVKPYIIDLGSGNGTF  253 (293)
T ss_pred             Cccccccceeeeeeeccccc-----CCCccceeeeeEEEecCCCCcce
Confidence            44568889999999876442     33332 34489999998766555


No 500
>PF03029 ATP_bind_1:  Conserved hypothetical ATP binding protein;  InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity.; GO: 0000166 nucleotide binding; PDB: 1YR7_A 1YRA_B 1YR8_A 1YR6_A 1YR9_A 1YRB_A 2OXR_A.
Probab=21.24  E-value=30  Score=31.49  Aligned_cols=13  Identities=38%  Similarity=0.255  Sum_probs=10.2

Q ss_pred             CCCcccccccccc
Q psy15014          2 LQTGSGKTYTMGT   14 (286)
Q Consensus         2 GqTGSGKTyTm~G   14 (286)
                      |+-|||||+=..+
T Consensus         3 GpaGSGKTT~~~~   15 (238)
T PF03029_consen    3 GPAGSGKTTFCKG   15 (238)
T ss_dssp             ESTTSSHHHHHHH
T ss_pred             CCCCCCHHHHHHH
Confidence            8899999976543


Done!