Diaphorina citri psyllid: psy15020


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MKCLLTLRPVDVRYFDESAYLEKGALRPGQDPYESNKYNQAASDNTPSNRDVPDTRHPAMIAKVQTALLYKKHYLQNSHDRWRIIFELR
ccEEEECcccccccccHHHHHHccccccccccHHHcccHHHHHcccccccccccccccccccccccccccccEEEEEcccHHHHHHHcc
**CLLTLRPVDVRYFDESAYLE*********PYESNKYNQAASDNTPSNRDVPDTRHPAMIAKVQTALLYKKHYLQNSHDRWRIIFELR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCLLTLRPVDVRYFDESAYLEKGALRPGQDPYESNKYNQAASDNTPSNRDVPDTRHPAMIAKVQTALLYKKHYLQNSHDRWRIIFELR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polypeptide N-acetylgalactosaminyltransferase 2 Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. It can both act as a peptide transferase that transfers GalNAc onto unmodified peptide substrates, and as a glycopeptide transferase that requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Prefers the monoglycosylated Muc5AC-3 as substrate.confidentQ6WV19

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009312 [BP]oligosaccharide biosynthetic processprobableGO:1901576, GO:0005975, GO:0044238, GO:0009311, GO:0016051, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0044723

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FFU, chain A
Confidence level:very confident
Coverage over the Query: 9-72
View the alignment between query and template
View the model in PyMOL