Query         psy15026
Match_columns 98
No_of_seqs    121 out of 140
Neff          3.2 
Searched_HMMs 46136
Date          Fri Aug 16 18:30:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15026.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15026hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06701 MIB_HERC2:  Mib_herc2;  99.5 1.8E-15   4E-20   99.4   2.2   28   67-94      1-28  (68)
  2 KOG4582|consensus               96.4 0.00071 1.5E-08   53.7  -0.4   52   44-95    204-255 (278)
  3 KOG4582|consensus               70.9     6.1 0.00013   31.5   3.7   33   62-94     59-94  (278)
  4 COG4672 gp18 Phage-related pro  64.3     6.7 0.00015   31.6   2.7   31    6-39     65-95  (231)
  5 KOG3360|consensus               59.8     8.3 0.00018   27.5   2.2   20   16-35      3-22  (98)
  6 PF13304 AAA_21:  AAA domain; P  36.6      12 0.00025   24.7   0.0   15    9-23      5-19  (303)
  7 PF03811 Zn_Tnp_IS1:  InsA N-te  35.9      30 0.00065   20.1   1.7   16    6-21     17-32  (36)
  8 smart00712 PUR DNA/RNA-binding  34.8      32 0.00068   22.1   1.8   24    2-25     25-48  (63)
  9 TIGR00739 yajC preprotein tran  33.3      47   0.001   22.2   2.5   20   54-73     28-47  (84)
 10 PF00488 MutS_V:  MutS domain V  30.6      12 0.00025   28.6  -0.8   16    7-22     47-62  (235)
 11 PF05986 ADAM_spacer1:  ADAM-TS  28.5      61  0.0013   22.2   2.5   19    2-24     27-45  (114)
 12 PF06934 CTI:  Fatty acid cis/t  27.8      11 0.00023   34.5  -1.7   18   17-34    422-439 (694)
 13 PF13752 DUF4165:  Domain of un  27.7      69  0.0015   23.6   2.8   18   17-34     71-88  (124)
 14 smart00534 MUTSac ATPase domai  27.1      19 0.00041   25.8  -0.2   19    6-24      2-20  (185)
 15 PF14652 DUF4457:  Domain of un  26.9      38 0.00083   27.4   1.5   16   15-30      9-24  (329)
 16 PRK05585 yajC preprotein trans  26.2      71  0.0015   22.3   2.5   18   56-73     45-62  (106)
 17 PRK06531 yajC preprotein trans  26.1      69  0.0015   22.9   2.5   28   56-94     29-56  (113)
 18 cd03280 ABC_MutS2 MutS2 homolo  24.6      27 0.00058   25.2   0.2   19    6-24     31-49  (200)
 19 PRK05886 yajC preprotein trans  24.5      73  0.0016   22.7   2.4   18   56-73     31-48  (109)
 20 cd03227 ABC_Class2 ABC-type Cl  23.7      25 0.00054   24.6  -0.1   20    6-25     24-43  (162)
 21 COG1862 YajC Preprotein transl  23.4      85  0.0018   21.9   2.5   30   54-94     34-63  (97)
 22 PF02699 YajC:  Preprotein tran  23.2      48   0.001   21.8   1.2   19   54-72     27-45  (82)
 23 cd03284 ABC_MutS1 MutS1 homolo  22.5      18 0.00038   27.0  -1.1   19    6-24     33-51  (216)
 24 cd03243 ABC_MutS_homologs The   22.0      33 0.00071   24.7   0.2   20    5-24     31-50  (202)
 25 KOG4660|consensus               21.4      34 0.00074   30.7   0.2   16   25-40     96-111 (549)

No 1  
>PF06701 MIB_HERC2:  Mib_herc2;  InterPro: IPR010606 Mib is a RING ubiquitin ligase in the Notch pathway. Mib interacts with the intracellular domain of Delta to promote its ubiquitylation and internalisation. Cell transplantation studies suggest that mib function is essential in the signalling cell for efficient activation of Notch in neighbouring cells. This domain has been named 'mib/herc2 domain' in []and usually the protein also contains an E3 ligase domain (either Ring or Hect).; GO: 0004842 ubiquitin-protein ligase activity, 0046872 metal ion binding, 0016567 protein ubiquitination; PDB: 2DK3_A 3DKM_A.
Probab=99.55  E-value=1.8e-15  Score=99.42  Aligned_cols=28  Identities=57%  Similarity=0.955  Sum_probs=20.5

Q ss_pred             cceEeeCCCCcccCCCCCCCCCCeeeee
Q psy15026         67 GARVQRGLDWKWRDQDGIPPGEGNLKPI   94 (98)
Q Consensus        67 G~RVvRG~DWkW~dQDGg~g~~GtV~~~   94 (98)
                      |+||||||||+|+||||+++++|||++|
T Consensus         1 G~rVvRGpDW~WgdQDGG~g~~GtV~~i   28 (68)
T PF06701_consen    1 GARVVRGPDWKWGDQDGGEGHVGTVVSI   28 (68)
T ss_dssp             TSEEEE-TT--STTTTSSTT--EEE-S-
T ss_pred             CCeeeeCcCCCccCcCCCCCcceEEEec
Confidence            7999999999999999999999999986


No 2  
>KOG4582|consensus
Probab=96.38  E-value=0.00071  Score=53.67  Aligned_cols=52  Identities=19%  Similarity=0.283  Sum_probs=43.0

Q ss_pred             hhhhHHHHhhhhHHHHhhhhccccceEeeCCCCcccCCCCCCCCCCeeeeeE
Q psy15026         44 EAEASVRKARRLVRTQVMRHLIIGARVQRGLDWKWRDQDGIPPGEGNLKPII   95 (98)
Q Consensus        44 ~ae~~l~~~R~~~r~~~~~~i~~G~RVvRG~DWkW~dQDGg~g~~GtV~~~i   95 (98)
                      .+..+++..++.++......++++..++||++|+|+++++++++.|++.++-
T Consensus       204 ~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  255 (278)
T KOG4582|consen  204 FSGYVMLSSPPNPVNLNKRPIFVGHSKVRGNDWYWTSLGGGEGRIGRVNEIV  255 (278)
T ss_pred             CCcceeccCCCCcccccccccccccccccccCCccccccCCCCCCccccccc
Confidence            3344556667777766678999999999999999999999999999998753


No 3  
>KOG4582|consensus
Probab=70.93  E-value=6.1  Score=31.52  Aligned_cols=33  Identities=18%  Similarity=0.068  Sum_probs=24.2

Q ss_pred             hhccccceEeeCCCCcccCCC---CCCCCCCeeeee
Q psy15026         62 RHLIIGARVQRGLDWKWRDQD---GIPPGEGNLKPI   94 (98)
Q Consensus        62 ~~i~~G~RVvRG~DWkW~dQD---Gg~g~~GtV~~~   94 (98)
                      -....+.+|+||.||+|-.+.   +..++.+++...
T Consensus        59 ~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~   94 (278)
T KOG4582|consen   59 DEDGVGMRVVRGNDLFDVTNQRLADEIGHVNAVRSF   94 (278)
T ss_pred             hccccceeEEecCCceEeecccCccccccccceeee
Confidence            456789999999999999994   444455555444


No 4  
>COG4672 gp18 Phage-related protein [Function unknown]
Probab=64.26  E-value=6.7  Score=31.61  Aligned_cols=31  Identities=39%  Similarity=0.716  Sum_probs=25.5

Q ss_pred             EeecCCCCCCceeeEEeeceEEEeccchhhhhhh
Q psy15026          6 IQQNGKNASGQTHYLSLSGFEIYGTLTGVCEDLG   39 (98)
Q Consensus         6 i~q~g~nss~~~~yls~sgfe~yg~v~~~~Ed~~   39 (98)
                      +.++||++|-+. -|++|-  ++|.|++.|||+.
T Consensus        65 Fe~~GkG~sarP-~L~VsN--l~G~Vt~m~~~~~   95 (231)
T COG4672          65 FEMNGKGSSARP-SLTVSN--LFGLVTGMAEDLQ   95 (231)
T ss_pred             eeecCCCCCCCC-ceEEee--cchhHHHHHHHhh
Confidence            458999999995 788875  6999999999843


No 5  
>KOG3360|consensus
Probab=59.76  E-value=8.3  Score=27.52  Aligned_cols=20  Identities=35%  Similarity=0.855  Sum_probs=17.0

Q ss_pred             ceeeEEeeceEEEeccchhh
Q psy15026         16 QTHYLSLSGFEIYGTLTGVC   35 (98)
Q Consensus        16 ~~~yls~sgfe~yg~v~~~~   35 (98)
                      +.+-|-.-.|||||.|-++|
T Consensus         3 ~~~~i~s~dfEvfGRVQGv~   22 (98)
T KOG3360|consen    3 QAESIKSCDFEVFGRVQGVC   22 (98)
T ss_pred             ccceeEEEeEEEEeeeccch
Confidence            45567778999999999998


No 6  
>PF13304 AAA_21:  AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A.
Probab=36.62  E-value=12  Score=24.71  Aligned_cols=15  Identities=33%  Similarity=0.468  Sum_probs=0.0

Q ss_pred             cCCCCCCceeeEEee
Q psy15026          9 NGKNASGQTHYLSLS   23 (98)
Q Consensus         9 ~g~nss~~~~yls~s   23 (98)
                      .|+|+||.|+.|..-
T Consensus         5 iG~N~sGKS~il~ai   19 (303)
T PF13304_consen    5 IGPNGSGKSNILEAI   19 (303)
T ss_dssp             ---------------
T ss_pred             ccccccccccccccc
Confidence            599999999887543


No 7  
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=35.85  E-value=30  Score=20.12  Aligned_cols=16  Identities=38%  Similarity=0.775  Sum_probs=13.7

Q ss_pred             EeecCCCCCCceeeEE
Q psy15026          6 IQQNGKNASGQTHYLS   21 (98)
Q Consensus         6 i~q~g~nss~~~~yls   21 (98)
                      +..+|++++|+..|+-
T Consensus        17 v~k~G~~~~G~qryrC   32 (36)
T PF03811_consen   17 VKKNGKSPSGHQRYRC   32 (36)
T ss_pred             ceeCCCCCCCCEeEec
Confidence            5689999999988974


No 8  
>smart00712 PUR DNA/RNA-binding repeats in PUR-alpha/beta/gamma and in hypothetical proteins from spirochetes and the Bacteroides-Cytophaga-Flexibacter bacteria.
Probab=34.82  E-value=32  Score=22.12  Aligned_cols=24  Identities=21%  Similarity=0.275  Sum_probs=15.0

Q ss_pred             eeEEEeecCCCCCCceeeEEeece
Q psy15026          2 RHVRIQQNGKNASGQTHYLSLSGF   25 (98)
Q Consensus         2 r~~ri~q~g~nss~~~~yls~sgf   25 (98)
                      +|+||...+++...++-+|..++|
T Consensus        25 ~fLrIsE~~~~~~r~~I~lp~~~~   48 (63)
T smart00712       25 RFLRISEVKNNGGRSSITVPEQGA   48 (63)
T ss_pred             cEEEEEEecCCCCceEEEEEHHHH
Confidence            567777777776555555555444


No 9  
>TIGR00739 yajC preprotein translocase, YajC subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas.
Probab=33.26  E-value=47  Score=22.16  Aligned_cols=20  Identities=20%  Similarity=0.257  Sum_probs=15.1

Q ss_pred             hhHHHHhhhhccccceEeeC
Q psy15026         54 RLVRTQVMRHLIIGARVQRG   73 (98)
Q Consensus        54 ~~~r~~~~~~i~~G~RVvRG   73 (98)
                      ++.+.++...|.+|.+|+-.
T Consensus        28 ~k~~~~m~~~L~~Gd~VvT~   47 (84)
T TIGR00739        28 RKAHKKLIESLKKGDKVLTI   47 (84)
T ss_pred             HHHHHHHHHhCCCCCEEEEC
Confidence            33445677899999999864


No 10 
>PF00488 MutS_V:  MutS domain V C-terminus.;  InterPro: IPR000432 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication []. MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base []. MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch []. MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level []. Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.  MutS is a modular protein with a complex structure [], and is composed of:   N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.   The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair. Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein [].This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions []. Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts [].  This entry represents the C-terminal domain found in proteins in the MutS family of DNA mismatch repair proteins. The C-terminal region of MutS is comprised of the ATPase domain and the HTH (helix-turn-helix) domain, the latter being involved in dimer contacts. Yeast MSH3 [], bacterial proteins involved in DNA mismatch repair, and the predicted protein product of the Rep-3 gene of mouse share extensive sequence similarity. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. ; GO: 0005524 ATP binding, 0030983 mismatched DNA binding, 0006298 mismatch repair; PDB: 1FW6_A 1EWQ_A 1EWR_B 1NNE_B 2WTU_A 1OH7_A 1OH5_B 1W7A_B 1NG9_A 1OH8_B ....
Probab=30.59  E-value=12  Score=28.62  Aligned_cols=16  Identities=31%  Similarity=0.520  Sum_probs=13.0

Q ss_pred             eecCCCCCCceeeEEe
Q psy15026          7 QQNGKNASGQTHYLSL   22 (98)
Q Consensus         7 ~q~g~nss~~~~yls~   22 (98)
                      .-+|+|++|+|.||.-
T Consensus        47 iiTGpN~sGKSt~lk~   62 (235)
T PF00488_consen   47 IITGPNMSGKSTFLKQ   62 (235)
T ss_dssp             EEESSTTSSHHHHHHH
T ss_pred             EEeCCCccchhhHHHH
Confidence            4589999999988753


No 11 
>PF05986 ADAM_spacer1:  ADAM-TS Spacer 1;  InterPro: IPR010294 This domain represents the Spacer-1 domain from the ADAM-TS family of metalloproteinases []. A cellular disintegrin and metalloproteinase (ADAM) is a family of genes with structural homology to the snake venom metalloproteinases and disintegrins []. There is variation amongst members of the family, however, all have a similar domain organisation comprising a preproregion, a reprolysin-type catalytic domain, a disintegrin-like domain, a thrombospondin type-1 (TS) module, a cysteine-rich domain, a spacer domain without cysteine residues, and a COOH-terminal TS module [, ]. They are involved in embryogenesis and have been implicated in some cancers and inflammatory diseases [].; GO: 0004222 metalloendopeptidase activity, 0031012 extracellular matrix
Probab=28.53  E-value=61  Score=22.16  Aligned_cols=19  Identities=32%  Similarity=0.679  Sum_probs=15.0

Q ss_pred             eeEEEeecCCCCCCceeeEEeec
Q psy15026          2 RHVRIQQNGKNASGQTHYLSLSG   24 (98)
Q Consensus         2 r~~ri~q~g~nss~~~~yls~sg   24 (98)
                      |+++|.|.++..    |||.|..
T Consensus        27 ~nI~I~e~~~s~----n~Lalk~   45 (114)
T PF05986_consen   27 RNIRITERRPSS----NYLALKN   45 (114)
T ss_pred             eEEEEEEeecCc----cEEEEEe
Confidence            689999997665    7998874


No 12 
>PF06934 CTI:  Fatty acid cis/trans isomerase (CTI);  InterPro: IPR010706 This family consists of several fatty acid cis/trans isomerase proteins, which appear to be found exclusively in bacteria of the orders Vibrionales and Pseudomonadales. Cis/trans isomerase (CTI) catalyses the cis-trans isomerisation of esterified fatty acids in phospholipids, mainly cis-oleic acid (C(16:1,9)) and cis-vaccenic acid (C(18:1,11)), in response to solvents. The CTI protein has been shown to be involved in solvent resistance in Pseudomonas putida [].
Probab=27.76  E-value=11  Score=34.55  Aligned_cols=18  Identities=39%  Similarity=0.927  Sum_probs=15.7

Q ss_pred             eeeEEeeceEEEeccchh
Q psy15026         17 THYLSLSGFEIYGTLTGV   34 (98)
Q Consensus        17 ~~yls~sgfe~yg~v~~~   34 (98)
                      .|||-+-||.|||.|-.=
T Consensus       422 ihYlLVAgFDVyGNvgHQ  439 (694)
T PF06934_consen  422 IHYLLVAGFDVYGNVGHQ  439 (694)
T ss_pred             HHHHHhhcceeccChhHH
Confidence            599999999999998653


No 13 
>PF13752 DUF4165:  Domain of unknown function (DUF4165)
Probab=27.69  E-value=69  Score=23.60  Aligned_cols=18  Identities=28%  Similarity=0.401  Sum_probs=14.2

Q ss_pred             eeeEEeeceEEEeccchh
Q psy15026         17 THYLSLSGFEIYGTLTGV   34 (98)
Q Consensus        17 ~~yls~sgfe~yg~v~~~   34 (98)
                      +.=++.+|.|.||+..-+
T Consensus        71 d~~~s~~G~efYGk~ltl   88 (124)
T PF13752_consen   71 DRRISSNGKEFYGKELTL   88 (124)
T ss_pred             eeeEEeCCceeeeeEEEe
Confidence            445788999999987655


No 14 
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family.
Probab=27.14  E-value=19  Score=25.81  Aligned_cols=19  Identities=32%  Similarity=0.601  Sum_probs=15.6

Q ss_pred             EeecCCCCCCceeeEEeec
Q psy15026          6 IQQNGKNASGQTHYLSLSG   24 (98)
Q Consensus         6 i~q~g~nss~~~~yls~sg   24 (98)
                      +.-+|+|.+|+++||...|
T Consensus         2 ~~ltG~N~~GKst~l~~i~   20 (185)
T smart00534        2 VIITGPNMGGKSTYLRQVG   20 (185)
T ss_pred             EEEECCCCCcHHHHHHHHH
Confidence            3458999999999987766


No 15 
>PF14652 DUF4457:  Domain of unknown function (DUF4457)
Probab=26.90  E-value=38  Score=27.45  Aligned_cols=16  Identities=38%  Similarity=0.929  Sum_probs=14.2

Q ss_pred             CceeeEEeeceEEEec
Q psy15026         15 GQTHYLSLSGFEIYGT   30 (98)
Q Consensus        15 ~~~~yls~sgfe~yg~   30 (98)
                      |..||+-|+|+|+++.
T Consensus         9 G~~~~iGLTgie~~d~   24 (329)
T PF14652_consen    9 GDPHYIGLTGIEVLDK   24 (329)
T ss_pred             CCCCeEecceEEEEcC
Confidence            6779999999999975


No 16 
>PRK05585 yajC preprotein translocase subunit YajC; Validated
Probab=26.15  E-value=71  Score=22.28  Aligned_cols=18  Identities=17%  Similarity=0.265  Sum_probs=14.1

Q ss_pred             HHHHhhhhccccceEeeC
Q psy15026         56 VRTQVMRHLIIGARVQRG   73 (98)
Q Consensus        56 ~r~~~~~~i~~G~RVvRG   73 (98)
                      .+.++...|++|.+|+-.
T Consensus        45 ~~~~~~~~Lk~Gd~VvT~   62 (106)
T PRK05585         45 EHKKMLSSLAKGDEVVTN   62 (106)
T ss_pred             HHHHHHHhcCCCCEEEEC
Confidence            445667899999999853


No 17 
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=26.05  E-value=69  Score=22.87  Aligned_cols=28  Identities=14%  Similarity=0.106  Sum_probs=19.8

Q ss_pred             HHHHhhhhccccceEeeCCCCcccCCCCCCCCCCeeeee
Q psy15026         56 VRTQVMRHLIIGARVQRGLDWKWRDQDGIPPGEGNLKPI   94 (98)
Q Consensus        56 ~r~~~~~~i~~G~RVvRG~DWkW~dQDGg~g~~GtV~~~   94 (98)
                      -+..++.+|++|.+|+-.           .|-.|+|+++
T Consensus        29 e~~em~~sLk~GD~VvT~-----------GGi~G~V~~I   56 (113)
T PRK06531         29 ERQNQLNAIQKGDEVVTI-----------GGLYGTVDEV   56 (113)
T ss_pred             HHHHHHHhcCCCCEEEEC-----------CCcEEEEEEE
Confidence            445667899999999954           3456776543


No 18 
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, a
Probab=24.56  E-value=27  Score=25.20  Aligned_cols=19  Identities=37%  Similarity=0.466  Sum_probs=16.5

Q ss_pred             EeecCCCCCCceeeEEeec
Q psy15026          6 IQQNGKNASGQTHYLSLSG   24 (98)
Q Consensus         6 i~q~g~nss~~~~yls~sg   24 (98)
                      +.-+|+|.+|+|.+|..-|
T Consensus        31 ~~ltG~Ng~GKStll~~i~   49 (200)
T cd03280          31 LVITGPNAGGKTVTLKTLG   49 (200)
T ss_pred             EEEECCCCCChHHHHHHHH
Confidence            6778999999999998755


No 19 
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=24.50  E-value=73  Score=22.66  Aligned_cols=18  Identities=22%  Similarity=0.274  Sum_probs=14.1

Q ss_pred             HHHHhhhhccccceEeeC
Q psy15026         56 VRTQVMRHLIIGARVQRG   73 (98)
Q Consensus        56 ~r~~~~~~i~~G~RVvRG   73 (98)
                      -+.+++..|++|.+|+-.
T Consensus        31 ~~~~m~~~Lk~GD~VvT~   48 (109)
T PRK05886         31 ATIDLHESLQPGDRVHTT   48 (109)
T ss_pred             HHHHHHHhcCCCCEEEEC
Confidence            345667899999999864


No 20 
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport.  These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2).  No known transmembrane proteins or domains are associated with these proteins.
Probab=23.70  E-value=25  Score=24.58  Aligned_cols=20  Identities=30%  Similarity=0.456  Sum_probs=16.1

Q ss_pred             EeecCCCCCCceeeEEeece
Q psy15026          6 IQQNGKNASGQTHYLSLSGF   25 (98)
Q Consensus         6 i~q~g~nss~~~~yls~sgf   25 (98)
                      +..+|+|.||++++|..-+|
T Consensus        24 ~~i~G~NgsGKS~~l~~i~~   43 (162)
T cd03227          24 TIITGPNGSGKSTILDAIGL   43 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            56789999999999876443


No 21 
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion]
Probab=23.41  E-value=85  Score=21.90  Aligned_cols=30  Identities=13%  Similarity=0.079  Sum_probs=21.7

Q ss_pred             hhHHHHhhhhccccceEeeCCCCcccCCCCCCCCCCeeeee
Q psy15026         54 RLVRTQVMRHLIIGARVQRGLDWKWRDQDGIPPGEGNLKPI   94 (98)
Q Consensus        54 ~~~r~~~~~~i~~G~RVvRG~DWkW~dQDGg~g~~GtV~~~   94 (98)
                      ++-+..++.+|..|.+|+-.           .|-.|+|+.+
T Consensus        34 ~K~~~~ml~sL~kGD~VvT~-----------gGi~G~V~~v   63 (97)
T COG1862          34 MKEHQELLNSLKKGDEVVTI-----------GGIVGTVTKV   63 (97)
T ss_pred             HHHHHHHHHhccCCCEEEEc-----------CCeEEEEEEE
Confidence            44667778999999999964           3456777654


No 22 
>PF02699 YajC:  Preprotein translocase subunit;  InterPro: IPR003849 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins []. The translocase protein subunits are encoded on the bacterial chromosome.  The translocase itself comprises 7 proteins, including a chaperone (SecB), ATPase (SecA), an integral membrane complex (SecY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. Other cytoplasmic/periplasmic proteins play a part in preprotein translocase activity, namely YidC and YajC []. The latter is bound in a complex to SecD and SecF, and plays a part in stabilising and regulating secretion through the SecYEG integral membrane component via SecA [].  Homologues of the YajC gene have been found in a range of pathogenic and commensal microbes. Brucella abortis YajC- and SecD-like proteins were shown to stimulate a Th1 cell-mediated immune response in mice, and conferred protection when challenged with B.abortis []. Therefore, these proteins may have an antigenic role as well as a secretory one in virulent bacteria []. A number of previously uncharacterised "hypothetical" proteins also show similarity to E.coli YajC, suggesting that this family is wider than first thought [].  More recently, the precise interactions between the E.coli SecYEG complex, SecD, SecF, YajC and YidC have been studied []. Rather than acting individually, the four proteins form a heterotetrameric complex and associate with the SecYEG heterotrimeric complex []. The SecF and YajC subunits link the complex to the integral membrane translocase. ; PDB: 2RDD_B.
Probab=23.24  E-value=48  Score=21.82  Aligned_cols=19  Identities=16%  Similarity=0.197  Sum_probs=5.2

Q ss_pred             hhHHHHhhhhccccceEee
Q psy15026         54 RLVRTQVMRHLIIGARVQR   72 (98)
Q Consensus        54 ~~~r~~~~~~i~~G~RVvR   72 (98)
                      ++.+.++...|.+|++|+-
T Consensus        27 ~k~~~~m~~~Lk~Gd~VvT   45 (82)
T PF02699_consen   27 QKEHQEMLASLKPGDEVVT   45 (82)
T ss_dssp             HHHHTTGGG----------
T ss_pred             HHHHHHHHHcCCCCCEEEE
Confidence            3345566789999999985


No 23 
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clam
Probab=22.46  E-value=18  Score=27.03  Aligned_cols=19  Identities=26%  Similarity=0.506  Sum_probs=16.3

Q ss_pred             EeecCCCCCCceeeEEeec
Q psy15026          6 IQQNGKNASGQTHYLSLSG   24 (98)
Q Consensus         6 i~q~g~nss~~~~yls~sg   24 (98)
                      +...|+|.+|+|+||...|
T Consensus        33 ~~l~Gpn~sGKstllr~i~   51 (216)
T cd03284          33 LLITGPNMAGKSTYLRQVA   51 (216)
T ss_pred             EEEECCCCCChHHHHHHHH
Confidence            5678999999999998764


No 24 
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=21.97  E-value=33  Score=24.72  Aligned_cols=20  Identities=30%  Similarity=0.512  Sum_probs=16.9

Q ss_pred             EEeecCCCCCCceeeEEeec
Q psy15026          5 RIQQNGKNASGQTHYLSLSG   24 (98)
Q Consensus         5 ri~q~g~nss~~~~yls~sg   24 (98)
                      ++.-+|+|.+|+|.+|.+.+
T Consensus        31 ~~~l~G~Ng~GKStll~~i~   50 (202)
T cd03243          31 LLLITGPNMGGKSTYLRSIG   50 (202)
T ss_pred             EEEEECCCCCccHHHHHHHH
Confidence            56778999999999987665


No 25 
>KOG4660|consensus
Probab=21.44  E-value=34  Score=30.70  Aligned_cols=16  Identities=25%  Similarity=0.559  Sum_probs=12.9

Q ss_pred             eEEEeccchhhhhhhh
Q psy15026         25 FEIYGTLTGVCEDLGR   40 (98)
Q Consensus        25 fe~yg~v~~~~Ed~~k   40 (98)
                      ||.||+|.++.|.+.+
T Consensus        96 f~~yGeir~ir~t~~~  111 (549)
T KOG4660|consen   96 FGAYGEIREIRETPNK  111 (549)
T ss_pred             HHhhcchhhhhccccc
Confidence            8999999999775443


Done!