RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy15036
         (179 letters)



>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a).  The Rab27a
           subfamily consists of Rab27a and its highly homologous
           isoform, Rab27b. Unlike most Rab proteins whose
           functions remain poorly defined, Rab27a has many known
           functions. Rab27a has multiple effector proteins, and
           depending on which effector it binds, Rab27a has
           different functions as well as tissue distribution
           and/or cellular localization. Putative functions have
           been assigned to Rab27a when associated with the
           effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp,
           rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c,
           Noc2, JFC1, and Munc13-4. Rab27a has been associated
           with several human diseases, including hemophagocytic
           syndrome (Griscelli syndrome or GS), Hermansky-Pudlak
           syndrome, and choroidermia. In the case of GS, a rare,
           autosomal recessive disease, a Rab27a mutation is
           directly responsible for the disorder. When Rab27a is
           localized to the secretory granules of pancreatic beta
           cells, it is believed to mediate glucose-stimulated
           insulin secretion, making it a potential target for
           diabetes therapy. When bound to JFC1 in prostate cells,
           Rab27a is believed to regulate the exocytosis of
           prostate- specific markers. GTPase activating proteins
           (GAPs) interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which facilitate Rab recycling by masking
           C-terminal lipid binding and promoting cytosolic
           localization. Most Rab GTPases contain a lipid
           modification site at the C-terminus, with sequence
           motifs CC, CXC, or CCX. Lipid binding is essential for
           membrane attachment, a key feature of most Rab proteins.
           Due to the presence of truncated sequences in this CD,
           the lipid modification site is not available for
           annotation.
          Length = 180

 Score = 59.1 bits (143), Expect = 2e-11
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 13/79 (16%)

Query: 70  TVGIVFPAISVTY-SIGP-----RYFRFPLV-------SRFLSLTTGLYRGTMGFLLIFD 116
           TVGI F    V Y S GP     + FR  L         RF SLTT  +R  MGFLL+FD
Sbjct: 36  TVGIDFREKRVVYNSQGPDGTSGKAFRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFD 95

Query: 117 VTNENSFKDVEKWLLQIKV 135
           +T+E SF +V  W+ Q++ 
Sbjct: 96  LTSEQSFLNVRNWMSQLQA 114


>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases.  Rab GTPases are
           implicated in vesicle trafficking.
          Length = 164

 Score = 56.7 bits (138), Expect = 1e-10
 Identities = 18/39 (46%), Positives = 30/39 (76%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           RF S+T+  YRG +G LL++D+TN  SF+++E WL +++
Sbjct: 61  RFRSITSSYYRGAVGALLVYDITNRESFENLENWLKELR 99


>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and
           Rab3D.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C,
           and Rab3D. All four isoforms were found in mouse brain
           and endocrine tissues, with varying levels of
           expression. Rab3A, Rab3B, and Rab3C localized to
           synaptic and secretory vesicles; Rab3D was expressed at
           high levels only in adipose tissue, exocrine glands, and
           the endocrine pituitary, where it is localized to
           cytoplasmic secretory granules. Rab3 appears to control
           Ca2+-regulated exocytosis. The appropriate GDP/GTP
           exchange cycle of Rab3A is required for Ca2+-regulated
           exocytosis to occur, and interaction of the GTP-bound
           form of Rab3A with effector molecule(s) is widely
           believed to be essential for this process. Functionally,
           most studies point toward a role for Rab3 in the
           secretion of hormones and neurotransmitters. GTPase
           activating proteins (GAPs) interact with GTP-bound Rab
           and accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 165

 Score = 56.5 bits (136), Expect = 2e-10
 Identities = 21/39 (53%), Positives = 29/39 (74%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           R+ ++TT  YRG MGF+L++D+TNE SF  V+ W  QIK
Sbjct: 62  RYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIK 100


>gnl|CDD|215692 pfam00071, Ras, Ras family.  Includes sub-families Ras, Rab, Rac,
           Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with
           GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025,
           pfam00063. As regards Rab GTPases, these are important
           regulators of vesicle formation, motility and fusion.
           They share a fold in common with all Ras GTPases: this
           is a six-stranded beta-sheet surrounded by five
           alpha-helices.
          Length = 162

 Score = 56.0 bits (136), Expect = 2e-10
 Identities = 19/39 (48%), Positives = 29/39 (74%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           RF +L    YRG  GFLL++D+T+ +SF++V+KWL +I 
Sbjct: 60  RFRALRPLYYRGAQGFLLVYDITSRDSFENVKKWLEEIL 98


>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine
           triphosphatases (GTPases).  Rab GTPases form the largest
           family within the Ras superfamily. There are at least 60
           Rab genes in the human genome, and a number of Rab
           GTPases are conserved from yeast to humans. Rab GTPases
           are small, monomeric proteins that function as molecular
           switches to regulate vesicle trafficking pathways. The
           different Rab GTPases are localized to the cytosolic
           face of specific intracellular membranes, where they
           regulate distinct steps in membrane traffic pathways. In
           the GTP-bound form, Rab GTPases recruit specific sets of
           effector proteins onto membranes. Through their
           effectors, Rab GTPases regulate vesicle formation,
           actin- and tubulin-dependent vesicle movement, and
           membrane fusion. GTPase activating proteins (GAPs)
           interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which mask C-terminal lipid binding and promote
           cytosolic localization. While most unicellular organisms
           possess 5-20 Rab members, several have been found to
           possess 60 or more Rabs; for many of these Rab isoforms,
           homologous proteins are not found in other organisms.
           Most Rab GTPases contain a lipid modification site at
           the C-terminus, with sequence motifs CC, CXC, or CCX.
           Lipid binding is essential for membrane attachment, a
           key feature of most Rab proteins. Since crystal
           structures often lack C-terminal residues, the lipid
           modification site is not available for annotation in
           many of the CDs in the hierarchy, but is included where
           possible.
          Length = 159

 Score = 55.2 bits (134), Expect = 4e-10
 Identities = 19/39 (48%), Positives = 30/39 (76%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           RF S+T+  YRG  G +L++DVTN  SF++++KWL ++K
Sbjct: 61  RFRSITSSYYRGAHGAILVYDVTNRESFENLDKWLNELK 99


>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13
           (Rab8, Rab10, Rab13).  Rab8/Sec4/Ypt2 are known or
           suspected to be involved in post-Golgi transport to the
           plasma membrane. It is likely that these Rabs have
           functions that are specific to the mammalian lineage and
           have no orthologs in plants. Rab8 modulates polarized
           membrane transport through reorganization of actin and
           microtubules, induces the formation of new surface
           extensions, and has an important role in directed
           membrane transport to cell surfaces. The Ypt2 gene of
           the fission yeast Schizosaccharomyces pombe encodes a
           member of the Ypt/Rab family of small GTP-binding
           proteins, related in sequence to Sec4p of Saccharomyces
           cerevisiae but closer to mammalian Rab8. GTPase
           activating proteins (GAPs) interact with GTP-bound Rab
           and accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 167

 Score = 54.6 bits (132), Expect = 7e-10
 Identities = 17/39 (43%), Positives = 29/39 (74%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           RF ++TT  YRG MG +L++D+T+E SF++++ W+  I 
Sbjct: 64  RFRTITTSYYRGAMGIILVYDITDEKSFENIKNWMRNID 102


>gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes
           Rab11a, Rab11b, and Rab25.  Rab11a, Rab11b, and Rab25
           are closely related, evolutionary conserved Rab proteins
           that are differentially expressed. Rab11a is
           ubiquitously synthesized, Rab11b is enriched in brain
           and heart and Rab25 is only found in epithelia. Rab11/25
           proteins seem to regulate recycling pathways from
           endosomes to the plasma membrane and to the trans-Golgi
           network. Furthermore, Rab11a is thought to function in
           the histamine-induced fusion of tubulovesicles
           containing H+, K+ ATPase with the plasma membrane in
           gastric parietal cells and in insulin-stimulated
           insertion of GLUT4 in the plasma membrane of
           cardiomyocytes. Overexpression of Rab25 has recently
           been observed in ovarian cancer and breast cancer, and
           has been correlated with worsened outcomes in both
           diseases. In addition, Rab25 overexpression has also
           been observed in prostate cancer, transitional cell
           carcinoma of the bladder, and invasive breast tumor
           cells. GTPase activating proteins (GAPs) interact with
           GTP-bound Rab and accelerate the hydrolysis of GTP to
           GDP. Guanine nucleotide exchange factors (GEFs) interact
           with GDP-bound Rabs to promote the formation of the
           GTP-bound state. Rabs are further regulated by guanine
           nucleotide dissociation inhibitors (GDIs), which
           facilitate Rab recycling by masking C-terminal lipid
           binding and promoting cytosolic localization. Most Rab
           GTPases contain a lipid modification site at the
           C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
           binding is essential for membrane attachment, a key
           feature of most Rab proteins. Due to the presence of
           truncated sequences in this CD, the lipid modification
           site is not available for annotation.
          Length = 165

 Score = 51.4 bits (124), Expect = 1e-08
 Identities = 15/39 (38%), Positives = 32/39 (82%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           R+ ++T+  YRG +G LL++D+T +++F++VE+WL +++
Sbjct: 64  RYRAITSAYYRGAVGALLVYDITKKSTFENVERWLKELR 102


>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35).  Rab35 is one of
           several Rab proteins to be found to participate in the
           regulation of osteoclast cells in rats. In addition,
           Rab35 has been identified as a protein that interacts
           with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK)
           in human cells. Overexpression of NPM-ALK is a key
           oncogenic event in some anaplastic large-cell lymphomas;
           since Rab35 interacts with N|PM-ALK, it may provide a
           target for cancer treatments. GTPase activating proteins
           (GAPs) interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which facilitate Rab recycling by masking
           C-terminal lipid binding and promoting cytosolic
           localization. Most Rab GTPases contain a lipid
           modification site at the C-terminus, with sequence
           motifs CC, CXC, or CCX. Lipid binding is essential for
           membrane attachment, a key feature of most Rab proteins.
          Length = 199

 Score = 48.3 bits (115), Expect = 2e-07
 Identities = 18/39 (46%), Positives = 30/39 (76%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           RF ++T+  YRGT G ++++DVTN  SF +V++WL +I+
Sbjct: 67  RFRTITSTYYRGTHGVIVVYDVTNGESFVNVKRWLQEIE 105


>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39).  Found in eukaryotes,
           Rab39 is mainly found in epithelial cell lines, but is
           distributed widely in various human tissues and cell
           lines. It is believed to be a novel Rab protein involved
           in regulating Golgi-associated vesicular transport
           during cellular endocytosis. GTPase activating proteins
           (GAPs) interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which facilitate Rab recycling by masking
           C-terminal lipid binding and promoting cytosolic
           localization. Most Rab GTPases contain a lipid
           modification site at the C-terminus, with sequence
           motifs CC, CXC, or CCX. Lipid binding is essential for
           membrane attachment, a key feature of most Rab proteins.
          Length = 211

 Score = 46.3 bits (110), Expect = 1e-06
 Identities = 18/40 (45%), Positives = 26/40 (65%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKV 135
           RF S+T   YR ++G LL+FD+TN  SF+ V  WL + + 
Sbjct: 64  RFRSITRSYYRNSVGVLLVFDITNRESFEHVHDWLEEARS 103


>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog
           Ypt1.  Rab1/Ypt1 subfamily. Rab1 is found in every
           eukaryote and is a key regulatory component for the
           transport of vesicles from the ER to the Golgi
           apparatus. Studies on mutations of Ypt1, the yeast
           homolog of Rab1, showed that this protein is necessary
           for the budding of vesicles of the ER as well as for
           their transport to, and fusion with, the Golgi
           apparatus. GTPase activating proteins (GAPs) interact
           with GTP-bound Rab and accelerate the hydrolysis of GTP
           to GDP. Guanine nucleotide exchange factors (GEFs)
           interact with GDP-bound Rabs to promote the formation of
           the GTP-bound state. Rabs are further regulated by
           guanine nucleotide dissociation inhibitors (GDIs), which
           facilitate Rab recycling by masking C-terminal lipid
           binding and promoting cytosolic localization. Most Rab
           GTPases contain a lipid modification site at the
           C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
           binding is essential for membrane attachment, a key
           feature of most Rab proteins. Due to the presence of
           truncated sequences in this CD, the lipid modification
           site is not available for annotation.
          Length = 166

 Score = 45.0 bits (107), Expect = 3e-06
 Identities = 16/38 (42%), Positives = 29/38 (76%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQI 133
           RF ++T+  YRG  G ++++DVT++ SF +V++WL +I
Sbjct: 63  RFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLQEI 100


>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4).  Rab4 subfamily. Rab4
           has been implicated in numerous functions within the
           cell. It helps regulate endocytosis through the sorting,
           recycling, and degradation of early endosomes. Mammalian
           Rab4 is involved in the regulation of many surface
           proteins including G-protein-coupled receptors,
           transferrin receptor, integrins, and surfactant protein
           A. Experimental data implicate Rab4 in regulation of the
           recycling of internalized receptors back to the plasma
           membrane. It is also believed to influence
           receptor-mediated antigen processing in B-lymphocytes,
           in calcium-dependent exocytosis in platelets, in
           alpha-amylase secretion in pancreatic cells, and in
           insulin-induced translocation of Glut4 from internal
           vesicles to the cell surface. Rab4 is known to share
           effector proteins with Rab5 and Rab11. GTPase activating
           proteins (GAPs) interact with GTP-bound Rab and
           accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 161

 Score = 44.3 bits (105), Expect = 3e-06
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWL 130
           RF S+T   YRG  G LL++D+T+  SF  +  WL
Sbjct: 61  RFRSVTRSYYRGAAGALLVYDITSRESFNALTNWL 95


>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional.
          Length = 216

 Score = 44.9 bits (106), Expect = 4e-06
 Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 7/56 (12%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFM 151
           R+ ++T+  YRG +G LL++D+T   +F +V++WL +++        H +  IV M
Sbjct: 73  RYRAITSAYYRGAVGALLVYDITKRQTFDNVQRWLRELR-------DHADSNIVIM 121


>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7).  Rab7 subfamily. Rab7 is
           a small Rab GTPase that regulates vesicular traffic from
           early to late endosomal stages of the endocytic pathway.
           The yeast Ypt7 and mammalian Rab7 are both involved in
           transport to the vacuole/lysosome, whereas Ypt7 is also
           required for homotypic vacuole fusion. Mammalian Rab7 is
           an essential participant in the autophagic pathway for
           sequestration and targeting of cytoplasmic components to
           the lytic compartment. Mammalian Rab7 is also proposed
           to function as a tumor suppressor. GTPase activating
           proteins (GAPs) interact with GTP-bound Rab and
           accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 172

 Score = 44.2 bits (105), Expect = 4e-06
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKW 129
           RF SL    YRG    +L++DVTN  SF+ ++ W
Sbjct: 61  RFQSLGVAFYRGADCCVLVYDVTNPKSFESLDSW 94


>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21).  The localization and
           function of Rab21 are not clearly defined, with
           conflicting data reported. Rab21 has been reported to
           localize in the ER in human intestinal epithelial cells,
           with partial colocalization with alpha-glucosidase, a
           late endosomal/lysosomal marker. More recently, Rab21
           was shown to colocalize with and affect the morphology
           of early endosomes. In Dictyostelium, GTP-bound Rab21,
           together with two novel LIM domain proteins, LimF and
           ChLim, has been shown to regulate phagocytosis. GTPase
           activating proteins (GAPs) interact with GTP-bound Rab
           and accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 162

 Score = 43.8 bits (104), Expect = 7e-06
 Identities = 16/43 (37%), Positives = 29/43 (67%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDG 138
           R+ +L    YR   G +L++D+T+ +SF+ V+KW+ ++K M G
Sbjct: 61  RYHALGPIYYRDADGAILVYDITDADSFQKVKKWIKELKQMRG 103


>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12).  Rab12 was first
           identified in canine cells, where it was localized to
           the Golgi complex. The specific function of Rab12
           remains unknown, and inconsistent results about its
           cellular localization have been reported. More recent
           studies have identified Rab12 associated with post-Golgi
           vesicles, or with other small vesicle-like structures
           but not with the Golgi complex. Most Rab GTPases contain
           a lipid modification site at the C-terminus, with
           sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. GTPase activating proteins (GAPs) interact
           with GTP-bound Rab and accelerate the hydrolysis of GTP
           to GDP. Guanine nucleotide exchange factors (GEFs)
           interact with GDP-bound Rabs to promote the formation of
           the GTP-bound state. Rabs are further regulated by
           guanine nucleotide dissociation inhibitors (GDIs), which
           facilitate Rab recycling by masking C-terminal lipid
           binding and promoting cytosolic localization. Most Rab
           GTPases contain a lipid modification site at the
           C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
           binding is essential for membrane attachment, a key
           feature of most Rab proteins.
          Length = 202

 Score = 43.8 bits (103), Expect = 8e-06
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQI 133
           RF S+T+  YR   G +L++D+T + +F D+ KW+  I
Sbjct: 61  RFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMI 98


>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18).  Rab18 subfamily.
           Mammalian Rab18 is implicated in endocytic transport and
           is expressed most highly in polarized epithelial cells.
           However, trypanosomal Rab, TbRAB18, is upregulated in
           the BSF (Blood Stream Form) stage and localized
           predominantly to elements of the Golgi complex. In human
           and mouse cells, Rab18 has been identified in lipid
           droplets, organelles that store neutral lipids. GTPase
           activating proteins (GAPs) interact with GTP-bound Rab
           and accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 161

 Score = 42.3 bits (100), Expect = 2e-05
 Identities = 15/40 (37%), Positives = 27/40 (67%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKV 135
           RF +LT+  YRG  G +L++DVT  ++F +++ WL ++  
Sbjct: 61  RFRTLTSSYYRGAQGVILVYDVTRRDTFDNLDTWLNELDT 100


>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26).  Rab26 subfamily.
           First identified in rat pancreatic acinar cells, Rab26
           is believed to play a role in recruiting mature granules
           to the plasma membrane upon beta-adrenergic stimulation.
           Rab26 belongs to the Rab functional group III, which are
           considered key regulators of intracellular vesicle
           transport during exocytosis. GTPase activating proteins
           (GAPs) interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which facilitate Rab recycling by masking
           C-terminal lipid binding and promoting cytosolic
           localization. Most Rab GTPases contain a lipid
           modification site at the C-terminus, with sequence
           motifs CC, CXC, or CCX. Lipid binding is essential for
           membrane attachment, a key feature of most Rab proteins.
          Length = 191

 Score = 41.4 bits (97), Expect = 6e-05
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQI 133
           RF S+T   YR     LL++DVTN++SF ++  WL +I
Sbjct: 62  RFRSVTHAYYRDAHALLLLYDVTNKSSFDNIRAWLTEI 99


>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like).  RJLs are found
           in many protists and as chimeras with C-terminal DNAJ
           domains in deuterostome metazoa. They are not found in
           plants, fungi, and protostome metazoa, suggesting a
           horizontal gene transfer between protists and
           deuterostome metazoa. RJLs lack any known membrane
           targeting signal and contain a degenerate
           phosphate/magnesium-binding 3 (PM3) motif, suggesting an
           impaired ability to hydrolyze GTP. GTPase activating
           proteins (GAPs) interact with GTP-bound Rab and
           accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization.
          Length = 168

 Score = 40.0 bits (94), Expect = 1e-04
 Identities = 13/31 (41%), Positives = 22/31 (70%)

Query: 105 YRGTMGFLLIFDVTNENSFKDVEKWLLQIKV 135
           Y+ T G LL++DVT+  SF+ ++ WL ++K 
Sbjct: 70  YKDTQGVLLVYDVTDRQSFEALDSWLKEMKQ 100


>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28).  Rab28 subfamily.
           First identified in maize, Rab28 has been shown to be a
           late embryogenesis-abundant (Lea) protein that is
           regulated by the plant hormone abcisic acid (ABA). In
           Arabidopsis, Rab28 is expressed during embryo
           development and is generally restricted to provascular
           tissues in mature embryos. Unlike maize Rab28, it is not
           ABA-inducible. Characterization of the human Rab28
           homolog revealed two isoforms, which differ by a 95-base
           pair insertion, producing an alternative sequence for
           the 30 amino acids at the C-terminus. The two human
           isoforms are presumably the result of alternative
           splicing. Since they differ at the C-terminus but not in
           the GTP-binding region, they are predicted to be
           targeted to different cellular locations. GTPase
           activating proteins (GAPs) interact with GTP-bound Rab
           and accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins.
          Length = 213

 Score = 38.6 bits (90), Expect = 7e-04
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 107 GTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           G     L++D+TN  SF+++E WL  +K
Sbjct: 73  GAQAVCLVYDITNSQSFENLEDWLSVVK 100


>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2).  Rab2 is localized on
           cis-Golgi membranes and interacts with Golgi matrix
           proteins. Rab2 is also implicated in the maturation of
           vesicular tubular clusters (VTCs), which are
           microtubule-associated intermediates in transport
           between the ER and Golgi apparatus. In plants, Rab2
           regulates vesicle trafficking between the ER and the
           Golgi bodies and is important to pollen tube growth.
           GTPase activating proteins (GAPs) interact with
           GTP-bound Rab and accelerate the hydrolysis of GTP to
           GDP. Guanine nucleotide exchange factors (GEFs) interact
           with GDP-bound Rabs to promote the formation of the
           GTP-bound state. Rabs are further regulated by guanine
           nucleotide dissociation inhibitors (GDIs), which
           facilitate Rab recycling by masking C-terminal lipid
           binding and promoting cytosolic localization. Most Rab
           GTPases contain a lipid modification site at the
           C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
           binding is essential for membrane attachment, a key
           feature of most Rab proteins. Due to the presence of
           truncated sequences in this CD, the lipid modification
           site is not available for annotation.
          Length = 168

 Score = 38.2 bits (89), Expect = 7e-04
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 97  FLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWL 130
           F S+T   YRG  G LL++D+T   +F  +  WL
Sbjct: 66  FRSITRSYYRGAAGALLVYDITRRETFNHLTSWL 99


>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14).  Rab14 GTPases are
           localized to biosynthetic compartments, including the
           rough ER, the Golgi complex, and the trans-Golgi
           network, and to endosomal compartments, including early
           endosomal vacuoles and associated vesicles. Rab14 is
           believed to function in both the biosynthetic and
           recycling pathways between the Golgi and endosomal
           compartments. Rab14 has also been identified on GLUT4
           vesicles, and has been suggested to help regulate GLUT4
           translocation. In addition, Rab14 is believed to play a
           role in the regulation of phagocytosis. GTPase
           activating proteins (GAPs) interact with GTP-bound Rab
           and accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 166

 Score = 37.9 bits (88), Expect = 8e-04
 Identities = 12/35 (34%), Positives = 22/35 (62%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWL 130
           RF ++T   YRG  G L+++D+T  +++  +  WL
Sbjct: 63  RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWL 97


>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32
           (Rab32).  Rab38/Rab32 subfamily. Rab32 and Rab38 are
           members of the Rab family of small GTPases. Human Rab32
           was first identified in platelets but it is expressed in
           a variety of cell types, where it functions as an
           A-kinase anchoring protein (AKAP). Rab38 has been shown
           to be melanocyte-specific. GTPase activating proteins
           (GAPs) interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which facilitate Rab recycling by masking
           C-terminal lipid binding and promoting cytosolic
           localization. Most Rab GTPases contain a lipid
           modification site at the C-terminus, with sequence
           motifs CC, CXC, or CCX. Lipid binding is essential for
           membrane attachment, a key feature of most Rab proteins.
          Length = 201

 Score = 37.7 bits (88), Expect = 0.001
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKW 129
           RF  +T   Y+G +G +++FDVT  ++F+ V KW
Sbjct: 62  RFGGMTRVYYKGAVGAIIVFDVTRPSTFEAVLKW 95


>gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a,
           Rab40b and Rab40c.  The Rab40 subfamily contains Rab40a,
           Rab40b, and Rab40c, which are all highly homologous. In
           rat, Rab40c is localized to the perinuclear recycling
           compartment (PRC), and is distributed in a
           tissue-specific manor, with high expression in brain,
           heart, kidney, and testis, low expression in lung and
           liver, and no expression in spleen and skeletal muscle.
           Rab40c is highly expressed in differentiated
           oligodendrocytes but minimally expressed in
           oligodendrocyte progenitors, suggesting a role in the
           vesicular transport of myelin components. Unlike most
           other Ras-superfamily proteins, Rab40c was shown to have
           a much lower affinity for GTP, and an affinity for GDP
           that is lower than for GTP. GTPase activating proteins
           (GAPs) interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which facilitate Rab recycling by masking
           C-terminal lipid binding and promoting cytosolic
           localization. Most Rab GTPases contain a lipid
           modification site at the C-terminus, with sequence
           motifs CC, CXC, or CCX. Lipid binding is essential for
           membrane attachment, a key feature of most Rab proteins.
          Length = 189

 Score = 37.2 bits (86), Expect = 0.002
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQI 133
           RF ++     RG  G +L++D+TN  SF  +++W+ +I
Sbjct: 67  RFCTIFRSYSRGAQGIILVYDITNRWSFDGIDRWIKEI 104


>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional.
          Length = 210

 Score = 37.2 bits (86), Expect = 0.002
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 3/67 (4%)

Query: 67  HGKTVGIVFPAISVTYSIGPRYFRFPLVS---RFLSLTTGLYRGTMGFLLIFDVTNENSF 123
           H  T+G+ F A  +T    P   +    +    F S+T   YRG  G LL++D+T   +F
Sbjct: 35  HDLTIGVEFGARMITIDNKPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETF 94

Query: 124 KDVEKWL 130
             +  WL
Sbjct: 95  NHLASWL 101


>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and
           Rab22; regulates early endosome fusion.  The
           Rab5-related subfamily includes Rab5 and Rab22 of
           mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants.
           The members of this subfamily are involved in
           endocytosis and endocytic-sorting pathways. In mammals,
           Rab5 GTPases localize to early endosomes and regulate
           fusion of clathrin-coated vesicles to early endosomes
           and fusion between early endosomes. In yeast, Ypt51p
           family members similarly regulate membrane trafficking
           through prevacuolar compartments. GTPase activating
           proteins (GAPs) interact with GTP-bound Rab and
           accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 163

 Score = 36.8 bits (86), Expect = 0.002
 Identities = 12/39 (30%), Positives = 25/39 (64%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           R+ SL    YRG    ++++D+T+E SF+  + W+ +++
Sbjct: 62  RYRSLAPMYYRGAAAAIVVYDITSEESFEKAKSWVKELQ 100


>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional.
          Length = 176

 Score = 36.6 bits (84), Expect = 0.003
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 7/69 (10%)

Query: 70  TVGIVFPAISVTYSIGPRYFRFPL-----VSRFLSLTTGLYRGTMGFLLIFDVTNENSFK 124
           T+GI F + ++    GP   R  L       RF SL     R +   ++++D+TN  SF+
Sbjct: 12  TIGIDFLSKTLYLDEGP--VRLQLWDTAGQERFRSLIPSYIRDSAAAIVVYDITNRQSFE 69

Query: 125 DVEKWLLQI 133
           +  KW+  I
Sbjct: 70  NTTKWIQDI 78


>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General
           function prediction only].
          Length = 219

 Score = 36.9 bits (85), Expect = 0.003
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 8/71 (11%)

Query: 70  TVGIVFPAISVTYSIGPRYFRFPLV-----SRFLSLTTGLYRGTMGFLLIFDVTNENSFK 124
           T+G + PA   T     R  +  L        + SL    YRG  G L+++D T   S  
Sbjct: 37  TIGNLDPA--KTIEPYRRNIKLQLWDTAGQEEYRSLRPEYYRGANGILIVYDSTLRESSD 94

Query: 125 DV-EKWLLQIK 134
           ++ E+WL +++
Sbjct: 95  ELTEEWLEELR 105


>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30).  Rab30 subfamily.
           Rab30 appears to be associated with the Golgi stack. It
           is expressed in a wide variety of tissue types and in
           humans maps to chromosome 11. GTPase activating proteins
           (GAPs) interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which facilitate Rab recycling by masking
           C-terminal lipid binding and promoting cytosolic
           localization. Most Rab GTPases contain a lipid
           modification site at the C-terminus, with sequence
           motifs CC, CXC, or CCX. Lipid binding is essential for
           membrane attachment, a key feature of most Rab proteins.
           Due to the presence of truncated sequences in this CD,
           the lipid modification site is not available for
           annotation.
          Length = 169

 Score = 36.0 bits (83), Expect = 0.004
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           RF S+T   YR     +L +D+T E SF+ + +WL +I+
Sbjct: 68  RFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIE 106


>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional.
          Length = 211

 Score = 35.4 bits (81), Expect = 0.008
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDV 126
           RF +LT+  YR   G +L++DVT   +F ++
Sbjct: 74  RFRTLTSSYYRNAQGIILVYDVTRRETFTNL 104


>gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15).  Rab15 colocalizes
           with the transferrin receptor in early endosome
           compartments, but not with late endosomal markers. It
           codistributes with Rab4 and Rab5 on early/sorting
           endosomes, and with Rab11 on pericentriolar recycling
           endosomes. It is believed to function as an inhibitory
           GTPase that regulates distinct steps in early endocytic
           trafficking. GTPase activating proteins (GAPs) interact
           with GTP-bound Rab and accelerate the hydrolysis of GTP
           to GDP. Guanine nucleotide exchange factors (GEFs)
           interact with GDP-bound Rabs to promote the formation of
           the GTP-bound state. Rabs are further regulated by
           guanine nucleotide dissociation inhibitors (GDIs), which
           facilitate Rab recycling by masking C-terminal lipid
           binding and promoting cytosolic localization. Most Rab
           GTPases contain a lipid modification site at the
           C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
           binding is essential for membrane attachment, a key
           feature of most Rab proteins. Due to the presence of
           truncated sequences in this CD, the lipid modification
           site is not available for annotation.
          Length = 164

 Score = 35.0 bits (80), Expect = 0.008
 Identities = 11/34 (32%), Positives = 22/34 (64%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKW 129
           R+ ++T   YR   G  L++D+++E S++ + KW
Sbjct: 61  RYQTITKQYYRRAQGIFLVYDISSERSYQHIMKW 94


>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19).  Rab19 subfamily.
           Rab19 proteins are associated with Golgi stacks.
           Similarity analysis indicated that Rab41 is closely
           related to Rab19. However, the function of these Rabs is
           not yet characterized. GTPase activating proteins (GAPs)
           interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which facilitate Rab recycling by masking
           C-terminal lipid binding and promoting cytosolic
           localization. Most Rab GTPases contain a lipid
           modification site at the C-terminus, with sequence
           motifs CC, CXC, or CCX. Lipid binding is essential for
           membrane attachment, a key feature of most Rab proteins.
           Due to the presence of truncated sequences in this CD,
           the lipid modification site is not available for
           annotation.
          Length = 165

 Score = 33.9 bits (78), Expect = 0.017
 Identities = 12/39 (30%), Positives = 24/39 (61%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           RF ++T   YR   G ++ +D+T  +SF+ V  W+ +++
Sbjct: 64  RFRTITQSYYRSANGAIIAYDITRRSSFESVPHWIEEVE 102


>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine
           triphosphatases (GTPases).  The Ras family of the Ras
           superfamily includes classical N-Ras, H-Ras, and K-Ras,
           as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG,
           Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.
           Ras proteins regulate cell growth, proliferation and
           differentiation. Ras is activated by guanine nucleotide
           exchange factors (GEFs) that release GDP and allow GTP
           binding. Many RasGEFs have been identified. These are
           sequestered in the cytosol until activation by growth
           factors triggers recruitment to the plasma membrane or
           Golgi, where the GEF colocalizes with Ras. Active
           GTP-bound Ras interacts with several effector proteins:
           among the best characterized are the Raf kinases,
           phosphatidylinositol 3-kinase (PI3K), RalGEFs and
           NORE/MST1. Most Ras proteins contain a lipid
           modification site at the C-terminus, with a typical
           sequence motif CaaX, where a = an aliphatic amino acid
           and X = any amino acid. Lipid binding is essential for
           membrane attachment, a key feature of most Ras proteins.
           Due to the presence of truncated sequences in this CD,
           the lipid modification site is not available for
           annotation.
          Length = 160

 Score = 33.3 bits (77), Expect = 0.033
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQI 133
            F ++     R   GF+L++ +T+  SF++++    QI
Sbjct: 59  EFSAMRDQYIRNGDGFILVYSITSRESFEEIKNIREQI 96


>gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3.  The
           M-Ras/R-Ras-like subfamily contains R-Ras2/TC21,
           M-Ras/R-Ras3, and related members of the Ras family.
           M-Ras is expressed in lympho-hematopoetic cells. It
           interacts with some of the known Ras effectors, but
           appears to also have its own effectors. Expression of
           mutated M-Ras leads to transformation of several types
           of cell lines, including hematopoietic cells, mammary
           epithelial cells, and fibroblasts. Overexpression of
           M-Ras is observed in carcinomas from breast, uterus,
           thyroid, stomach, colon, kidney, lung, and rectum. In
           addition, expression of a constitutively active M-Ras
           mutant in murine bone marrow induces a malignant mast
           cell leukemia that is distinct from the monocytic
           leukemia induced by H-Ras. TC21, along with H-Ras, has
           been shown to regulate the branching morphogenesis of
           ureteric bud cell branching in mice. Most Ras proteins
           contain a lipid modification site at the C-terminus,
           with a typical sequence motif CaaX, where a = an
           aliphatic amino acid and X = any amino acid. Lipid
           binding is essential for membrane attachment, a key
           feature of most Ras proteins. Due to the presence of
           truncated sequences in this CD, the lipid modification
           site is not available for annotation.
          Length = 164

 Score = 32.4 bits (74), Expect = 0.060
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 106 RGTMGFLLIFDVTNENSFKDVEKWLLQI 133
           R   GFLL+F VT+  SF++V+K+  QI
Sbjct: 72  RTGEGFLLVFSVTDRGSFEEVDKFHTQI 99


>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6).  Rab6 is involved in
           microtubule-dependent transport pathways through the
           Golgi and from endosomes to the Golgi. Rab6A of mammals
           is implicated in retrograde transport through the Golgi
           stack, and is also required for a slow,
           COPI-independent, retrograde transport pathway from the
           Golgi to the endoplasmic reticulum (ER). This pathway
           may allow Golgi residents to be recycled through the ER
           for scrutiny by ER quality-control systems. Yeast Ypt6p,
           the homolog of the mammalian Rab6 GTPase, is not
           essential for cell viability. Ypt6p acts in
           endosome-to-Golgi, in intra-Golgi retrograde transport,
           and possibly also in Golgi-to-ER trafficking. GTPase
           activating proteins (GAPs) interact with GTP-bound Rab
           and accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 161

 Score = 32.2 bits (74), Expect = 0.063
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKW 129
           RF SL     R +   ++++D+TN  SF + +KW
Sbjct: 61  RFRSLIPSYIRDSSVAVVVYDITNRQSFDNTDKW 94


>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of
           small guanosine triphosphatases (GTPases).  Ras-like
           GTPase superfamily. The Ras-like superfamily of small
           GTPases consists of several families with an extremely
           high degree of structural and functional similarity. The
           Ras superfamily is divided into at least four families
           in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.
           This superfamily also includes proteins like the GTP
           translation factors, Era-like GTPases, and G-alpha chain
           of the heterotrimeric G proteins. Members of the Ras
           superfamily regulate a wide variety of cellular
           functions: the Ras family regulates gene expression, the
           Rho family regulates cytoskeletal reorganization and
           gene expression, the Rab and Sar1/Arf families regulate
           vesicle trafficking, and the Ran family regulates
           nucleocytoplasmic transport and microtubule
           organization. The GTP translation factor family
           regulates initiation, elongation, termination, and
           release in translation, and the Era-like GTPase family
           regulates cell division, sporulation, and DNA
           replication. Members of the Ras superfamily are
           identified by the GTP binding site, which is made up of
           five characteristic sequence motifs, and the switch I
           and switch II regions.
          Length = 161

 Score = 32.4 bits (74), Expect = 0.065
 Identities = 16/80 (20%), Positives = 24/80 (30%), Gaps = 8/80 (10%)

Query: 66  THGKTVGIVFPAISVTYSIG-------PRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVT 118
             G T         +            P    F        L   L RG    LL+ D T
Sbjct: 28  VPGTTRDPDVYVKELDKGKVKLVLVDTPGLDEFG-GLGREELARLLLRGADLILLVVDST 86

Query: 119 NENSFKDVEKWLLQIKVMDG 138
           +  S +D +  +L+    +G
Sbjct: 87  DRESEEDAKLLILRRLRKEG 106


>gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras
           and K-Ras4A/4B.  H-Ras/N-Ras/K-Ras subfamily. H-Ras,
           N-Ras, and K-Ras4A/4B are the prototypical members of
           the Ras family. These isoforms generate distinct signal
           outputs despite interacting with a common set of
           activators and effectors, and are strongly associated
           with oncogenic progression in tumor initiation. Mutated
           versions of Ras that are insensitive to GAP stimulation
           (and are therefore constitutively active) are found in a
           significant fraction of human cancers. Many Ras guanine
           nucleotide exchange factors (GEFs) have been identified.
           They are sequestered in the cytosol until activation by
           growth factors triggers recruitment to the plasma
           membrane or Golgi, where the GEF colocalizes with Ras.
           Active (GTP-bound) Ras interacts with several effector
           proteins that stimulate a variety of diverse cytoplasmic
           signaling activities. Some are known to positively
           mediate the oncogenic properties of Ras, including Raf,
           phosphatidylinositol 3-kinase (PI3K), RalGEFs, and
           Tiam1. Others are proposed to play negative regulatory
           roles in oncogenesis, including RASSF and NORE/MST1.
           Most Ras proteins contain a lipid modification site at
           the C-terminus, with a typical sequence motif CaaX,
           where a = an aliphatic amino acid and X = any amino
           acid. Lipid binding is essential for membrane
           attachment, a key feature of most Ras proteins. Due to
           the presence of truncated sequences in this CD, the
           lipid modification site is not available for annotation.
          Length = 162

 Score = 32.4 bits (74), Expect = 0.068
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 110 GFLLIFDVTNENSFKDVEKWLLQIK 134
           GFL +F + +  SF+D+  +  QIK
Sbjct: 75  GFLCVFAINSRKSFEDIHTYREQIK 99


>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily;
           ill-defined subfamily.  SMART predicts Ras-like small
           GTPases of the ARF, RAB, RAN, RAS, and SAR subfamilies.
           Others that could not be classified in this way are
           predicted to be members of the small GTPase superfamily
           without predictions of the subfamily.
          Length = 166

 Score = 32.1 bits (74), Expect = 0.074
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 106 RGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDG 138
           R   GFLL++ +T+  SF+++ K+  QI  +  
Sbjct: 72  RTGEGFLLVYSITDRQSFEEIAKFREQILRVKD 104


>gnl|CDD|133324 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like2).  RabL2
           (Rab-like2) subfamily. RabL2s are novel Rab proteins
           identified recently which display features that are
           distinct from other Rabs, and have been termed Rab-like.
           RabL2 contains RabL2a and RabL2b, two very similar Rab
           proteins that share > 98% sequence identity in humans.
           RabL2b maps to the subtelomeric region of chromosome
           22q13.3 and RabL2a maps to 2q13, a region that suggests
           it is also a subtelomeric gene. Both genes are believed
           to be expressed ubiquitously, suggesting that RabL2s are
           the first example of duplicated genes in human proximal
           subtelomeric regions that are both expressed actively.
           Like other Rab-like proteins, RabL2s lack a prenylation
           site at the C-terminus. The specific functions of RabL2a
           and RabL2b remain unknown. GTPase activating proteins
           (GAPs) interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which facilitate Rab recycling by masking
           C-terminal lipid binding and promoting cytosolic
           localization.
          Length = 161

 Score = 32.1 bits (73), Expect = 0.081
 Identities = 11/39 (28%), Positives = 23/39 (58%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           RF ++    Y      +L+FDVT + ++K++ KW  +++
Sbjct: 61  RFQTMHASYYHKAHACILVFDVTRKITYKNLSKWYEELR 99


>gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9).  Rab9 is found in late
           endosomes, together with mannose 6-phosphate receptors
           (MPRs) and the tail-interacting protein of 47 kD
           (TIP47). Rab9 is a key mediator of vesicular transport
           from late endosomes to the trans-Golgi network (TGN) by
           redirecting the MPRs. Rab9 has been identified as a key
           component for the replication of several viruses,
           including HIV1, Ebola, Marburg, and measles, making it a
           potential target for inhibiting a variety of viruses.
           GTPase activating proteins (GAPs) interact with
           GTP-bound Rab and accelerate the hydrolysis of GTP to
           GDP. Guanine nucleotide exchange factors (GEFs) interact
           with GDP-bound Rabs to promote the formation of the
           GTP-bound state. Rabs are further regulated by guanine
           nucleotide dissociation inhibitors (GDIs), which
           facilitate Rab recycling by masking C-terminal lipid
           binding and promoting cytosolic localization. Most Rab
           GTPases contain a lipid modification site at the
           C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
           binding is essential for membrane attachment, a key
           feature of most Rab proteins. Due to the presence of
           truncated sequences in this CD, the lipid modification
           site is not available for annotation.
          Length = 170

 Score = 32.2 bits (73), Expect = 0.084
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKW 129
           RF SL T  YRG+   LL F V +  SF+++  W
Sbjct: 66  RFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNW 99


>gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like.  Rab23-like
           subfamily. Rab23 is a member of the Rab family of small
           GTPases. In mouse, Rab23 has been shown to function as a
           negative regulator in the sonic hedgehog (Shh) signaling
           pathway. Rab23 mediates the activity of Gli2 and Gli3,
           transcription factors that regulate Shh signaling in the
           spinal cord, primarily by preventing Gli2 activation in
           the absence of Shh ligand. Rab23 also regulates a step
           in the cytoplasmic signal transduction pathway that
           mediates the effect of Smoothened (one of two integral
           membrane proteins that are essential components of the
           Shh signaling pathway in vertebrates). In humans, Rab23
           is expressed in the retina. Mice contain an isoform that
           shares 93% sequence identity with the human Rab23 and an
           alternative splicing isoform that is specific to the
           brain. This isoform causes the murine open brain
           phenotype, indicating it may have a role in the
           development of the central nervous system. GTPase
           activating proteins (GAPs) interact with GTP-bound Rab
           and accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 162

 Score = 31.6 bits (72), Expect = 0.13
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 97  FLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKW 129
           F ++T   YRG    +L+F  T+  SF+ +E W
Sbjct: 64  FDAITKAYYRGAQACILVFSTTDRESFEAIESW 96


>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases.  Similar in
           fold and function to the bacterial EF-Tu GTPase. p21Ras
           couples receptor Tyr kinases and G protein receptors to
           protein kinase cascades.
          Length = 164

 Score = 31.4 bits (72), Expect = 0.15
 Identities = 11/29 (37%), Positives = 20/29 (68%)

Query: 106 RGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           R   GFLL++ +T+  SF++++K+  QI 
Sbjct: 70  RTGEGFLLVYSITDRQSFEEIKKFREQIL 98


>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine
           triphosphatases (GTPases).  Members of the Rho (Ras
           homology) family include RhoA, Cdc42, Rac, Rnd, Wrch1,
           RhoBTB, and Rop. There are 22 human Rho family members
           identified currently. These proteins are all involved in
           the reorganization of the actin cytoskeleton in response
           to external stimuli. They also have roles in cell
           transformation by Ras in cytokinesis, in focal adhesion
           formation and in the stimulation of stress-activated
           kinase. These various functions are controlled through
           distinct effector proteins and mediated through a
           GTP-binding/GTPase cycle involving three classes of
           regulating proteins: GAPs (GTPase-activating proteins),
           GEFs (guanine nucleotide exchange factors), and GDIs
           (guanine nucleotide dissociation inhibitors). Most Rho
           proteins contain a lipid modification site at the
           C-terminus, with a typical sequence motif CaaX, where a
           = an aliphatic amino acid and X = any amino acid. Lipid
           binding is essential for membrane attachment, a key
           feature of most Rho proteins. Since crystal structures
           often lack C-terminal residues, this feature is not
           available for annotation in many of the CDs in the
           hierarchy.
          Length = 171

 Score = 31.0 bits (71), Expect = 0.19
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 99  SLTTGLYRGTMGFLLIFDVTNENSFKDV-EKWLLQIK 134
            L    Y  T  FLL F V + +SF++V  KW  +IK
Sbjct: 63  RLRPLSYPQTDVFLLCFSVDSPSSFENVKTKWYPEIK 99


>gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4).  RabL4
           (Rab-like4) subfamily. RabL4s are novel proteins that
           have high sequence similarity with Rab family members,
           but display features that are distinct from Rabs, and
           have been termed Rab-like. As in other Rab-like
           proteins, RabL4 lacks a prenylation site at the
           C-terminus. The specific function of RabL4 remains
           unknown.
          Length = 167

 Score = 31.0 bits (70), Expect = 0.20
 Identities = 8/24 (33%), Positives = 17/24 (70%)

Query: 111 FLLIFDVTNENSFKDVEKWLLQIK 134
             +++DVTNE SF +  +W+ +++
Sbjct: 80  VCVVYDVTNEVSFNNCSRWINRVR 103


>gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small
           GTPases.  Members of this subfamily of Ras-like small
           GTPases include Cdc42 and Rac, as well as Rho isoforms.
          Length = 174

 Score = 31.0 bits (71), Expect = 0.21
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 105 YRGTMGFLLIFDVTNENSFKDV-EKWLLQIK 134
           Y  T  FL+ F V +  SF++V EKW  ++K
Sbjct: 67  YPDTDVFLICFSVDSPASFENVKEKWYPEVK 97


>gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional.
          Length = 215

 Score = 31.2 bits (71), Expect = 0.22
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKW 129
           +F  L  G Y      +++FDVT+  ++K+V  W
Sbjct: 70  KFGGLRDGYYIKGQCAIIMFDVTSRITYKNVPNW 103


>gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho
           family GTPase similar to Cdc42.  Wrch-1 (Wnt-1
           responsive Cdc42 homolog) is a Rho family GTPase that
           shares significant sequence and functional similarity
           with Cdc42. Wrch-1 was first identified in mouse mammary
           epithelial cells, where its transcription is upregulated
           in Wnt-1 transformation. Wrch-1 contains N- and
           C-terminal extensions relative to cdc42, suggesting
           potential differences in cellular localization and
           function. The Wrch-1 N-terminal extension contains
           putative SH3 domain-binding motifs and has been shown to
           bind the SH3 domain-containing protein Grb2, which
           increases the level of active Wrch-1 in cells. Unlike
           Cdc42, which localizes to the cytosol and perinuclear
           membranes, Wrch-1 localizes extensively with the plasma
           membrane and endosomes. The membrane association,
           localization, and biological activity of Wrch-1 indicate
           an atypical model of regulation distinct from other Rho
           family GTPases. Most Rho proteins contain a lipid
           modification site at the C-terminus, with a typical
           sequence motif CaaX, where a = an aliphatic amino acid
           and X = any amino acid. Lipid binding is essential for
           membrane attachment, a key feature of most Rho proteins.
           Due to the presence of truncated sequences in this CD,
           the lipid modification site is not available for
           annotation.
          Length = 173

 Score = 30.4 bits (69), Expect = 0.27
 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%)

Query: 105 YRGTMGFLLIFDVTNENSFKDV-EKWLLQIK 134
           Y  T  FLL F V N +SF+++ EKW+ +I+
Sbjct: 69  YPDTDVFLLCFSVVNPSSFQNISEKWIPEIR 99


>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase.  RSR1/Bud1p is a member of
           the Rap subfamily of the Ras family that is found in
           fungi. In budding yeasts, RSR1 is involved in selecting
           a site for bud growth on the cell cortex, which directs
           the establishment of cell polarization. The Rho family
           GTPase cdc42 and its GEF, cdc24, then establish an axis
           of polarized growth by organizing the actin cytoskeleton
           and secretory apparatus at the bud site. It is believed
           that cdc42 interacts directly with RSR1 in vivo. In
           filamentous fungi, polar growth occurs at the tips of
           hypha and at novel growth sites along the extending
           hypha. In Ashbya gossypii, RSR1 is a key regulator of
           hyphal growth, localizing at the tip region and
           regulating in apical polarization of the actin
           cytoskeleton. Most Ras proteins contain a lipid
           modification site at the C-terminus, with a typical
           sequence motif CaaX, where a = an aliphatic amino acid
           and X = any amino acid. Lipid binding is essential for
           membrane attachment, a key feature of most Ras proteins.
          Length = 168

 Score = 28.6 bits (64), Expect = 1.3
 Identities = 9/33 (27%), Positives = 18/33 (54%)

Query: 94  VSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDV 126
             +F ++     +   GFLL++ VT+E S  ++
Sbjct: 59  TEQFTAMRELYIKSGQGFLLVYSVTSEASLNEL 91


>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1.
            The Rap subfamily consists of the Rap1, Rap2, and RSR1.
           Rap subfamily proteins perform different cellular
           functions, depending on the isoform and its subcellular
           localization. For example, in rat salivary gland,
           neutrophils, and platelets, Rap1 localizes to secretory
           granules and is believed to regulate exocytosis or the
           formation of secretory granules. Rap1 has also been
           shown to localize in the Golgi of rat fibroblasts,
           zymogen granules, plasma membrane, and microsomal
           membrane of the pancreatic acini, as well as in the
           endocytic compartment of skeletal muscle cells and
           fibroblasts. Rap1 localizes in the nucleus of human
           oropharyngeal squamous cell carcinomas (SCCs) and cell
           lines. Rap1 plays a role in phagocytosis by controlling
           the binding of adhesion receptors (typically integrins)
           to their ligands. In yeast, Rap1 has been implicated in
           multiple functions, including activation and silencing
           of transcription and maintenance of telomeres. Rap2 is
           involved in multiple functions, including activation of
           c-Jun N-terminal kinase (JNK) to regulate the actin
           cytoskeleton and activation of the Wnt/beta-catenin
           signaling pathway in embryonic Xenopus. A number of
           effector proteins for Rap2 have been identified,
           including isoform 3 of the human mitogen-activated
           protein kinase kinase kinase kinase 4 (MAP4K4) and
           Traf2- and Nck-interacting kinase (TNIK), and the
           RalGEFs RalGDS, RGL, and Rlf, which also interact with
           Rap1 and Ras. RSR1 is the fungal homolog of Rap1 and
           Rap2. In budding yeasts, it is involved in selecting a
           site for bud growth, which directs the establishment of
           cell polarization. The Rho family GTPase Cdc42 and its
           GEF, Cdc24, then establish an axis of polarized growth.
           It is believed that Cdc42 interacts directly with RSR1
           in vivo. In filamentous fungi such as Ashbya gossypii,
           RSR1 is a key regulator of polar growth in the hypha.
           Most Ras proteins contain a lipid modification site at
           the C-terminus, with a typical sequence motif CaaX,
           where a = an aliphatic amino acid and X = any amino
           acid. Lipid binding is essential for membrane
           attachment, a key feature of most Ras proteins. Due to
           the presence of truncated sequences in this CD, the
           lipid modification site is not available for annotation.
          Length = 164

 Score = 28.3 bits (63), Expect = 1.5
 Identities = 9/25 (36%), Positives = 15/25 (60%)

Query: 109 MGFLLIFDVTNENSFKDVEKWLLQI 133
            GF L++ +T + SF D++    QI
Sbjct: 74  QGFALVYSITAQQSFNDLQDLREQI 98


>gnl|CDD|233264 TIGR01082, murC, UDP-N-acetylmuramate--alanine ligase.  This model
           describes the MurC protein in bacterial peptidoglycan
           (murein) biosynthesis. In a few species (Mycobacterium
           leprae, the Chlamydia), the amino acid may be L-serine
           or glycine instead of L-alanine. A related protein,
           UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-
           diaminopimelate ligase (murein tripeptide ligase) is
           described by model TIGR01081 [Cell envelope,
           Biosynthesis and degradation of murein sacculus and
           peptidoglycan].
          Length = 448

 Score = 28.8 bits (65), Expect = 1.5
 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 11/32 (34%)

Query: 50  RRGIPLLKHLKYLG-----------TGTHGKT 70
            RGIP+++  + L             GTHGKT
Sbjct: 80  ERGIPVIRRAEMLAELMRFRHSIAVAGTHGKT 111


>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36
           (Rab36).  Rab34/Rab36 subfamily. Rab34, found primarily
           in the Golgi, interacts with its effector,
           Rab-interacting lysosomal protein (RILP). This enables
           its participation in microtubular
           dynenin-dynactin-mediated repositioning of lysosomes
           from the cell periphery to the Golgi. A Rab34 (Rah)
           isoform that lacks the consensus GTP-binding region has
           been identified in mice. This isoform is associated with
           membrane ruffles and promotes macropinosome formation.
           Rab36 has been mapped to human chromosome 22q11.2, a
           region that is homozygously deleted in malignant
           rhabdoid tumors (MRTs). However, experimental
           assessments do not implicate Rab36 as a tumor suppressor
           that would enable tumor formation through a
           loss-of-function mechanism. GTPase activating proteins
           (GAPs) interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which facilitate Rab recycling by masking
           C-terminal lipid binding and promoting cytosolic
           localization. Most Rab GTPases contain a lipid
           modification site at the C-terminus, with sequence
           motifs CC, CXC, or CCX. Lipid binding is essential for
           membrane attachment, a key feature of most Rab proteins.
          Length = 170

 Score = 28.3 bits (63), Expect = 1.6
 Identities = 11/35 (31%), Positives = 20/35 (57%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWL 130
           RF  + +  YRG    +++FD+T+  S +   +WL
Sbjct: 61  RFKCIASTYYRGAQAIIIVFDLTDVASLEHTRQWL 95


>gnl|CDD|218779 pfam05853, DUF849, Prokaryotic protein of unknown function
           (DUF849).  This family consists of several hypothetical
           prokaryotic proteins with no known function.
          Length = 273

 Score = 28.6 bits (65), Expect = 1.7
 Identities = 15/72 (20%), Positives = 23/72 (31%), Gaps = 10/72 (13%)

Query: 107 GTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCRE--V 164
           G+M F    D+   N+  DVE        M        E +  F  G L       +  +
Sbjct: 110 GSMNFGAYRDMVFRNTPADVE-EFA--ARM-QEAGVKPEFEC-FDVGHLRNAAALLKRGL 164

Query: 165 VTPD---QIMFG 173
           +      Q + G
Sbjct: 165 LKGPLFVQFVLG 176


>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and
           activator of G-protein signaling 1 (Dexras1/AGS1).  This
           subfamily includes Rhes (Ras homolog enriched in
           striatum) and Dexras1/AGS1 (activator of G-protein
           signaling 1). These proteins are homologous, but exhibit
           significant differences in tissue distribution and
           subcellular localization. Rhes is found primarily in the
           striatum of the brain, but is also expressed in other
           areas of the brain, such as the cerebral cortex,
           hippocampus, inferior colliculus, and cerebellum. Rhes
           expression is controlled by thyroid hormones. In rat
           PC12 cells, Rhes is farnesylated and localizes to the
           plasma membrane. Rhes binds and activates PI3K, and
           plays a role in coupling serpentine membrane receptors
           with heterotrimeric G-protein signaling. Rhes has
           recently been shown to be reduced under conditions of
           dopamine supersensitivity and may play a role in
           determining dopamine receptor sensitivity. Dexras1/AGS1
           is a dexamethasone-induced Ras protein that is expressed
           primarily in the brain, with low expression levels in
           other tissues. Dexras1 localizes primarily to the
           cytoplasm, and is a critical regulator of the circadian
           master clock to photic and nonphotic input. Most Ras
           proteins contain a lipid modification site at the
           C-terminus, with a typical sequence motif CaaX, where a
           = an aliphatic amino acid and X = any amino acid. Lipid
           binding is essential for membrane attachment, a key
           feature of most Ras proteins.
          Length = 247

 Score = 28.6 bits (64), Expect = 1.8
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 91  FPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQI 133
           FP + R LS+ TG       F+L+F + N  SF++V +   QI
Sbjct: 61  FPAMRR-LSILTGDV-----FILVFSLDNRESFEEVCRLREQI 97


>gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional.
          Length = 189

 Score = 27.9 bits (62), Expect = 2.4
 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 106 RGTMGFLLIFDVTNENSFKDVEKWLLQI-KVMD 137
           R   GFL ++ +T+ +SF+++  +  QI +V D
Sbjct: 75  RTGQGFLCVYSITSRSSFEEIASFREQILRVKD 107


>gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine
           triphosphatases (GTPases)-like.  Rho4 is a GTPase that
           controls septum degradation by regulating secretion of
           Eng1 or Agn1 during cytokinesis. Rho4 also plays a role
           in cell morphogenesis. Rho4 regulates septation and cell
           morphology by controlling the actin cytoskeleton and
           cytoplasmic microtubules. The localization of Rho4 is
           modulated by Rdi1, which may function as a GDI, and by
           Rga9, which is believed to function as a GAP. In S.
           pombe, both Rho4 deletion and Rho4 overexpression result
           in a defective cell wall, suggesting a role for Rho4 in
           maintaining cell wall integrity. Most Rho proteins
           contain a lipid modification site at the C-terminus,
           with a typical sequence motif CaaX, where a = an
           aliphatic amino acid and X = any amino acid. Lipid
           binding is essential for membrane attachment, a key
           feature of most Rho proteins.
          Length = 197

 Score = 27.7 bits (62), Expect = 2.5
 Identities = 7/19 (36%), Positives = 11/19 (57%), Gaps = 1/19 (5%)

Query: 112 LLIFDVTNENSFKDV-EKW 129
           L+ + V N  S  +V +KW
Sbjct: 80  LICYSVDNPTSLDNVEDKW 98


>gnl|CDD|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase
           (GDH).  D-glycerate dehydrogenase (GDH, also known as
           hydroxypyruvate reductase, HPR) catalyzes the reversible
           reaction of (R)-glycerate + NAD+ to hydroxypyruvate +
           NADH + H+. In humans, HPR deficiency causes primary
           hyperoxaluria type 2, characterized by over-excretion of
           L-glycerate and oxalate in the urine, possibly due to an
           imbalance in competition with L-lactate dehydrogenase,
           another formate dehydrogenase (FDH)-like enzyme. GDH,
           like FDH and other members of the D-specific hydroxyacid
           dehydrogenase family that also includes L-alanine
           dehydrogenase and S-adenosylhomocysteine hydrolase,
           typically have a characteristic arrangement of 2 similar
           subdomains of the alpha/beta Rossmann-fold NAD+ binding
           form, despite often low sequence identity. The NAD+
           binding domain is inserted within the linear sequence of
           the mostly N-terminal catalytic domain, which has a
           similar domain structure to the internal NAD binding
           domain. Structurally, these domains are connected by
           extended alpha helices and create a cleft in which NAD
           is bound, primarily to the C-terminal portion of the 2nd
           (internal) domain. Some related proteins have similar
           structural subdomain but with a tandem arrangement of
           the catalytic and NAD-binding subdomains in the linear
           sequence. While many members of this family are dimeric,
           alanine DH is hexameric and phosphoglycerate DH is
           tetrameric.
          Length = 309

 Score = 27.7 bits (63), Expect = 2.9
 Identities = 10/14 (71%), Positives = 11/14 (78%)

Query: 61  YLGTGTHGKTVGIV 74
            LGT  HGKT+GIV
Sbjct: 137 LLGTDLHGKTLGIV 150


>gnl|CDD|223844 COG0773, MurC, UDP-N-acetylmuramate-alanine ligase [Cell envelope
           biogenesis, outer membrane].
          Length = 459

 Score = 27.5 bits (62), Expect = 3.7
 Identities = 11/32 (34%), Positives = 14/32 (43%), Gaps = 11/32 (34%)

Query: 50  RRGIPLLKHLKYLG-----------TGTHGKT 70
            RGIP++   + L             GTHGKT
Sbjct: 88  ERGIPVISRAEMLAELMRFRTSIAVAGTHGKT 119


>gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras
           GTPases.  RGK subfamily. The RGK (Rem, Rem2, Rad,
           Gem/Kir) subfamily of Ras GTPases are expressed in a
           tissue-specific manner and are dynamically regulated by
           transcriptional and posttranscriptional mechanisms in
           response to environmental cues. RGK proteins bind to the
           beta subunit of L-type calcium channels, causing
           functional down-regulation of these voltage-dependent
           calcium channels, and either termination of
           calcium-dependent secretion or modulation of electrical
           conduction and contractile function. Inhibition of
           L-type calcium channels by Rem2 may provide a mechanism
           for modulating calcium-triggered exocytosis in
           hormone-secreting cells, and has been proposed to
           influence the secretion of insulin in pancreatic beta
           cells. RGK proteins also interact with and inhibit the
           Rho/Rho kinase pathway to modulate remodeling of the
           cytoskeleton. Two characteristics of RGK proteins cited
           in the literature are N-terminal and C-terminal
           extensions beyond the GTPase domain typical of Ras
           superfamily members. The N-terminal extension is not
           conserved among family members; the C-terminal extension
           is reported to be conserved among the family and lack
           the CaaX prenylation motif typical of
           membrane-associated Ras proteins. However, a putative
           CaaX motif has been identified in the alignment of the
           C-terminal residues of this CD.
          Length = 219

 Score = 27.4 bits (61), Expect = 3.9
 Identities = 12/56 (21%), Positives = 26/56 (46%), Gaps = 7/56 (12%)

Query: 110 GFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQI-VFMRGCLELLQRCREV 164
            +++++ VT+ +SF+   +  +Q++             I + + G    L R REV
Sbjct: 75  AYVIVYSVTDRSSFEKASELRIQLRR------ARQAEDIPIILVGNKSDLVRSREV 124


>gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and
           Rab33B.  Rab33B/Rab33A subfamily. Rab33B is ubiquitously
           expressed in mouse tissues and cells, where it is
           localized to the medial Golgi cisternae. It colocalizes
           with alpha-mannose II. Together with the other cisternal
           Rabs, Rab6A and Rab6A', it is believed to regulate the
           Golgi response to stress and is likely a molecular
           target in stress-activated signaling pathways. Rab33A
           (previously known as S10) is expressed primarily in the
           brain and immune system cells. In humans, it is located
           on the X chromosome at Xq26 and its expression is
           down-regulated in tuberculosis patients. Experimental
           evidence suggests that Rab33A is a novel CD8+ T cell
           factor that likely plays a role in tuberculosis disease
           processes. GTPase activating proteins (GAPs) interact
           with GTP-bound Rab and accelerate the hydrolysis of GTP
           to GDP. Guanine nucleotide exchange factors (GEFs)
           interact with GDP-bound Rabs to promote the formation of
           the GTP-bound state. Rabs are further regulated by
           guanine nucleotide dissociation inhibitors (GDIs), which
           facilitate Rab recycling by masking C-terminal lipid
           binding and promoting cytosolic localization. Most Rab
           GTPases contain a lipid modification site at the
           C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
           binding is essential for membrane attachment, a key
           feature of most Rab proteins. Due to the presence of
           truncated sequences in this CD, the lipid modification
           site is not available for annotation.
          Length = 170

 Score = 27.0 bits (60), Expect = 4.1
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 105 YRGTMGFLLIFDVTNENSFKDVEKWL 130
           YR     + ++DVTN  SF  +  W+
Sbjct: 73  YRNVHAVVFVYDVTNMASFHSLPSWI 98


>gnl|CDD|226837 COG4403, LcnDR2, Lantibiotic modifying enzyme [Defense mechanisms].
          Length = 963

 Score = 27.4 bits (61), Expect = 4.7
 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 4/37 (10%)

Query: 100 LTTGLYRGTMGFLLIFD----VTNENSFKDVEKWLLQ 132
           L   LY G+ G  L F     VT ++ +K++    LQ
Sbjct: 641 LGNDLYDGSAGIALFFAYLALVTGKDYYKEIAIKALQ 677


>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly
           homologous RalA and RalB.  The Ral (Ras-like) subfamily
           consists of the highly homologous RalA and RalB. Ral
           proteins are believed to play a crucial role in
           tumorigenesis, metastasis, endocytosis, and actin
           cytoskeleton dynamics. Despite their high sequence
           similarity (>80% sequence identity), nonoverlapping and
           opposing functions have been assigned to RalA and RalBs
           in tumor migration. In human bladder and prostate cancer
           cells, RalB promotes migration while RalA inhibits it. A
           Ral-specific set of GEFs has been identified that are
           activated by Ras binding. This RalGEF activity is
           enhanced by Ras binding to another of its target
           proteins, phosphatidylinositol 3-kinase (PI3K). Ral
           effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and
           the exocyst (Sec6/8) complex, a heterooctomeric protein
           complex that is involved in tethering vesicles to
           specific sites on the plasma membrane prior to
           exocytosis. In rat kidney cells, RalB is required for
           functional assembly of the exocyst and for localizing
           the exocyst to the leading edge of migrating cells. In
           human cancer cells, RalA is required to support
           anchorage-independent proliferation and RalB is required
           to suppress apoptosis. RalA has been shown to localize
           to the plasma membrane while RalB is localized to the
           intracellular vesicles. Most Ras proteins contain a
           lipid modification site at the C-terminus, with a
           typical sequence motif CaaX, where a = an aliphatic
           amino acid and X = any amino acid. Lipid binding is
           essential for membrane attachment, a key feature of most
           Ras proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 163

 Score = 26.6 bits (59), Expect = 5.8
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 105 YRGTMGFLLIFDVTNENSFKDVEKWLLQI 133
           +R   GFLL+F +T+  SF  + ++  QI
Sbjct: 69  FRSGEGFLLVFSITDMESFTALAEFREQI 97


>gnl|CDD|206664 cd01874, Cdc42, cell division cycle 42 (Cdc42) is a small GTPase of
           the Rho family.  Cdc42 is an essential GTPase that
           belongs to the Rho family of Ras-like GTPases. These
           proteins act as molecular switches by responding to
           exogenous and/or endogenous signals and relaying those
           signals to activate downstream components of a
           biological pathway. Cdc42 transduces signals to the
           actin cytoskeleton to initiate and maintain polarized
           growth and to mitogen-activated protein morphogenesis.
           In the budding yeast Saccharomyces cerevisiae, Cdc42
           plays an important role in multiple actin-dependent
           morphogenetic events such as bud emergence,
           mating-projection formation, and pseudohyphal growth. In
           mammalian cells, Cdc42 regulates a variety of
           actin-dependent events and induces the JNK/SAPK protein
           kinase cascade, which leads to the activation of
           transcription factors within the nucleus. Cdc42 mediates
           these processes through interactions with a myriad of
           downstream effectors, whose number and regulation we are
           just starting to understand. In addition, Cdc42 has been
           implicated in a number of human diseases through
           interactions with its regulators and downstream
           effectors. Most Rho proteins contain a lipid
           modification site at the C-terminus, with a typical
           sequence motif CaaX, where a = an aliphatic amino acid
           and X = any amino acid. Lipid binding is essential for
           membrane attachment, a key feature of most Rho proteins.
           Due to the presence of truncated sequences in this CD,
           the lipid modification site is not available for
           annotation.
          Length = 175

 Score = 26.8 bits (59), Expect = 5.9
 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 105 YRGTMGFLLIFDVTNENSFKDV-EKWLLQIK 134
           Y  T  FL+ F V + +SF++V EKW+ +I 
Sbjct: 70  YPQTDVFLVCFSVVSPSSFENVKEKWVPEIT 100


>gnl|CDD|165398 PHA03126, PHA03126, dUTPase; Provisional.
          Length = 326

 Score = 26.5 bits (58), Expect = 7.8
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 2   FADLAIMFADSRPESTFWIFGKPT 25
           F DL I+FA S P  T  IFG+ +
Sbjct: 197 FVDLPIVFASSNPAVTPCIFGRSS 220


>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional.
          Length = 516

 Score = 26.7 bits (59), Expect = 8.2
 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 4/57 (7%)

Query: 68  GKTVGIVFPAISVTYSIGPRYFRFPLVSRFLSLTTG-LYRGTMGFLL---IFDVTNE 120
            +TV +  P  + TY   P      L + F +   G +Y   M  LL   IF+V  E
Sbjct: 65  DRTVVVKMPFTTYTYIADPVNVEHVLKTNFANYPKGEVYHSYMEVLLGDGIFNVDGE 121


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.329    0.142    0.438 

Gapped
Lambda     K      H
   0.267   0.0830    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 9,169,017
Number of extensions: 840112
Number of successful extensions: 997
Number of sequences better than 10.0: 1
Number of HSP's gapped: 996
Number of HSP's successfully gapped: 76
Length of query: 179
Length of database: 10,937,602
Length adjustment: 91
Effective length of query: 88
Effective length of database: 6,901,388
Effective search space: 607322144
Effective search space used: 607322144
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 56 (25.2 bits)