Query         psy15037
Match_columns 149
No_of_seqs    138 out of 323
Neff          4.4 
Searched_HMMs 29240
Date          Fri Aug 16 18:49:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15037.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/15037hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1wd2_A Ariadne-1 protein homol  99.3 4.3E-13 1.5E-17   89.7  -0.3   29  106-134     1-29  (60)
  2 2jmo_A Parkin; IBR, E3 ligase,  98.3 2.5E-07 8.6E-12   64.0   2.4   32    5-36     40-76  (80)
  3 2ct7_A Ring finger protein 31;  98.2 2.6E-07 8.9E-12   64.5   0.5   33    6-38     39-75  (86)
  4 1wd2_A Ariadne-1 protein homol  91.6   0.094 3.2E-06   34.3   2.2   27    3-29     17-45  (60)
  5 1iym_A EL5; ring-H2 finger, ub  81.6     0.6 2.1E-05   27.9   1.5   23    7-29     18-40  (55)
  6 1vq8_Z 50S ribosomal protein L  75.9     1.6 5.4E-05   30.4   2.4   31  108-138    24-54  (83)
  7 1x4j_A Ring finger protein 38;  74.1       2   7E-05   27.4   2.4   22  104-126    54-75  (75)
  8 1g25_A CDK-activating kinase a  71.4     2.3   8E-05   26.3   2.2   20  105-124    37-56  (65)
  9 2gmg_A Hypothetical protein PF  66.9     2.1 7.3E-05   31.3   1.4   11   10-20     67-77  (105)
 10 3lrq_A E3 ubiquitin-protein li  66.1    0.95 3.3E-05   31.0  -0.6   21    9-29     34-54  (100)
 11 2ecy_A TNF receptor-associated  65.5       3  0.0001   25.9   1.7   21  104-124    43-63  (66)
 12 2ct2_A Tripartite motif protei  65.1     1.8 6.2E-05   28.0   0.7   21  104-124    47-69  (88)
 13 2ecm_A Ring finger and CHY zin  62.9     2.3 7.8E-05   25.2   0.8   21    9-29     20-40  (55)
 14 2xeu_A Ring finger protein 4;   62.3     4.1 0.00014   24.5   1.9   20  104-124    38-57  (64)
 15 3ng2_A RNF4, snurf, ring finge  61.6     4.8 0.00016   24.9   2.2   20  104-124    45-64  (71)
 16 4ap4_A E3 ubiquitin ligase RNF  59.6     4.2 0.00014   27.8   1.8   21  104-125   107-127 (133)
 17 1z60_A TFIIH basal transcripti  58.2     2.7 9.1E-05   27.6   0.5   21   10-30     30-50  (59)
 18 1pft_A TFIIB, PFTFIIBN; N-term  54.9       9 0.00031   23.2   2.6   26  110-135     4-30  (50)
 19 2ea6_A Ring finger protein 4;   54.8     7.3 0.00025   23.7   2.2   19  104-123    50-68  (69)
 20 1t1h_A Gspef-atpub14, armadill  53.9     6.4 0.00022   25.0   1.8   20  104-123    36-55  (78)
 21 2djb_A Polycomb group ring fin  53.6     8.2 0.00028   24.3   2.3   20  104-124    44-63  (72)
 22 2csy_A Zinc finger protein 183  52.9     3.7 0.00013   26.5   0.5   15   15-29     32-46  (81)
 23 1p7a_A BF3, BKLF, kruppel-like  51.7     6.3 0.00022   20.5   1.3   17    7-23      8-24  (37)
 24 2kvh_A Zinc finger and BTB dom  50.5     5.8  0.0002   19.2   1.0   13   10-22      3-15  (27)
 25 2yur_A Retinoblastoma-binding   50.0     4.6 0.00016   25.8   0.6   16   14-29     32-47  (74)
 26 2m0d_A Zinc finger and BTB dom  48.7     6.1 0.00021   19.0   0.9   16    9-24      2-17  (30)
 27 2els_A Zinc finger protein 406  48.5     6.9 0.00023   20.3   1.1   17    7-23      6-22  (36)
 28 2kiz_A E3 ubiquitin-protein li  48.3     9.9 0.00034   23.5   2.0   19  104-123    45-63  (69)
 29 1chc_A Equine herpes virus-1 r  48.1      10 0.00034   23.3   2.0   17  105-122    35-51  (68)
 30 3ztg_A E3 ubiquitin-protein li  48.1     3.1 0.00011   27.4  -0.4   16   14-29     30-45  (92)
 31 2m0e_A Zinc finger and BTB dom  47.9     6.5 0.00022   18.7   0.9   14   10-23      2-15  (29)
 32 2elv_A Zinc finger protein 406  47.9      10 0.00035   19.5   1.8   18    6-23      5-22  (36)
 33 3lrq_A E3 ubiquitin-protein li  47.8     9.1 0.00031   25.9   1.9   20  104-123    51-70  (100)
 34 2elq_A Zinc finger protein 406  47.1       8 0.00027   20.0   1.3   17    7-23      6-22  (36)
 35 2ysj_A Tripartite motif-contai  47.0     2.6 8.8E-05   25.9  -0.9   15   15-29     37-51  (63)
 36 2elx_A Zinc finger protein 406  46.9     7.4 0.00025   19.7   1.1   18    7-24      4-21  (35)
 37 2elt_A Zinc finger protein 406  46.7     8.2 0.00028   19.8   1.3   17    7-23      6-22  (36)
 38 1jm7_B BARD1, BRCA1-associated  46.7     6.9 0.00024   27.1   1.2   20   15-34     40-59  (117)
 39 2ect_A Ring finger protein 126  46.6      10 0.00034   24.0   1.9   18  105-123    47-64  (78)
 40 3vk6_A E3 ubiquitin-protein li  46.6      11 0.00037   27.4   2.2   21  105-125    31-51  (101)
 41 1ard_A Yeast transcription fac  46.3     7.4 0.00025   18.7   1.0   12   11-22      3-14  (29)
 42 2egp_A Tripartite motif-contai  46.1     4.3 0.00015   25.6   0.0   15   15-29     29-43  (79)
 43 2ysl_A Tripartite motif-contai  45.9     6.5 0.00022   24.4   0.9   20  105-124    49-70  (73)
 44 2ep4_A Ring finger protein 24;  45.7      11 0.00039   23.5   2.0   18  104-122    46-63  (74)
 45 2kvf_A Zinc finger and BTB dom  45.6     7.5 0.00026   18.7   0.9   13   10-22      3-15  (28)
 46 2elp_A Zinc finger protein 406  45.4     8.1 0.00028   20.1   1.1   16    7-22      6-21  (37)
 47 2elm_A Zinc finger protein 406  45.3     7.8 0.00027   20.5   1.0   17    7-23      6-22  (37)
 48 1bor_A Transcription factor PM  44.9      11 0.00038   22.8   1.8   22   15-36     23-46  (56)
 49 2l0b_A E3 ubiquitin-protein li  44.8     2.6   9E-05   28.2  -1.2   15   15-29     60-74  (91)
 50 2ecj_A Tripartite motif-contai  44.6       3  0.0001   24.8  -0.9   14   15-28     32-45  (58)
 51 2ecw_A Tripartite motif-contai  43.5      14 0.00048   23.2   2.2   14  111-124    59-72  (85)
 52 1srk_A Zinc finger protein ZFP  42.6     9.6 0.00033   19.4   1.1   23    7-29      4-26  (35)
 53 1rik_A E6APC1 peptide; E6-bind  42.5     8.5 0.00029   18.5   0.8   14   10-23      2-15  (29)
 54 1paa_A Yeast transcription fac  42.3     9.2 0.00032   18.5   1.0   12   11-22      3-14  (30)
 55 2kvg_A Zinc finger and BTB dom  41.3     7.7 0.00026   18.9   0.6   13   10-22      3-15  (27)
 56 2elr_A Zinc finger protein 406  41.2      12 0.00042   19.1   1.4   17    7-23      6-22  (36)
 57 1klr_A Zinc finger Y-chromosom  41.1     9.7 0.00033   18.2   0.9   12   11-22      3-14  (30)
 58 2elo_A Zinc finger protein 406  41.0     8.6 0.00029   19.9   0.8   17    7-23      6-22  (37)
 59 3t7l_A Zinc finger FYVE domain  40.7     9.3 0.00032   26.1   1.1   18    9-26     35-52  (90)
 60 2lvu_A Zinc finger and BTB dom  46.8     5.8  0.0002   19.0   0.0   13   11-23      3-15  (26)
 61 2jun_A Midline-1; B-BOX, TRIM,  40.7       5 0.00017   27.0  -0.4   24    7-30     15-38  (101)
 62 2ecv_A Tripartite motif-contai  40.5       5 0.00017   25.4  -0.3   14   15-28     36-49  (85)
 63 2m0f_A Zinc finger and BTB dom  40.3     9.3 0.00032   18.2   0.8   12   11-22      3-14  (29)
 64 2y43_A E3 ubiquitin-protein li  40.0     4.6 0.00016   27.0  -0.6   20   11-30     36-55  (99)
 65 3u6p_A Formamidopyrimidine-DNA  39.4      10 0.00036   30.8   1.4   14  111-124   245-258 (273)
 66 2ytb_A Zinc finger protein 32;  39.2      12 0.00041   19.9   1.2   23    7-29      8-30  (42)
 67 3hct_A TNF receptor-associated  38.9      15 0.00051   25.4   1.9   21  104-124    46-66  (118)
 68 1k82_A Formamidopyrimidine-DNA  38.6      11 0.00038   30.6   1.4   13  112-124   241-253 (268)
 69 3fl2_A E3 ubiquitin-protein li  38.6      16 0.00055   25.3   2.1   20  104-123    80-99  (124)
 70 2xzf_A Formamidopyrimidine-DNA  38.6      11 0.00038   30.6   1.4   14  111-124   242-255 (271)
 71 3l11_A E3 ubiquitin-protein li  38.4     6.5 0.00022   26.9  -0.0   16   15-30     32-47  (115)
 72 1v87_A Deltex protein 2; ring-  38.3      16 0.00056   24.7   2.0   23  104-126    71-97  (114)
 73 2yw8_A RUN and FYVE domain-con  38.3      11 0.00037   25.3   1.1   17   10-26     35-51  (82)
 74 1vfy_A Phosphatidylinositol-3-  38.2      11 0.00037   24.7   1.1   17    9-25     26-42  (73)
 75 1ee8_A MUTM (FPG) protein; bet  38.0      11 0.00039   30.5   1.4   14  111-124   235-248 (266)
 76 2d8t_A Dactylidin, ring finger  37.9     4.7 0.00016   25.4  -0.8   15   15-29     32-46  (71)
 77 2eos_A B-cell lymphoma 6 prote  37.6      14 0.00048   19.8   1.3   23    7-29      8-30  (42)
 78 2yte_A Zinc finger protein 473  37.4      13 0.00045   19.7   1.2   18    7-24      7-24  (42)
 79 2lvr_A Zinc finger and BTB dom  43.6       7 0.00024   18.9   0.0   15   10-24      3-17  (30)
 80 1k3x_A Endonuclease VIII; hydr  37.3      12 0.00041   30.2   1.4   13  112-124   235-247 (262)
 81 1joc_A EEA1, early endosomal a  37.1      11 0.00038   27.3   1.1   17    9-25     84-100 (125)
 82 2vje_B MDM4 protein; proto-onc  37.0      17 0.00057   22.7   1.8   14  110-123    43-56  (63)
 83 2enf_A Zinc finger protein 347  36.9      14 0.00049   20.1   1.3   23    7-29      9-31  (46)
 84 2el5_A Zinc finger protein 268  36.6      13 0.00044   19.9   1.0   23    7-29      7-29  (42)
 85 2ckl_A Polycomb group ring fin  36.5       5 0.00017   27.3  -0.9   20   10-29     28-47  (108)
 86 2yu5_A Zinc finger protein 473  36.4      13 0.00046   20.1   1.1   23    7-29      9-31  (44)
 87 2ckl_B Ubiquitin ligase protei  36.0      18 0.00062   26.3   2.1   19  104-122    83-101 (165)
 88 1njq_A Superman protein; zinc-  35.9      14 0.00046   19.6   1.1   17    8-24      4-20  (39)
 89 2jr6_A UPF0434 protein NMA0874  35.7      34  0.0012   22.6   3.2   23  111-133     8-30  (68)
 90 1rmd_A RAG1; V(D)J recombinati  35.6      18 0.00062   24.7   1.9   21  104-124    51-71  (116)
 91 1z2q_A LM5-1; membrane protein  35.6      13 0.00043   25.1   1.0   14   11-24     38-51  (84)
 92 2lvt_A Zinc finger and BTB dom  41.8     7.8 0.00027   18.8   0.0   13   11-23      3-15  (29)
 93 2epc_A Zinc finger protein 32;  35.5      14 0.00047   19.6   1.1   17    7-23      8-24  (42)
 94 2jrp_A Putative cytoplasmic pr  35.4      24 0.00081   24.5   2.5   15  112-126     3-17  (81)
 95 2ecn_A Ring finger protein 141  35.3     5.7  0.0002   24.7  -0.7   16   15-30     31-46  (70)
 96 2yth_A Zinc finger protein 224  35.3      16 0.00056   20.0   1.4   23    7-29      9-31  (46)
 97 2en2_A B-cell lymphoma 6 prote  35.2      15  0.0005   19.6   1.1   19    7-25      8-26  (42)
 98 2eow_A Zinc finger protein 347  35.2      14 0.00047   20.1   1.0   23    7-29      9-31  (46)
 99 2ept_A Zinc finger protein 32;  34.9      22 0.00076   18.8   1.9   18    7-24      7-24  (41)
100 1y02_A CARP2, FYVE-ring finger  34.8      12 0.00042   27.4   1.0   20    9-28     34-53  (120)
101 1fv5_A First zinc finger of U-  34.7      12 0.00041   21.3   0.7   24    7-30      5-28  (36)
102 2eof_A Zinc finger protein 268  34.6      14 0.00048   19.8   1.0   23    7-29      9-31  (44)
103 2en7_A Zinc finger protein 268  34.5      15 0.00051   19.7   1.1   23    7-29      9-31  (44)
104 2yti_A Zinc finger protein 347  34.3      16 0.00054   20.0   1.2   23    7-29      9-31  (46)
105 1znf_A 31ST zinc finger from X  34.2      14 0.00048   17.4   0.9   11   12-22      3-13  (27)
106 2eon_A ZFP-95, zinc finger pro  34.2      16 0.00056   20.0   1.3   23    7-29      9-31  (46)
107 2yrj_A Zinc finger protein 473  33.9      15 0.00052   19.9   1.1   23    7-29      9-31  (46)
108 2elz_A Zinc finger protein 224  33.8      19 0.00064   19.7   1.5   18    7-24      9-26  (46)
109 2zet_C Melanophilin; complex,   33.8      15 0.00052   27.8   1.4   21    8-29     83-103 (153)
110 2emg_A Zinc finger protein 484  33.8      18  0.0006   19.8   1.3   23    7-29      9-31  (46)
111 2epv_A Zinc finger protein 268  33.8      17 0.00057   19.8   1.2   23    7-29      9-31  (44)
112 2eov_A Zinc finger protein 484  33.8      17 0.00058   19.8   1.3   17    7-23      9-25  (46)
113 2ytf_A Zinc finger protein 268  33.7      15 0.00053   19.9   1.1   23    7-29      9-31  (46)
114 3iuf_A Zinc finger protein UBI  33.6      15  0.0005   20.9   1.0   23    7-29      4-26  (48)
115 1x4u_A Zinc finger, FYVE domai  33.4      14 0.00049   24.7   1.1   13   12-24     32-44  (84)
116 2emj_A Zinc finger protein 28   33.4      16 0.00054   20.0   1.1   23    7-29      9-31  (46)
117 2eq2_A Zinc finger protein 347  33.4      16 0.00054   19.9   1.1   23    7-29      9-31  (46)
118 2yts_A Zinc finger protein 484  33.3      15 0.00053   19.9   1.0   23    7-29      9-31  (46)
119 2enh_A Zinc finger protein 28   33.3      18  0.0006   19.8   1.3   23    7-29      9-31  (46)
120 3zyq_A Hepatocyte growth facto  33.2      13 0.00046   29.2   1.0   15   10-24    180-194 (226)
121 2ytp_A Zinc finger protein 484  33.1      16 0.00055   20.0   1.1   23    7-29      9-31  (46)
122 2em6_A Zinc finger protein 224  33.0      18 0.00062   19.8   1.3   23    7-29      9-31  (46)
123 2epw_A Zinc finger protein 268  33.0      16 0.00055   19.8   1.1   23    7-29      9-31  (46)
124 2emi_A Zinc finger protein 484  33.0      16 0.00054   20.0   1.0   23    7-29      9-31  (46)
125 2eq1_A Zinc finger protein 347  32.8      17 0.00057   19.8   1.1   23    7-29      9-31  (46)
126 2emb_A Zinc finger protein 473  32.8      16 0.00054   19.7   1.0   23    7-29      9-31  (44)
127 2em3_A Zinc finger protein 28   32.8      16 0.00054   20.0   1.0   23    7-29      9-31  (46)
128 2ep3_A Zinc finger protein 484  32.8      16 0.00056   19.9   1.1   23    7-29      9-31  (46)
129 2ely_A Zinc finger protein 224  32.8      19 0.00063   19.7   1.3   18    7-24      9-26  (46)
130 2eoh_A Zinc finger protein 28   32.7      19 0.00064   19.7   1.4   23    7-29      9-31  (46)
131 2ytn_A Zinc finger protein 347  32.7      18 0.00062   19.7   1.3   23    7-29      9-31  (46)
132 1rim_A E6APC2 peptide; E6-bind  32.6      15 0.00053   18.8   0.9   12   11-22      3-14  (33)
133 2epx_A Zinc finger protein 28   32.4      21  0.0007   19.4   1.5   19    7-25      9-27  (47)
134 2em4_A Zinc finger protein 28   32.4      17 0.00058   19.9   1.1   23    7-29      9-31  (46)
135 2ep1_A Zinc finger protein 484  32.3      17 0.00058   19.7   1.1   23    7-29      9-31  (46)
136 2vje_A E3 ubiquitin-protein li  32.3      26  0.0009   21.8   2.2   14  110-123    44-57  (64)
137 2l8e_A Polyhomeotic-like prote  32.2       6 0.00021   25.0  -1.0   11    8-18     16-26  (49)
138 2ene_A Zinc finger protein 347  32.1      17 0.00059   19.8   1.1   23    7-29      9-31  (46)
139 2ytr_A Zinc finger protein 347  32.1      17 0.00058   19.8   1.1   18    7-24      9-26  (46)
140 2en9_A Zinc finger protein 28   31.9      18 0.00063   19.7   1.2   20    7-26      9-28  (46)
141 1mm2_A MI2-beta; PHD, zinc fin  31.9      32  0.0011   21.7   2.5   27    5-31      4-34  (61)
142 2eoj_A Zinc finger protein 268  31.8      14 0.00048   19.9   0.7   23    7-29      9-31  (44)
143 2em0_A Zinc finger protein 224  31.8      18 0.00062   19.7   1.2   23    7-29      9-31  (46)
144 2eoy_A Zinc finger protein 473  31.8      17  0.0006   19.8   1.1   23    7-29      9-31  (46)
145 2epz_A Zinc finger protein 28   31.8      19 0.00065   19.6   1.3   23    7-29      9-31  (46)
146 2jrr_A Uncharacterized protein  31.7      15 0.00052   24.6   0.9   15    7-21     37-51  (67)
147 2em9_A Zinc finger protein 224  31.7      17 0.00059   19.7   1.1   23    7-29      9-31  (46)
148 2ytq_A Zinc finger protein 268  31.7      20 0.00067   19.6   1.3   23    7-29      9-31  (46)
149 2eml_A Zinc finger protein 28   31.7      17 0.00058   19.8   1.0   19    7-25      9-27  (46)
150 2eq3_A Zinc finger protein 347  31.6      15  0.0005   20.0   0.7   23    7-29      9-31  (46)
151 2emk_A Zinc finger protein 28   31.6      19 0.00066   19.6   1.3   18    7-24      9-26  (46)
152 2kpi_A Uncharacterized protein  31.6      48  0.0016   21.0   3.3   20  112-133    11-30  (56)
153 2yto_A Zinc finger protein 484  31.6      17 0.00058   19.9   1.0   23    7-29      9-31  (46)
154 2eop_A Zinc finger protein 268  31.4      19 0.00066   19.5   1.2   23    7-29      9-31  (46)
155 2emh_A Zinc finger protein 484  31.3      17 0.00059   19.8   1.0   20    7-26      9-28  (46)
156 2ytj_A Zinc finger protein 484  31.2      17  0.0006   19.8   1.0   23    7-29      9-31  (46)
157 2emz_A ZFP-95, zinc finger pro  31.2      19 0.00064   19.7   1.2   19    7-25      9-27  (46)
158 2en3_A ZFP-95, zinc finger pro  31.0      18 0.00062   19.7   1.1   20    7-26      9-28  (46)
159 2eom_A ZFP-95, zinc finger pro  31.0      19 0.00066   19.7   1.2   21    7-27      9-29  (46)
160 2yu8_A Zinc finger protein 347  31.0      18 0.00063   19.7   1.1   23    7-29      9-31  (46)
161 1wfk_A Zinc finger, FYVE domai  30.9      16 0.00053   25.0   0.9   19    9-27     24-42  (88)
162 2en8_A Zinc finger protein 224  30.9      18 0.00061   19.6   1.0   23    7-29      9-31  (46)
163 2jne_A Hypothetical protein YF  30.9      29 0.00099   25.2   2.4   21  111-133    32-52  (101)
164 2jvm_A Uncharacterized protein  30.9      19 0.00064   25.0   1.3   15    8-22     51-65  (80)
165 2eoo_A ZFP-95, zinc finger pro  30.9      18 0.00063   19.7   1.1   18    7-24      9-26  (46)
166 2emf_A Zinc finger protein 484  30.7      18 0.00062   19.8   1.1   23    7-29      9-31  (46)
167 2eoq_A Zinc finger protein 224  30.7      19 0.00065   19.6   1.2   19    7-25      9-27  (46)
168 2eq4_A Zinc finger protein 224  30.6      19 0.00066   19.5   1.1   18    7-24      9-26  (46)
169 2emx_A Zinc finger protein 268  30.5      19 0.00063   19.4   1.1   17    7-23      7-23  (44)
170 1dvp_A HRS, hepatocyte growth   30.5      16 0.00054   28.3   1.0   13   12-24    179-191 (220)
171 2em7_A Zinc finger protein 224  30.5      19 0.00064   19.6   1.1   19    7-25      9-27  (46)
172 2eq0_A Zinc finger protein 347  30.4      19 0.00066   19.6   1.2   23    7-29      9-31  (46)
173 2el4_A Zinc finger protein 268  30.4      21 0.00071   19.4   1.3   23    7-29      9-31  (46)
174 2emy_A Zinc finger protein 268  30.4      19 0.00064   19.6   1.1   19    7-25      9-27  (46)
175 2kfq_A FP1; protein, de novo p  30.4      16 0.00055   18.5   0.7   19   11-29      3-21  (32)
176 2enc_A Zinc finger protein 224  30.4      20  0.0007   19.5   1.2   18    7-24      9-26  (46)
177 2yu4_A E3 SUMO-protein ligase   30.3     7.1 0.00024   26.3  -0.9   20   10-29     20-39  (94)
178 2ema_A Zinc finger protein 347  30.2      19 0.00065   19.6   1.1   23    7-29      9-31  (46)
179 2em2_A Zinc finger protein 28   30.2      21 0.00071   19.5   1.2   19    7-25      9-27  (46)
180 2eou_A Zinc finger protein 473  30.2      19 0.00066   19.5   1.1   17    7-23      9-25  (44)
181 2ytk_A Zinc finger protein 347  30.2      19 0.00065   19.6   1.1   17    7-23      9-25  (46)
182 2em5_A ZFP-95, zinc finger pro  30.2      19 0.00066   19.6   1.1   23    7-29      9-31  (46)
183 2eor_A Zinc finger protein 224  30.2      19 0.00063   19.6   1.0   18    7-24      9-26  (46)
184 2ep2_A Zinc finger protein 484  30.0      19 0.00066   19.6   1.1   23    7-29      9-31  (46)
185 2eox_A Zinc finger protein 473  29.8      16 0.00055   19.7   0.7   23    7-29      9-31  (44)
186 2eme_A Zinc finger protein 473  29.8      20 0.00067   19.5   1.1   17    7-23      9-25  (46)
187 2emp_A Zinc finger protein 347  29.8      20 0.00067   19.5   1.1   18    7-24      9-26  (46)
188 2ytm_A Zinc finger protein 28   29.5      20 0.00067   19.7   1.1   17    7-23      9-25  (46)
189 2em8_A Zinc finger protein 224  29.4      21 0.00072   19.5   1.2   17    7-23      9-25  (46)
190 2ytg_A ZFP-95, zinc finger pro  29.2      19 0.00065   19.6   1.0   23    7-29      9-31  (46)
191 2el6_A Zinc finger protein 268  29.0      23 0.00077   19.3   1.3   23    7-29      9-31  (46)
192 2ytt_A Zinc finger protein 473  29.0      22 0.00074   19.4   1.2   18    7-24      9-26  (46)
193 2eoz_A Zinc finger protein 473  29.0      17 0.00056   19.9   0.7   23    7-29      9-31  (46)
194 2emm_A ZFP-95, zinc finger pro  28.9      21 0.00071   19.4   1.1   18    7-24      9-26  (46)
195 1jm7_A BRCA1, breast cancer ty  28.9      27 0.00093   23.2   1.9   13  112-124    59-71  (112)
196 4ayc_A E3 ubiquitin-protein li  28.6     7.8 0.00027   27.7  -1.0   16   15-30     70-85  (138)
197 2yrm_A B-cell lymphoma 6 prote  28.5      24 0.00082   19.1   1.3   17    7-23      7-23  (43)
198 2eoe_A Zinc finger protein 347  28.4      18 0.00061   19.6   0.7   23    7-29      9-31  (46)
199 4esj_A Type-2 restriction enzy  28.4      32  0.0011   28.6   2.5   23  101-124    25-48  (257)
200 1f62_A Transcription factor WS  28.1      20 0.00068   21.5   1.0   12   18-29     15-26  (51)
201 1wim_A KIAA0161 protein; ring   27.7     8.3 0.00028   25.6  -0.9   16   14-29     24-39  (94)
202 2epu_A Zinc finger protein 32;  27.5      18 0.00062   19.7   0.7   23    7-29      9-31  (45)
203 2en1_A Zinc finger protein 224  27.5      19 0.00064   19.6   0.7   20    7-26      9-28  (46)
204 2ecl_A Ring-box protein 2; RNF  27.3      10 0.00034   24.8  -0.6   20   10-29     42-61  (81)
205 2ytd_A Zinc finger protein 473  27.2      25 0.00086   19.1   1.2   19    7-25      9-27  (46)
206 1z6u_A NP95-like ring finger p  27.2      31  0.0011   25.2   2.1   21  104-124   106-126 (150)
207 1yui_A GAGA-factor; complex (D  27.1      22 0.00075   20.3   1.0   17    8-24     22-38  (54)
208 2ep0_A Zinc finger protein 28   26.7      24 0.00081   19.2   1.1   23    7-29      9-31  (46)
209 2en6_A Zinc finger protein 268  26.6      21 0.00072   19.4   0.8   17    7-23      9-25  (46)
210 3hcs_A TNF receptor-associated  26.6      30   0.001   25.1   1.9   21  104-124    46-66  (170)
211 2yso_A ZFP-95, zinc finger pro  26.2      24 0.00082   19.2   1.0   18    7-24      9-26  (46)
212 2ysp_A Zinc finger protein 224  26.2      20 0.00068   19.5   0.7   19    7-25      9-27  (46)
213 3uk3_C Zinc finger protein 217  25.9      22 0.00074   20.1   0.8   17    9-25      3-19  (57)
214 1vd4_A Transcription initiatio  25.8      28 0.00095   20.8   1.3   14    7-20     11-24  (62)
215 1zbd_B Rabphilin-3A; G protein  25.7      23 0.00078   26.2   1.1   20    8-27     70-89  (134)
216 2epq_A POZ-, at HOOK-, and zin  25.6      21 0.00072   19.4   0.7   18    7-24      7-24  (45)
217 2e72_A POGO transposable eleme  25.0      27 0.00093   22.3   1.2   12  110-121    11-22  (49)
218 1x4v_A Hypothetical protein LO  24.4      31  0.0011   22.6   1.4   17    7-23     24-40  (63)
219 2eod_A TNF receptor-associated  24.1      37  0.0013   20.1   1.7   24    5-29      5-28  (66)
220 1lv3_A Hypothetical protein YA  24.0      19 0.00066   24.2   0.4   13  110-122     8-20  (68)
221 1bbo_A Human enhancer-binding   24.0      28 0.00096   19.6   1.1   15    8-22     27-41  (57)
222 2epr_A POZ-, at HOOK-, and zin  23.6      35  0.0012   18.8   1.4   24    6-29      8-31  (48)
223 2yql_A PHD finger protein 21A;  23.6      50  0.0017   20.2   2.3   28    7-35      6-37  (56)
224 2lce_A B-cell lymphoma 6 prote  22.9      41  0.0014   20.1   1.8   25    5-29     12-36  (74)
225 2drp_A Protein (tramtrack DNA-  22.8      29 0.00099   20.2   1.0   16    7-22     37-52  (66)
226 2a20_A Regulating synaptic mem  22.5      25 0.00086   23.4   0.7   19   12-30     27-45  (62)
227 1sp2_A SP1F2; zinc finger, tra  22.3      33  0.0011   16.8   1.0   12   11-22      3-16  (31)
228 2lcq_A Putative toxin VAPC6; P  21.8      35  0.0012   25.0   1.5   13  112-124   149-161 (165)
229 1vk6_A NADH pyrophosphatase; 1  21.6      95  0.0032   24.8   4.1   35  108-142   104-144 (269)
230 2ea5_A Cell growth regulator w  21.1      33  0.0011   21.7   1.1   13  111-123    46-58  (68)
231 1zfd_A SWI5; DNA binding motif  21.1      38  0.0013   16.5   1.1   13   10-22      3-17  (32)
232 2d8s_A Cellular modulator of i  21.1      47  0.0016   21.9   1.9   19  104-122    50-69  (80)
233 3knv_A TNF receptor-associated  20.9      13 0.00046   27.0  -1.0   15   15-29     48-62  (141)
234 2adr_A ADR1; transcription reg  20.9      34  0.0012   19.5   1.0   14    9-22     29-42  (60)
235 2yt9_A Zinc finger-containing   20.7      43  0.0015   20.7   1.6   24    6-29      3-26  (95)
236 1f2i_G Fusion of N-terminal 17  20.5      35  0.0012   20.3   1.0   14    7-20     16-31  (73)
237 3mpx_A FYVE, rhogef and PH dom  20.4      21 0.00073   29.5   0.0   14   11-24    392-405 (434)
238 2lri_C Autoimmune regulator; Z  20.3      61  0.0021   20.9   2.2   22    8-29     10-35  (66)

No 1  
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=99.26  E-value=4.3e-13  Score=89.68  Aligned_cols=29  Identities=28%  Similarity=0.393  Sum_probs=27.6

Q ss_pred             HHHhcCcCCCCCCcceeecCCcceeEeCC
Q psy15037        106 TIKVSTKPCPSCRTATERAGKGVYAYDLY  134 (149)
Q Consensus       106 ~I~~ntK~CP~C~~~IEK~~GCNhM~~~~  134 (149)
                      ||..+||+||+|+++|||++|||||+|..
T Consensus         1 wi~~~~k~CP~C~~~Iek~~GCnhmtC~~   29 (60)
T 1wd2_A            1 WIAANTKECPKCHVTIEKDGGCNHMVCRN   29 (60)
T ss_dssp             CCCCCCCCCTTTCCCCSSCCSCCSSSCCS
T ss_pred             CccccceECcCCCCeeEeCCCCCcEEECC
Confidence            68899999999999999999999999985


No 2  
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens}
Probab=98.30  E-value=2.5e-07  Score=64.03  Aligned_cols=32  Identities=34%  Similarity=0.994  Sum_probs=27.7

Q ss_pred             CCCCCcccCC-----ccCccccccccccccCCCCCCc
Q psy15037          5 EDGCKRIGCT-----ECGFVFCKDCLQGAHIGPCDPG   36 (149)
Q Consensus         5 e~~~~~v~Cp-----~C~~aFC~~Cke~WH~g~C~~~   36 (149)
                      +++.++++||     .|+++||+.|++.||..+|.+.
T Consensus        40 ~~~~~~v~C~~~~~~~C~~~FC~~C~~~wH~~~C~~~   76 (80)
T 2jmo_A           40 EPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAV   76 (80)
T ss_dssp             CSCTTSBCTTSSSTTCCSCCEETTTTEECCSSCSSSC
T ss_pred             CCCCCcCCCCCCCCCCCCCeeccccCccccCCccccc
Confidence            4567889999     9999999999999998569764


No 3  
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4
Probab=98.18  E-value=2.6e-07  Score=64.46  Aligned_cols=33  Identities=24%  Similarity=0.580  Sum_probs=28.9

Q ss_pred             CCCCcccCCccCccccccccccc---cCC-CCCCccc
Q psy15037          6 DGCKRIGCTECGFVFCKDCLQGA---HIG-PCDPGRT   38 (149)
Q Consensus         6 ~~~~~v~Cp~C~~aFC~~Cke~W---H~g-~C~~~~~   38 (149)
                      ++..+++||.|++.||+.|+.+|   |.+ .|...+.
T Consensus        39 ~~~~~v~C~~C~~~FC~~C~~~w~~~H~~~sC~~~~~   75 (86)
T 2ct7_A           39 REQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQN   75 (86)
T ss_dssp             CSCSCEECTTTCCEECSSSCSBCCTTTTTSCHHHHHH
T ss_pred             CCCCceEeCCCCCccccccCCchhhcCCCCChHHHHH
Confidence            45677999999999999999999   988 6988765


No 4  
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=91.65  E-value=0.094  Score=34.31  Aligned_cols=27  Identities=33%  Similarity=0.792  Sum_probs=23.7

Q ss_pred             CCCCCCCcccCCc--cCcccccccccccc
Q psy15037          3 EGEDGCKRIGCTE--CGFVFCKDCLQGAH   29 (149)
Q Consensus         3 ~~e~~~~~v~Cp~--C~~aFC~~Cke~WH   29 (149)
                      +.+.+.+.+.|..  |++.||..|...|.
T Consensus        17 ek~~GCnhmtC~~~~C~~~FCw~C~~~~~   45 (60)
T 1wd2_A           17 EKDGGCNHMVCRNQNCKAEFCWVCLGPWE   45 (60)
T ss_dssp             SSCCSCCSSSCCSSGGGSCCSSSSCSCSG
T ss_pred             EeCCCCCcEEECCCCcCCEEeeCcCCCcc
Confidence            4456788999998  99999999999997


No 5  
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1
Probab=81.56  E-value=0.6  Score=27.93  Aligned_cols=23  Identities=22%  Similarity=0.342  Sum_probs=18.1

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +...+.-+.|+..||..|...|-
T Consensus        18 ~~~~~~~~~C~H~f~~~Ci~~w~   40 (55)
T 1iym_A           18 GEEARFLPRCGHGFHAECVDMWL   40 (55)
T ss_dssp             TSCCEECSSSCCEECTTHHHHTT
T ss_pred             CCceEECCCCCCcccHHHHHHHH
Confidence            34455666899999999998885


No 6  
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ...
Probab=75.86  E-value=1.6  Score=30.37  Aligned_cols=31  Identities=13%  Similarity=0.126  Sum_probs=25.8

Q ss_pred             HhcCcCCCCCCcceeecCCcceeEeCCCcee
Q psy15037        108 KVSTKPCPSCRTATERAGKGVYAYDLYPMFI  138 (149)
Q Consensus       108 ~~ntK~CP~C~~~IEK~~GCNhM~~~~~~~~  138 (149)
                      +....+||.|.....+..+=..+.|.|=.+.
T Consensus        24 q~~~y~Cp~CG~~~v~r~atGiW~C~~Cg~~   54 (83)
T 1vq8_Z           24 MNEDHACPNCGEDRVDRQGTGIWQCSYCDYK   54 (83)
T ss_dssp             HHSCEECSSSCCEEEEEEETTEEEETTTCCE
T ss_pred             ccccCcCCCCCCcceeccCCCeEECCCCCCE
Confidence            4567899999999999998888999886654


No 7  
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=74.14  E-value=2  Score=27.35  Aligned_cols=22  Identities=23%  Similarity=0.599  Sum_probs=16.9

Q ss_pred             HHHHHhcCcCCCCCCcceeecCC
Q psy15037        104 QVTIKVSTKPCPSCRTATERAGK  126 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK~~G  126 (149)
                      ..|++.+ ..||-|+.+|....|
T Consensus        54 ~~w~~~~-~~CP~Cr~~~~~~~g   75 (75)
T 1x4j_A           54 DKWLKAN-RTCPICRADSGPSSG   75 (75)
T ss_dssp             HHHHHHC-SSCTTTCCCCCCCCC
T ss_pred             HHHHHcC-CcCcCcCCcCCCCCC
Confidence            3566654 689999999987766


No 8  
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=71.42  E-value=2.3  Score=26.32  Aligned_cols=20  Identities=20%  Similarity=0.539  Sum_probs=15.1

Q ss_pred             HHHHhcCcCCCCCCcceeec
Q psy15037        105 VTIKVSTKPCPSCRTATERA  124 (149)
Q Consensus       105 ~~I~~ntK~CP~C~~~IEK~  124 (149)
                      .|+..+...||.|+.++.++
T Consensus        37 ~~~~~~~~~CP~Cr~~~~~~   56 (65)
T 1g25_A           37 LLFVRGAGNCPECGTPLRKS   56 (65)
T ss_dssp             HHHHTTSSSCTTTCCCCSSC
T ss_pred             HHHHcCCCcCCCCCCccccc
Confidence            44455678899999999764


No 9  
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82
Probab=66.94  E-value=2.1  Score=31.26  Aligned_cols=11  Identities=55%  Similarity=1.370  Sum_probs=9.7

Q ss_pred             cccCCccCccc
Q psy15037         10 RIGCTECGFVF   20 (149)
Q Consensus        10 ~v~Cp~C~~aF   20 (149)
                      ...|-.|||+|
T Consensus        67 p~~C~~CG~~F   77 (105)
T 2gmg_A           67 PAQCRKCGFVF   77 (105)
T ss_dssp             CCBBTTTCCBC
T ss_pred             CcChhhCcCee
Confidence            46799999999


No 10 
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}
Probab=66.11  E-value=0.95  Score=30.95  Aligned_cols=21  Identities=19%  Similarity=0.520  Sum_probs=18.0

Q ss_pred             CcccCCccCcccccccccccc
Q psy15037          9 KRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         9 ~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      .++.|..|+..||..|...|-
T Consensus        34 ~p~~~~~CgH~FC~~Ci~~~~   54 (100)
T 3lrq_A           34 DARLCPHCSKLCCFSCIRRWL   54 (100)
T ss_dssp             SEEECTTTCCEEEHHHHHHHH
T ss_pred             CccccCCCCChhhHHHHHHHH
Confidence            356678999999999999995


No 11 
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=65.54  E-value=3  Score=25.90  Aligned_cols=21  Identities=14%  Similarity=0.471  Sum_probs=15.9

Q ss_pred             HHHHHhcCcCCCCCCcceeec
Q psy15037        104 QVTIKVSTKPCPSCRTATERA  124 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK~  124 (149)
                      ..|+......||.|+.+|.++
T Consensus        43 ~~~~~~~~~~CP~Cr~~~~~~   63 (66)
T 2ecy_A           43 AALLSSSSPKCTACQESIVKD   63 (66)
T ss_dssp             HHHHTTSSCCCTTTCCCCCTT
T ss_pred             HHHHHhCcCCCCCCCcCCChh
Confidence            456666677899999998654


No 12 
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=65.09  E-value=1.8  Score=27.98  Aligned_cols=21  Identities=24%  Similarity=0.423  Sum_probs=15.5

Q ss_pred             HHHHHhc--CcCCCCCCcceeec
Q psy15037        104 QVTIKVS--TKPCPSCRTATERA  124 (149)
Q Consensus       104 ~~~I~~n--tK~CP~C~~~IEK~  124 (149)
                      ..|++.+  ...||.|+.++...
T Consensus        47 ~~~~~~~~~~~~CP~Cr~~~~~~   69 (88)
T 2ct2_A           47 EKLLASSINGVRCPFCSKITRIT   69 (88)
T ss_dssp             HHHHHHCSSCBCCTTTCCCBCCS
T ss_pred             HHHHHcCCCCcCCCCCCCcccch
Confidence            3456554  68999999998654


No 13 
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A
Probab=62.87  E-value=2.3  Score=25.17  Aligned_cols=21  Identities=14%  Similarity=0.403  Sum_probs=16.1

Q ss_pred             CcccCCccCcccccccccccc
Q psy15037          9 KRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         9 ~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      ..+.-..|+..||..|...|-
T Consensus        20 ~~~~~~~CgH~fc~~Ci~~~~   40 (55)
T 2ecm_A           20 VVAHVLPCGHLLHRTCYEEML   40 (55)
T ss_dssp             SCEEECTTSCEEETTHHHHHH
T ss_pred             cCeEecCCCCcccHHHHHHHH
Confidence            344555689999999988885


No 14 
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}
Probab=62.31  E-value=4.1  Score=24.52  Aligned_cols=20  Identities=25%  Similarity=0.707  Sum_probs=14.9

Q ss_pred             HHHHHhcCcCCCCCCcceeec
Q psy15037        104 QVTIKVSTKPCPSCRTATERA  124 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK~  124 (149)
                      ..|++. ...||.|+.++...
T Consensus        38 ~~~~~~-~~~CP~Cr~~~~~~   57 (64)
T 2xeu_A           38 RDSLKN-ANTCPTCRKKINHK   57 (64)
T ss_dssp             HHHHHH-CSBCTTTCCBCTTT
T ss_pred             HHHHHc-CCCCCCCCccCCcc
Confidence            356655 67999999998653


No 15 
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}
Probab=61.60  E-value=4.8  Score=24.90  Aligned_cols=20  Identities=25%  Similarity=0.715  Sum_probs=14.6

Q ss_pred             HHHHHhcCcCCCCCCcceeec
Q psy15037        104 QVTIKVSTKPCPSCRTATERA  124 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK~  124 (149)
                      ..|++.+ +.||.|+.++.++
T Consensus        45 ~~~~~~~-~~CP~Cr~~~~~~   64 (71)
T 3ng2_A           45 RDSLKNA-NTCPTCRKKINHK   64 (71)
T ss_dssp             HHHHHHC-SBCTTTCCBCCCC
T ss_pred             HHHHHcC-CCCCCCCCccChh
Confidence            3466544 7999999999654


No 16 
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}
Probab=59.64  E-value=4.2  Score=27.83  Aligned_cols=21  Identities=24%  Similarity=0.657  Sum_probs=16.7

Q ss_pred             HHHHHhcCcCCCCCCcceeecC
Q psy15037        104 QVTIKVSTKPCPSCRTATERAG  125 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK~~  125 (149)
                      ..|++. .+.||.|+.+|+++.
T Consensus       107 ~~~~~~-~~~CP~Cr~~~~~~~  127 (133)
T 4ap4_A          107 RDSLKN-ANTCPTCRKKINHKR  127 (133)
T ss_dssp             HHHHHH-CSBCTTTCCBCCGGG
T ss_pred             HHHHHc-CCCCCCCCCcCChhc
Confidence            567764 579999999998763


No 17 
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2
Probab=58.23  E-value=2.7  Score=27.59  Aligned_cols=21  Identities=38%  Similarity=0.629  Sum_probs=17.4

Q ss_pred             cccCCccCccccccccccccC
Q psy15037         10 RIGCTECGFVFCKDCLQGAHI   30 (149)
Q Consensus        10 ~v~Cp~C~~aFC~~Cke~WH~   30 (149)
                      ...|+.|+..||..|=.-=|.
T Consensus        30 ~y~C~~C~~~FC~dCD~fiHe   50 (59)
T 1z60_A           30 VYVCAVCQNVFCVDCDVFVHD   50 (59)
T ss_dssp             EECCTTTTCCBCHHHHHTTTT
T ss_pred             cEECCccCcCcccchhHHHHh
Confidence            467999999999999766664


No 18 
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1
Probab=54.87  E-value=9  Score=23.20  Aligned_cols=26  Identities=15%  Similarity=0.131  Sum_probs=20.8

Q ss_pred             cCcCCCCCCc-ceeecCCcceeEeCCC
Q psy15037        110 STKPCPSCRT-ATERAGKGVYAYDLYP  135 (149)
Q Consensus       110 ntK~CP~C~~-~IEK~~GCNhM~~~~~  135 (149)
                      +...||.|.. .+.-+..=..++|.+=
T Consensus         4 ~~~~CP~C~~~~l~~d~~~gelvC~~C   30 (50)
T 1pft_A            4 KQKVCPACESAELIYDPERGEIVCAKC   30 (50)
T ss_dssp             SCCSCTTTSCCCEEEETTTTEEEESSS
T ss_pred             ccEeCcCCCCcceEEcCCCCeEECccc
Confidence            4668999998 8888877778888764


No 19 
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=54.84  E-value=7.3  Score=23.73  Aligned_cols=19  Identities=26%  Similarity=0.751  Sum_probs=14.2

Q ss_pred             HHHHHhcCcCCCCCCcceee
Q psy15037        104 QVTIKVSTKPCPSCRTATER  123 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK  123 (149)
                      ..|+.. ...||.|+.+|.+
T Consensus        50 ~~~~~~-~~~CP~Cr~~~~~   68 (69)
T 2ea6_A           50 RDSLKN-ANTCPTCRKKINH   68 (69)
T ss_dssp             HHHHHH-CSSCTTTCCCCCC
T ss_pred             HHHHHc-CCCCCCCCCccCc
Confidence            456655 6789999999854


No 20 
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2
Probab=53.88  E-value=6.4  Score=24.96  Aligned_cols=20  Identities=20%  Similarity=0.370  Sum_probs=15.7

Q ss_pred             HHHHHhcCcCCCCCCcceee
Q psy15037        104 QVTIKVSTKPCPSCRTATER  123 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK  123 (149)
                      ..|+..+...||.|+.++..
T Consensus        36 ~~~~~~~~~~CP~C~~~~~~   55 (78)
T 1t1h_A           36 QKWLDAGHKTCPKSQETLLH   55 (78)
T ss_dssp             HHHHTTTCCBCTTTCCBCSS
T ss_pred             HHHHHHCcCCCCCCcCCCCh
Confidence            45676668889999999854


No 21 
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=53.57  E-value=8.2  Score=24.27  Aligned_cols=20  Identities=15%  Similarity=0.474  Sum_probs=14.7

Q ss_pred             HHHHHhcCcCCCCCCcceeec
Q psy15037        104 QVTIKVSTKPCPSCRTATERA  124 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK~  124 (149)
                      ..|++. ...||.|+.+|.+.
T Consensus        44 ~~~~~~-~~~CP~Cr~~~~~~   63 (72)
T 2djb_A           44 VRHFYY-SNRCPKCNIVVHQT   63 (72)
T ss_dssp             HHHHHH-CSSCTTTCCCCCSS
T ss_pred             HHHHHc-CCcCCCcCcccCcc
Confidence            345544 67899999999764


No 22 
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=52.86  E-value=3.7  Score=26.50  Aligned_cols=15  Identities=27%  Similarity=0.837  Sum_probs=13.1

Q ss_pred             ccCcccccccccccc
Q psy15037         15 ECGFVFCKDCLQGAH   29 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH   29 (149)
                      .|+..||..|...|-
T Consensus        32 ~CgH~fC~~Ci~~~~   46 (81)
T 2csy_A           32 KCRHYFCESCALEHF   46 (81)
T ss_dssp             TTSCEEEHHHHHHHH
T ss_pred             cCCCHhHHHHHHHHH
Confidence            588999999998885


No 23 
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A
Probab=51.69  E-value=6.3  Score=20.48  Aligned_cols=17  Identities=29%  Similarity=0.780  Sum_probs=12.7

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.++..|+.|+..|-..
T Consensus         8 ~~k~~~C~~C~k~f~~~   24 (37)
T 1p7a_A            8 GIKPFQCPDCDRSFSRS   24 (37)
T ss_dssp             CSSSBCCTTTCCCBSSH
T ss_pred             CCCCccCCCCCcccCcH
Confidence            45678899999888543


No 24 
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=50.46  E-value=5.8  Score=19.15  Aligned_cols=13  Identities=15%  Similarity=0.296  Sum_probs=9.2

Q ss_pred             cccCCccCccccc
Q psy15037         10 RIGCTECGFVFCK   22 (149)
Q Consensus        10 ~v~Cp~C~~aFC~   22 (149)
                      +..|+.|+..|=.
T Consensus         3 ~~~C~~C~k~f~~   15 (27)
T 2kvh_A            3 PFSCSLCPQRSRD   15 (27)
T ss_dssp             CEECSSSSCEESS
T ss_pred             CccCCCcChhhCC
Confidence            4678888887743


No 25 
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}
Probab=49.99  E-value=4.6  Score=25.79  Aligned_cols=16  Identities=31%  Similarity=0.960  Sum_probs=13.6

Q ss_pred             CccCcccccccccccc
Q psy15037         14 TECGFVFCKDCLQGAH   29 (149)
Q Consensus        14 p~C~~aFC~~Cke~WH   29 (149)
                      +.|+..||..|...|-
T Consensus        32 ~~CgH~fC~~Ci~~~~   47 (74)
T 2yur_A           32 PCCGNSYCDECIRTAL   47 (74)
T ss_dssp             SSSCCEECTTHHHHHH
T ss_pred             CCCCCHHHHHHHHHHH
Confidence            3599999999998885


No 26 
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=48.67  E-value=6.1  Score=19.02  Aligned_cols=16  Identities=31%  Similarity=0.619  Sum_probs=10.8

Q ss_pred             CcccCCccCccccccc
Q psy15037          9 KRIGCTECGFVFCKDC   24 (149)
Q Consensus         9 ~~v~Cp~C~~aFC~~C   24 (149)
                      +...|+.|+..|-..-
T Consensus         2 k~~~C~~C~~~f~~~~   17 (30)
T 2m0d_A            2 KPYQCDYCGRSFSDPT   17 (30)
T ss_dssp             CCEECTTTCCEESCHH
T ss_pred             cCccCCCCCcccCCHH
Confidence            3467888888876543


No 27 
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=48.48  E-value=6.9  Score=20.27  Aligned_cols=17  Identities=29%  Similarity=0.417  Sum_probs=12.8

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+.+|-..
T Consensus         6 ~~k~~~C~~C~k~f~~~   22 (36)
T 2els_A            6 SGKIFTCEYCNKVFKFK   22 (36)
T ss_dssp             CCCCEECTTTCCEESSH
T ss_pred             CCCCEECCCCCceeCCH
Confidence            45678899999988653


No 28 
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}
Probab=48.28  E-value=9.9  Score=23.45  Aligned_cols=19  Identities=32%  Similarity=0.627  Sum_probs=13.5

Q ss_pred             HHHHHhcCcCCCCCCcceee
Q psy15037        104 QVTIKVSTKPCPSCRTATER  123 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK  123 (149)
                      ..|++.+ ..||-|+.+|..
T Consensus        45 ~~~~~~~-~~CP~Cr~~~~~   63 (69)
T 2kiz_A           45 DQWLITN-KKCPICRVDIEA   63 (69)
T ss_dssp             HHHHHHC-SBCTTTCSBSCS
T ss_pred             HHHHHcC-CCCcCcCccccC
Confidence            3466554 469999999864


No 29 
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1
Probab=48.11  E-value=10  Score=23.28  Aligned_cols=17  Identities=29%  Similarity=0.690  Sum_probs=12.6

Q ss_pred             HHHHhcCcCCCCCCccee
Q psy15037        105 VTIKVSTKPCPSCRTATE  122 (149)
Q Consensus       105 ~~I~~ntK~CP~C~~~IE  122 (149)
                      .|+..+ ..||.|+.++.
T Consensus        35 ~~~~~~-~~CP~Cr~~~~   51 (68)
T 1chc_A           35 RWIRQN-PTCPLCKVPVE   51 (68)
T ss_dssp             HHHHHS-CSTTTTCCCCC
T ss_pred             HHHhCc-CcCcCCChhhH
Confidence            455543 78999999985


No 30 
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}
Probab=48.09  E-value=3.1  Score=27.35  Aligned_cols=16  Identities=31%  Similarity=0.960  Sum_probs=13.7

Q ss_pred             CccCcccccccccccc
Q psy15037         14 TECGFVFCKDCLQGAH   29 (149)
Q Consensus        14 p~C~~aFC~~Cke~WH   29 (149)
                      +.|+.+||..|...|-
T Consensus        30 ~~CgH~fC~~Ci~~~~   45 (92)
T 3ztg_A           30 PCCGNSYCDECIRTAL   45 (92)
T ss_dssp             TTTCCEECHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHH
Confidence            3499999999999884


No 31 
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=47.88  E-value=6.5  Score=18.74  Aligned_cols=14  Identities=21%  Similarity=0.465  Sum_probs=9.4

Q ss_pred             cccCCccCcccccc
Q psy15037         10 RIGCTECGFVFCKD   23 (149)
Q Consensus        10 ~v~Cp~C~~aFC~~   23 (149)
                      +..|+.|+.+|-..
T Consensus         2 ~~~C~~C~~~f~~~   15 (29)
T 2m0e_A            2 EHKCPHCDKKFNQV   15 (29)
T ss_dssp             CCCCSSCCCCCCTT
T ss_pred             CCcCCCCCcccCCH
Confidence            34688888777644


No 32 
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=47.87  E-value=10  Score=19.54  Aligned_cols=18  Identities=17%  Similarity=0.298  Sum_probs=13.1

Q ss_pred             CCCCcccCCccCcccccc
Q psy15037          6 DGCKRIGCTECGFVFCKD   23 (149)
Q Consensus         6 ~~~~~v~Cp~C~~aFC~~   23 (149)
                      .+.+...|+.|+..|=..
T Consensus         5 ~~~k~~~C~~C~k~f~~~   22 (36)
T 2elv_A            5 SSGLLYDCHICERKFKNE   22 (36)
T ss_dssp             CCCCCEECSSSCCEESSH
T ss_pred             CCCCCeECCCCCCccCCH
Confidence            345677899999888654


No 33 
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}
Probab=47.81  E-value=9.1  Score=25.87  Aligned_cols=20  Identities=20%  Similarity=0.511  Sum_probs=15.1

Q ss_pred             HHHHHhcCcCCCCCCcceee
Q psy15037        104 QVTIKVSTKPCPSCRTATER  123 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK  123 (149)
                      ..|+......||.|+.++..
T Consensus        51 ~~~~~~~~~~CP~Cr~~~~~   70 (100)
T 3lrq_A           51 RRWLTEQRAQCPHCRAPLQL   70 (100)
T ss_dssp             HHHHHHTCSBCTTTCCBCCG
T ss_pred             HHHHHHCcCCCCCCCCcCCH
Confidence            35666665799999999854


No 34 
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=47.13  E-value=8  Score=19.99  Aligned_cols=17  Identities=18%  Similarity=0.450  Sum_probs=12.7

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|=..
T Consensus         6 ~~k~~~C~~C~k~f~~~   22 (36)
T 2elq_A            6 SGKPFKCSLCEYATRSK   22 (36)
T ss_dssp             CCCSEECSSSSCEESCH
T ss_pred             CCCCccCCCCCchhCCH
Confidence            45678899999888543


No 35 
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=47.01  E-value=2.6  Score=25.87  Aligned_cols=15  Identities=33%  Similarity=1.032  Sum_probs=13.3

Q ss_pred             ccCcccccccccccc
Q psy15037         15 ECGFVFCKDCLQGAH   29 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH   29 (149)
                      .|+.+||..|...|-
T Consensus        37 ~CgH~fC~~Ci~~~~   51 (63)
T 2ysj_A           37 DCGHNFCLKCITQIG   51 (63)
T ss_dssp             TTSSEECHHHHHHHH
T ss_pred             CCCCcchHHHHHHHH
Confidence            589999999998885


No 36 
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}
Probab=46.85  E-value=7.4  Score=19.75  Aligned_cols=18  Identities=22%  Similarity=0.366  Sum_probs=12.8

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+..|=..-
T Consensus         4 ~~k~~~C~~C~k~f~~~~   21 (35)
T 2elx_A            4 GSSGYVCALCLKKFVSSI   21 (35)
T ss_dssp             CCCSEECSSSCCEESSHH
T ss_pred             CCCCeECCCCcchhCCHH
Confidence            345678999988886543


No 37 
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=46.73  E-value=8.2  Score=19.79  Aligned_cols=17  Identities=18%  Similarity=0.499  Sum_probs=12.4

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.++..|+.|+..|=..
T Consensus         6 ~~k~~~C~~C~k~f~~~   22 (36)
T 2elt_A            6 SGKPYKCPQCSYASAIK   22 (36)
T ss_dssp             CCCSEECSSSSCEESSH
T ss_pred             CCCCCCCCCCCcccCCH
Confidence            44567899999888543


No 38 
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=46.71  E-value=6.9  Score=27.11  Aligned_cols=20  Identities=25%  Similarity=0.820  Sum_probs=16.1

Q ss_pred             ccCccccccccccccCCCCC
Q psy15037         15 ECGFVFCKDCLQGAHIGPCD   34 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH~g~C~   34 (149)
                      .|+.+||..|...|-...|.
T Consensus        40 ~CgH~fC~~Ci~~~~~~~CP   59 (117)
T 1jm7_B           40 GCEHIFCSNCVSDCIGTGCP   59 (117)
T ss_dssp             SSSCCBCTTTGGGGTTTBCS
T ss_pred             CCCCHHHHHHHHHHhcCCCc
Confidence            69999999999999653343


No 39 
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}
Probab=46.60  E-value=10  Score=24.01  Aligned_cols=18  Identities=22%  Similarity=0.575  Sum_probs=13.1

Q ss_pred             HHHHhcCcCCCCCCcceee
Q psy15037        105 VTIKVSTKPCPSCRTATER  123 (149)
Q Consensus       105 ~~I~~ntK~CP~C~~~IEK  123 (149)
                      .|++.+ ..||-|+.+|..
T Consensus        47 ~~~~~~-~~CP~Cr~~~~~   64 (78)
T 2ect_A           47 PWLEQH-DSCPVCRKSLTG   64 (78)
T ss_dssp             HHHTTT-CSCTTTCCCCCC
T ss_pred             HHHHcC-CcCcCcCCccCC
Confidence            455443 789999999854


No 40 
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}
Probab=46.55  E-value=11  Score=27.35  Aligned_cols=21  Identities=29%  Similarity=0.594  Sum_probs=17.0

Q ss_pred             HHHHhcCcCCCCCCcceeecC
Q psy15037        105 VTIKVSTKPCPSCRTATERAG  125 (149)
Q Consensus       105 ~~I~~ntK~CP~C~~~IEK~~  125 (149)
                      .|-+...+.||.|+.+|++..
T Consensus        31 ~~~~~~~k~Cp~C~~~V~rVe   51 (101)
T 3vk6_A           31 LHEKKGDKMCPGCSDPVQRIE   51 (101)
T ss_dssp             HHHHTTCCBCTTTCCBCSEEE
T ss_pred             HHHhccCCCCcCcCCeeeeeE
Confidence            345678899999999998854


No 41 
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A
Probab=46.28  E-value=7.4  Score=18.67  Aligned_cols=12  Identities=25%  Similarity=0.686  Sum_probs=7.7

Q ss_pred             ccCCccCccccc
Q psy15037         11 IGCTECGFVFCK   22 (149)
Q Consensus        11 v~Cp~C~~aFC~   22 (149)
                      ..|+.|+.+|=.
T Consensus         3 ~~C~~C~~~f~~   14 (29)
T 1ard_A            3 FVCEVCTRAFAR   14 (29)
T ss_dssp             CBCTTTCCBCSS
T ss_pred             eECCCCCcccCC
Confidence            467777777643


No 42 
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}
Probab=46.13  E-value=4.3  Score=25.64  Aligned_cols=15  Identities=27%  Similarity=1.085  Sum_probs=12.8

Q ss_pred             ccCcccccccccccc
Q psy15037         15 ECGFVFCKDCLQGAH   29 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH   29 (149)
                      .|+.+||..|...|-
T Consensus        29 ~CgH~fC~~Ci~~~~   43 (79)
T 2egp_A           29 DCGHSLCRACITVSN   43 (79)
T ss_dssp             SSSCCCCHHHHSCCC
T ss_pred             CCCCHHHHHHHHHHH
Confidence            599999999988773


No 43 
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=45.87  E-value=6.5  Score=24.45  Aligned_cols=20  Identities=20%  Similarity=0.443  Sum_probs=14.4

Q ss_pred             HHHH--hcCcCCCCCCcceeec
Q psy15037        105 VTIK--VSTKPCPSCRTATERA  124 (149)
Q Consensus       105 ~~I~--~ntK~CP~C~~~IEK~  124 (149)
                      .|++  .....||.|+.+|.++
T Consensus        49 ~~~~~~~~~~~CP~Cr~~~~~~   70 (73)
T 2ysl_A           49 QIGETSCGFFKCPLCKTSVRKN   70 (73)
T ss_dssp             HHCSSSCSCCCCSSSCCCCCCC
T ss_pred             HHHHcCCCCCCCCCCCCcCCcc
Confidence            4554  3566899999998764


No 44 
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=45.69  E-value=11  Score=23.51  Aligned_cols=18  Identities=28%  Similarity=0.505  Sum_probs=13.3

Q ss_pred             HHHHHhcCcCCCCCCccee
Q psy15037        104 QVTIKVSTKPCPSCRTATE  122 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IE  122 (149)
                      ..|++.+ ..||-|+.+|.
T Consensus        46 ~~~~~~~-~~CP~Cr~~~~   63 (74)
T 2ep4_A           46 IKWLEVR-KVCPLCNMPVL   63 (74)
T ss_dssp             HHHHHHC-SBCTTTCCBCS
T ss_pred             HHHHHcC-CcCCCcCcccc
Confidence            4566654 58999999884


No 45 
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=45.63  E-value=7.5  Score=18.72  Aligned_cols=13  Identities=31%  Similarity=0.710  Sum_probs=9.3

Q ss_pred             cccCCccCccccc
Q psy15037         10 RIGCTECGFVFCK   22 (149)
Q Consensus        10 ~v~Cp~C~~aFC~   22 (149)
                      ...|+.|+..|-.
T Consensus         3 ~~~C~~C~k~f~~   15 (28)
T 2kvf_A            3 PYSCSVCGKRFSL   15 (28)
T ss_dssp             SEECSSSCCEESC
T ss_pred             CccCCCCCcccCC
Confidence            4578888887754


No 46 
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=45.43  E-value=8.1  Score=20.10  Aligned_cols=16  Identities=31%  Similarity=0.783  Sum_probs=11.9

Q ss_pred             CCCcccCCccCccccc
Q psy15037          7 GCKRIGCTECGFVFCK   22 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~   22 (149)
                      +.+...|+.|+..|=.
T Consensus         6 ~~k~~~C~~C~k~f~~   21 (37)
T 2elp_A            6 SGRAMKCPYCDFYFMK   21 (37)
T ss_dssp             CCCCEECSSSSCEECS
T ss_pred             CCCCeECCCCChhhcc
Confidence            3456789999988854


No 47 
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=45.27  E-value=7.8  Score=20.48  Aligned_cols=17  Identities=12%  Similarity=0.348  Sum_probs=12.8

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.++..|+.|+..|-..
T Consensus         6 ~~k~~~C~~C~k~f~~~   22 (37)
T 2elm_A            6 SGHLYYCSQCHYSSITK   22 (37)
T ss_dssp             SSCEEECSSSSCEEECH
T ss_pred             CCcCeECCCCCcccCCH
Confidence            45678899999988653


No 48 
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=44.91  E-value=11  Score=22.80  Aligned_cols=22  Identities=23%  Similarity=0.721  Sum_probs=16.4

Q ss_pred             ccCccccccccccccCC--CCCCc
Q psy15037         15 ECGFVFCKDCLQGAHIG--PCDPG   36 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH~g--~C~~~   36 (149)
                      .|+.+||..|...|...  .|...
T Consensus        23 ~CgH~fC~~Ci~~~~~~CP~Cr~~   46 (56)
T 1bor_A           23 PCLHTLCSGCLEASGMQCPICQAP   46 (56)
T ss_dssp             TTSCCSBTTTCSSSSSSCSSCCSS
T ss_pred             CCCCcccHHHHccCCCCCCcCCcE
Confidence            58999999999887643  36543


No 49 
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}
Probab=44.85  E-value=2.6  Score=28.18  Aligned_cols=15  Identities=27%  Similarity=0.447  Sum_probs=12.6

Q ss_pred             ccCcccccccccccc
Q psy15037         15 ECGFVFCKDCLQGAH   29 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH   29 (149)
                      .|+..||..|...|-
T Consensus        60 ~C~H~Fh~~Ci~~wl   74 (91)
T 2l0b_A           60 PCHHYFHKPCVSIWL   74 (91)
T ss_dssp             TTTEEEEHHHHHHHH
T ss_pred             CCCChHHHHHHHHHH
Confidence            388899999988885


No 50 
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=44.59  E-value=3  Score=24.82  Aligned_cols=14  Identities=50%  Similarity=1.201  Sum_probs=12.8

Q ss_pred             ccCccccccccccc
Q psy15037         15 ECGFVFCKDCLQGA   28 (149)
Q Consensus        15 ~C~~aFC~~Cke~W   28 (149)
                      .|+..||..|...|
T Consensus        32 ~CgH~fC~~Ci~~~   45 (58)
T 2ecj_A           32 ECGHNFCKACITRW   45 (58)
T ss_dssp             SSCCCCCHHHHHHH
T ss_pred             CCCCccCHHHHHHH
Confidence            58999999999988


No 51 
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}
Probab=43.48  E-value=14  Score=23.19  Aligned_cols=14  Identities=29%  Similarity=0.657  Sum_probs=11.8

Q ss_pred             CcCCCCCCcceeec
Q psy15037        111 TKPCPSCRTATERA  124 (149)
Q Consensus       111 tK~CP~C~~~IEK~  124 (149)
                      ...||.|+.++...
T Consensus        59 ~~~CP~Cr~~~~~~   72 (85)
T 2ecw_A           59 KGNCPVCRVPYPFG   72 (85)
T ss_dssp             CBCCTTTCCCCCTT
T ss_pred             CCCCCCCCCcCCHH
Confidence            78899999998653


No 52 
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1
Probab=42.62  E-value=9.6  Score=19.45  Aligned_cols=23  Identities=22%  Similarity=0.355  Sum_probs=14.9

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|-..-....|
T Consensus         4 ~~k~~~C~~C~k~f~~~~~l~~H   26 (35)
T 1srk_A            4 GKRPFVCRICLSAFTTKANCARH   26 (35)
T ss_dssp             CCSCEECSSSCCEESSHHHHHHH
T ss_pred             CCcCeeCCCCCcccCCHHHHHHH
Confidence            34567899999888655433333


No 53 
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A
Probab=42.53  E-value=8.5  Score=18.52  Aligned_cols=14  Identities=29%  Similarity=0.792  Sum_probs=9.2

Q ss_pred             cccCCccCcccccc
Q psy15037         10 RIGCTECGFVFCKD   23 (149)
Q Consensus        10 ~v~Cp~C~~aFC~~   23 (149)
                      +..|+.|+..|-..
T Consensus         2 ~~~C~~C~k~f~~~   15 (29)
T 1rik_A            2 KFACPECPKRFMRS   15 (29)
T ss_dssp             CEECSSSSCEESCS
T ss_pred             CccCCCCCchhCCH
Confidence            34678888777543


No 54 
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=42.30  E-value=9.2  Score=18.54  Aligned_cols=12  Identities=25%  Similarity=0.706  Sum_probs=8.1

Q ss_pred             ccCCccCccccc
Q psy15037         11 IGCTECGFVFCK   22 (149)
Q Consensus        11 v~Cp~C~~aFC~   22 (149)
                      ..|+.|+..|-.
T Consensus         3 ~~C~~C~k~f~~   14 (30)
T 1paa_A            3 YACGLCNRAFTR   14 (30)
T ss_dssp             SBCTTTCCBCSS
T ss_pred             cCCcccCcccCC
Confidence            467777777744


No 55 
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=41.33  E-value=7.7  Score=18.89  Aligned_cols=13  Identities=15%  Similarity=0.189  Sum_probs=9.0

Q ss_pred             cccCCccCccccc
Q psy15037         10 RIGCTECGFVFCK   22 (149)
Q Consensus        10 ~v~Cp~C~~aFC~   22 (149)
                      +..|+.|+..|=.
T Consensus         3 ~~~C~~C~k~f~~   15 (27)
T 2kvg_A            3 PYRCPLCRAGCPS   15 (27)
T ss_dssp             TEEETTTTEEESC
T ss_pred             CcCCCCCCcccCC
Confidence            4578888877743


No 56 
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=41.18  E-value=12  Score=19.05  Aligned_cols=17  Identities=29%  Similarity=0.436  Sum_probs=12.0

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|=..
T Consensus         6 ~~~~~~C~~C~k~f~~~   22 (36)
T 2elr_A            6 SGKTHLCDMCGKKFKSK   22 (36)
T ss_dssp             CCSSCBCTTTCCBCSSH
T ss_pred             CCCCeecCcCCCCcCch
Confidence            45567888888888543


No 57 
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A
Probab=41.15  E-value=9.7  Score=18.21  Aligned_cols=12  Identities=25%  Similarity=0.584  Sum_probs=7.6

Q ss_pred             ccCCccCccccc
Q psy15037         11 IGCTECGFVFCK   22 (149)
Q Consensus        11 v~Cp~C~~aFC~   22 (149)
                      ..|+.|+..|-.
T Consensus         3 ~~C~~C~k~f~~   14 (30)
T 1klr_A            3 YQCQYCEFRSAD   14 (30)
T ss_dssp             CCCSSSSCCCSC
T ss_pred             ccCCCCCCccCC
Confidence            457777776643


No 58 
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=41.05  E-value=8.6  Score=19.92  Aligned_cols=17  Identities=24%  Similarity=0.583  Sum_probs=12.2

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|-..
T Consensus         6 ~~k~~~C~~C~k~f~~~   22 (37)
T 2elo_A            6 SGRSYSCPVCEKSFSED   22 (37)
T ss_dssp             CCCCCEETTTTEECSSH
T ss_pred             CCCCcCCCCCCCccCCH
Confidence            34567899898888543


No 59 
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens}
Probab=40.74  E-value=9.3  Score=26.15  Aligned_cols=18  Identities=44%  Similarity=1.082  Sum_probs=11.9

Q ss_pred             CcccCCccCccccccccc
Q psy15037          9 KRIGCTECGFVFCKDCLQ   26 (149)
Q Consensus         9 ~~v~Cp~C~~aFC~~Cke   26 (149)
                      ++-.|-.||.+||..|-.
T Consensus        35 RrhhCr~CG~v~C~~Cs~   52 (90)
T 3t7l_A           35 RRHHCRACGKVFCGVCCN   52 (90)
T ss_dssp             CCEECTTTCCEECGGGSC
T ss_pred             hCccccCCCCEECCcccC
Confidence            344567777777777744


No 60 
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=46.83  E-value=5.8  Score=18.96  Aligned_cols=13  Identities=31%  Similarity=0.759  Sum_probs=8.3

Q ss_pred             ccCCccCcccccc
Q psy15037         11 IGCTECGFVFCKD   23 (149)
Q Consensus        11 v~Cp~C~~aFC~~   23 (149)
                      ..|+.|+..|=..
T Consensus         3 ~~C~~C~k~f~~~   15 (26)
T 2lvu_A            3 YVCERCGKRFVQS   15 (26)
Confidence            4677777776543


No 61 
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}
Probab=40.68  E-value=5  Score=27.01  Aligned_cols=24  Identities=25%  Similarity=0.732  Sum_probs=20.3

Q ss_pred             CCCcccCCccCccccccccccccC
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAHI   30 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH~   30 (149)
                      .+....|..|+..||..|.+.+|.
T Consensus        15 ~~av~~C~~C~~~~C~~Cl~~~h~   38 (101)
T 2jun_A           15 QDAVKTCVTCEVSYCDECLKATHP   38 (101)
T ss_dssp             CBCCEEETTTTEEECHHHHHHHSC
T ss_pred             CCceEECCcCChHHhHHHCHHHhc
Confidence            345567999999999999999884


No 62 
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=40.50  E-value=5  Score=25.38  Aligned_cols=14  Identities=43%  Similarity=1.310  Sum_probs=12.4

Q ss_pred             ccCccccccccccc
Q psy15037         15 ECGFVFCKDCLQGA   28 (149)
Q Consensus        15 ~C~~aFC~~Cke~W   28 (149)
                      .|+..||..|...|
T Consensus        36 ~CgH~fC~~Ci~~~   49 (85)
T 2ecv_A           36 DCGHSFCQACLTAN   49 (85)
T ss_dssp             SSSCCBCTTHHHHH
T ss_pred             CCCCHHHHHHHHHH
Confidence            58999999998887


No 63 
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=40.34  E-value=9.3  Score=18.20  Aligned_cols=12  Identities=42%  Similarity=1.013  Sum_probs=8.0

Q ss_pred             ccCCccCccccc
Q psy15037         11 IGCTECGFVFCK   22 (149)
Q Consensus        11 v~Cp~C~~aFC~   22 (149)
                      ..|+.|+.+|-.
T Consensus         3 ~~C~~C~k~f~~   14 (29)
T 2m0f_A            3 LKCRECGKQFTT   14 (29)
T ss_dssp             EECTTTSCEESC
T ss_pred             ccCCCCCCccCC
Confidence            467777777754


No 64 
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}
Probab=39.98  E-value=4.6  Score=26.98  Aligned_cols=20  Identities=15%  Similarity=0.496  Sum_probs=16.2

Q ss_pred             ccCCccCccccccccccccC
Q psy15037         11 IGCTECGFVFCKDCLQGAHI   30 (149)
Q Consensus        11 v~Cp~C~~aFC~~Cke~WH~   30 (149)
                      +..+.|+..||..|...|-.
T Consensus        36 ~~~~~CgH~fC~~Ci~~~~~   55 (99)
T 2y43_A           36 MIIPQCSHNYCSLCIRKFLS   55 (99)
T ss_dssp             EECTTTCCEEEHHHHHHHHT
T ss_pred             CEECCCCCHhhHHHHHHHHH
Confidence            34457999999999999974


No 65 
>3u6p_A Formamidopyrimidine-DNA glycosylase; DNA glycosylase, DNA repair, sequence context; HET: DNA 08Q; 1.60A {Geobacillus stearothermophilus} PDB: 3u6d_A* 3u6c_A* 3u6l_A* 3u6m_A* 3u6o_A* 3u6e_A* 3u6q_A* 3u6s_A* 3gp1_A* 3sbj_A* 2f5q_A* 2f5s_A* 3gq4_A* 3gpy_A* 2f5n_A 2f5o_A 2f5p_A 3sau_A* 3sar_A* 3sav_A* ...
Probab=39.42  E-value=10  Score=30.84  Aligned_cols=14  Identities=36%  Similarity=0.895  Sum_probs=12.0

Q ss_pred             CcCCCCCCcceeec
Q psy15037        111 TKPCPSCRTATERA  124 (149)
Q Consensus       111 tK~CP~C~~~IEK~  124 (149)
                      -+|||.|.++|+|.
T Consensus       245 g~pC~~CG~~I~~~  258 (273)
T 3u6p_A          245 GNPCKRCGTPIEKT  258 (273)
T ss_dssp             TSBCTTTCCBCEEE
T ss_pred             cCCCCCCCCeEEEE
Confidence            37999999999873


No 66 
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.21  E-value=12  Score=19.88  Aligned_cols=23  Identities=30%  Similarity=0.541  Sum_probs=15.4

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+.+|-..-...-|
T Consensus         8 ~~k~~~C~~C~k~f~~~~~L~~H   30 (42)
T 2ytb_A            8 GEKPYRCDQCGKAFSQKGSLIVH   30 (42)
T ss_dssp             SCCSBCCTTTTCCBSSHHHHHTT
T ss_pred             CCCCeeCCCccchhCCHHHHHHH
Confidence            45667899998888765444444


No 67 
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A
Probab=38.93  E-value=15  Score=25.40  Aligned_cols=21  Identities=14%  Similarity=0.192  Sum_probs=16.2

Q ss_pred             HHHHHhcCcCCCCCCcceeec
Q psy15037        104 QVTIKVSTKPCPSCRTATERA  124 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK~  124 (149)
                      ..|+..+...||.|+.++..+
T Consensus        46 ~~~~~~~~~~CP~Cr~~~~~~   66 (118)
T 3hct_A           46 IKSIRDAGHKCPVDNEILLEN   66 (118)
T ss_dssp             HHHHHHHCSBCTTTCCBCCGG
T ss_pred             HHHHhhCCCCCCCCCCCcCHH
Confidence            356776666999999998764


No 68 
>1k82_A Formamidopyrimidine-DNA glycosylase; protein-DNA complex, DNA repair, beta sandwich, zinc finger, helix two-turns helix, hydrolase/DNA complex; HET: PED; 2.10A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8
Probab=38.62  E-value=11  Score=30.58  Aligned_cols=13  Identities=31%  Similarity=0.749  Sum_probs=11.8

Q ss_pred             cCCCCCCcceeec
Q psy15037        112 KPCPSCRTATERA  124 (149)
Q Consensus       112 K~CP~C~~~IEK~  124 (149)
                      +|||.|.++|+|.
T Consensus       241 ~pC~~CG~~I~~~  253 (268)
T 1k82_A          241 EPCRVCGTPIVAT  253 (268)
T ss_dssp             SBCTTTCCBCEEE
T ss_pred             CCCCCCCCEeeEE
Confidence            7899999999875


No 69 
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}
Probab=38.60  E-value=16  Score=25.30  Aligned_cols=20  Identities=25%  Similarity=0.639  Sum_probs=15.7

Q ss_pred             HHHHHhcCcCCCCCCcceee
Q psy15037        104 QVTIKVSTKPCPSCRTATER  123 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK  123 (149)
                      ..|+..+...||.|+.++..
T Consensus        80 ~~~~~~~~~~CP~Cr~~~~~   99 (124)
T 3fl2_A           80 DRSFRAQVFSCPACRYDLGR   99 (124)
T ss_dssp             HHHHHTTCCBCTTTCCBCCT
T ss_pred             HHHHhHCcCCCCCCCccCCC
Confidence            35666677799999999965


No 70 
>2xzf_A Formamidopyrimidine-DNA glycosylase; hydrolase-DNA complex; HET: VET; 1.80A {Lactococcus lactis subsp} PDB: 1pm5_A* 1xc8_A* 1pji_A* 2xzu_A* 3c58_A* 1tdz_A* 1nnj_A 1kfv_A 1pjj_A*
Probab=38.58  E-value=11  Score=30.57  Aligned_cols=14  Identities=14%  Similarity=0.603  Sum_probs=12.2

Q ss_pred             CcCCCCCCcceeec
Q psy15037        111 TKPCPSCRTATERA  124 (149)
Q Consensus       111 tK~CP~C~~~IEK~  124 (149)
                      -+|||.|.++|+|.
T Consensus       242 G~pC~~CG~~I~~~  255 (271)
T 2xzf_A          242 GEKCSRCGAEIQKI  255 (271)
T ss_dssp             TSBCTTTCCBCEEE
T ss_pred             CCCCCCCCCEeeEE
Confidence            38999999999875


No 71 
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}
Probab=38.41  E-value=6.5  Score=26.95  Aligned_cols=16  Identities=31%  Similarity=0.829  Sum_probs=14.2

Q ss_pred             ccCccccccccccccC
Q psy15037         15 ECGFVFCKDCLQGAHI   30 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH~   30 (149)
                      .|+..||..|...|-.
T Consensus        32 ~CgH~fC~~Ci~~~~~   47 (115)
T 3l11_A           32 PCNHTLCKPCFQSTVE   47 (115)
T ss_dssp             TTSCEECHHHHCCCCC
T ss_pred             CCCCHHhHHHHHHHHh
Confidence            6999999999999973


No 72 
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1
Probab=38.35  E-value=16  Score=24.68  Aligned_cols=23  Identities=22%  Similarity=0.351  Sum_probs=16.6

Q ss_pred             HHHHHh----cCcCCCCCCcceeecCC
Q psy15037        104 QVTIKV----STKPCPSCRTATERAGK  126 (149)
Q Consensus       104 ~~~I~~----ntK~CP~C~~~IEK~~G  126 (149)
                      ..|+..    ....||-|++.+.+..|
T Consensus        71 ~~wl~~~~~~~~~~CP~CR~~~~~~~g   97 (114)
T 1v87_A           71 LAMYCNGNKDGSLQCPSCKTIYGEKTG   97 (114)
T ss_dssp             HHHHHHTCCSSCCBCTTTCCBSSSCSS
T ss_pred             HHHHHcccCCCCCcCCCCCCccCCCCC
Confidence            467753    45689999999876554


No 73 
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A
Probab=38.25  E-value=11  Score=25.28  Aligned_cols=17  Identities=35%  Similarity=1.200  Sum_probs=10.9

Q ss_pred             cccCCccCccccccccc
Q psy15037         10 RIGCTECGFVFCKDCLQ   26 (149)
Q Consensus        10 ~v~Cp~C~~aFC~~Cke   26 (149)
                      +-.|-.||.+||..|-.
T Consensus        35 rHHCR~CG~v~C~~Cs~   51 (82)
T 2yw8_A           35 KHHCRNCGHIFCNTCSS   51 (82)
T ss_dssp             CEECTTTCCEECSGGGC
T ss_pred             cccCCCCCCEEChHHhC
Confidence            34566777777777743


No 74 
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1
Probab=38.20  E-value=11  Score=24.69  Aligned_cols=17  Identities=35%  Similarity=0.958  Sum_probs=11.2

Q ss_pred             CcccCCccCcccccccc
Q psy15037          9 KRIGCTECGFVFCKDCL   25 (149)
Q Consensus         9 ~~v~Cp~C~~aFC~~Ck   25 (149)
                      ++-.|-.||.+||..|-
T Consensus        26 RrHHCR~CG~v~C~~Cs   42 (73)
T 1vfy_A           26 RKHHCRSCGGVFCQEHS   42 (73)
T ss_dssp             CCEECTTTCCEECGGGS
T ss_pred             ccccCCCCCEEEccccc
Confidence            34456677777777773


No 75 
>1ee8_A MUTM (FPG) protein; beta sandwich, zinc finger, helix two-turns helix, riken STR genomics/proteomics initiative, RSGI, structural genomics; 1.90A {Thermus thermophilus} SCOP: a.156.1.2 b.113.1.1 g.39.1.8
Probab=37.99  E-value=11  Score=30.50  Aligned_cols=14  Identities=43%  Similarity=1.020  Sum_probs=12.3

Q ss_pred             CcCCCCCCcceeec
Q psy15037        111 TKPCPSCRTATERA  124 (149)
Q Consensus       111 tK~CP~C~~~IEK~  124 (149)
                      -+|||.|.++|+|.
T Consensus       235 g~pC~~CG~~I~~~  248 (266)
T 1ee8_A          235 GLPCPACGRPVERR  248 (266)
T ss_dssp             TSBCTTTCCBCEEE
T ss_pred             CCCCCCCCCEeeEE
Confidence            48999999999875


No 76 
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=37.86  E-value=4.7  Score=25.36  Aligned_cols=15  Identities=47%  Similarity=1.092  Sum_probs=13.3

Q ss_pred             ccCcccccccccccc
Q psy15037         15 ECGFVFCKDCLQGAH   29 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH   29 (149)
                      .|+..||..|...|-
T Consensus        32 ~CgH~fC~~Ci~~~~   46 (71)
T 2d8t_A           32 PCKHVFCYLCVKGAS   46 (71)
T ss_dssp             TTTEEEEHHHHHHCT
T ss_pred             cCCCHHHHHHHHHHH
Confidence            489999999999885


No 77 
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=37.59  E-value=14  Score=19.77  Aligned_cols=23  Identities=30%  Similarity=0.411  Sum_probs=15.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+.+|-..-....|
T Consensus         8 ~~k~~~C~~C~k~f~~~~~L~~H   30 (42)
T 2eos_A            8 GEKPYPCEICGTRFRHLQTLKSH   30 (42)
T ss_dssp             SSCCBCCSSSCCCBSSHHHHHHH
T ss_pred             CCCCEECCCCCCccCCHHHHHHH
Confidence            45667899999888765544444


No 78 
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=37.44  E-value=13  Score=19.72  Aligned_cols=18  Identities=33%  Similarity=0.663  Sum_probs=12.5

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+..|=..=
T Consensus         7 ~~k~~~C~~C~k~f~~~~   24 (42)
T 2yte_A            7 GEKPYSCAECKETFSDNN   24 (42)
T ss_dssp             SCCSCBCTTTCCBCSSHH
T ss_pred             CCCCeECCCCCCccCCHH
Confidence            345678888888886543


No 79 
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens}
Probab=43.56  E-value=7  Score=18.93  Aligned_cols=15  Identities=20%  Similarity=0.390  Sum_probs=9.7

Q ss_pred             cccCCccCccccccc
Q psy15037         10 RIGCTECGFVFCKDC   24 (149)
Q Consensus        10 ~v~Cp~C~~aFC~~C   24 (149)
                      ...|+.|+..|-..-
T Consensus         3 ~~~C~~C~k~f~~~~   17 (30)
T 2lvr_A            3 PYVCIHCQRQFADPG   17 (30)
Confidence            456777777775443


No 80 
>1k3x_A Endonuclease VIII; hydrolase/DNA, hydrolase-DNA complex; HET: BRU PED; 1.25A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 PDB: 1k3w_A* 1q39_A 2ea0_A* 2oq4_A* 1q3c_A 2opf_A* 1q3b_A*
Probab=37.32  E-value=12  Score=30.23  Aligned_cols=13  Identities=31%  Similarity=0.951  Sum_probs=11.5

Q ss_pred             cCCCCCCcceeec
Q psy15037        112 KPCPSCRTATERA  124 (149)
Q Consensus       112 K~CP~C~~~IEK~  124 (149)
                      +|||.|.++|+|.
T Consensus       235 ~pC~~CG~~I~~~  247 (262)
T 1k3x_A          235 EPCERCGSIIEKT  247 (262)
T ss_dssp             SBCTTTCCBCEEE
T ss_pred             CCCCCCCCEeEEE
Confidence            6899999999875


No 81 
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A
Probab=37.14  E-value=11  Score=27.30  Aligned_cols=17  Identities=41%  Similarity=1.275  Sum_probs=11.4

Q ss_pred             CcccCCccCcccccccc
Q psy15037          9 KRIGCTECGFVFCKDCL   25 (149)
Q Consensus         9 ~~v~Cp~C~~aFC~~Ck   25 (149)
                      ++-.|-.||.+||..|-
T Consensus        84 RrHHCR~CG~vfC~~Cs  100 (125)
T 1joc_A           84 RRHHCRQCGNIFCAECS  100 (125)
T ss_dssp             CCEECTTTCCEECGGGS
T ss_pred             ccccCCCCCeEEChHHh
Confidence            34456777777777774


No 82 
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*
Probab=36.99  E-value=17  Score=22.70  Aligned_cols=14  Identities=21%  Similarity=0.726  Sum_probs=11.6

Q ss_pred             cCcCCCCCCcceee
Q psy15037        110 STKPCPSCRTATER  123 (149)
Q Consensus       110 ntK~CP~C~~~IEK  123 (149)
                      ..+.||-|+.+|++
T Consensus        43 ~~~~CPiCR~~i~~   56 (63)
T 2vje_B           43 AGASCPICKKEIQL   56 (63)
T ss_dssp             TTCBCTTTCCBCCE
T ss_pred             hCCcCCCcCchhhc
Confidence            34899999999964


No 83 
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=36.92  E-value=14  Score=20.14  Aligned_cols=23  Identities=39%  Similarity=0.678  Sum_probs=16.3

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2enf_A            9 GEKPYKCNECGKVFTQNSHLVRH   31 (46)
T ss_dssp             CCCSCBCSSSCCBCSSHHHHHHH
T ss_pred             CCcCeECCCCCcccCCHHHHHHH
Confidence            45667899999988776554444


No 84 
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A
Probab=36.62  E-value=13  Score=19.87  Aligned_cols=23  Identities=30%  Similarity=0.553  Sum_probs=14.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+.+|=..-....|
T Consensus         7 ~~k~~~C~~C~k~f~~~~~L~~H   29 (42)
T 2el5_A            7 GENPYECSECGKAFNRKDQLISH   29 (42)
T ss_dssp             SCCSEECSSSCCEESSHHHHHHH
T ss_pred             CCCCccCCCcChhhCCHHHHHHH
Confidence            35667899998888654433333


No 85 
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A
Probab=36.53  E-value=5  Score=27.31  Aligned_cols=20  Identities=30%  Similarity=0.584  Sum_probs=16.1

Q ss_pred             cccCCccCcccccccccccc
Q psy15037         10 RIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus        10 ~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      .+....|+.+||..|...|-
T Consensus        28 p~~~~~CgH~fC~~Ci~~~~   47 (108)
T 2ckl_A           28 ATTIIECLHSFCKTCIVRYL   47 (108)
T ss_dssp             EEEETTTCCEEEHHHHHHHH
T ss_pred             cCEeCCCCChhhHHHHHHHH
Confidence            34445799999999999995


No 86 
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=36.42  E-value=13  Score=20.07  Aligned_cols=23  Identities=26%  Similarity=0.525  Sum_probs=15.6

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.++..|+.|+..|-..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (44)
T 2yu5_A            9 GENPFKCSKCDRVFTQRNYLVQH   31 (44)
T ss_dssp             CCCSEECSSSSCEESSSHHHHHH
T ss_pred             CCCCeECCCCCchhCCHHHHHHH
Confidence            45668899999888765444434


No 87 
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B
Probab=36.03  E-value=18  Score=26.30  Aligned_cols=19  Identities=26%  Similarity=0.704  Sum_probs=15.5

Q ss_pred             HHHHHhcCcCCCCCCccee
Q psy15037        104 QVTIKVSTKPCPSCRTATE  122 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IE  122 (149)
                      ..|+......||.|+.+|.
T Consensus        83 ~~~~~~~~~~CP~Cr~~~~  101 (165)
T 2ckl_B           83 ITALRSGNKECPTCRKKLV  101 (165)
T ss_dssp             HHHHHTTCCBCTTTCCBCC
T ss_pred             HHHHHhCcCCCCCCCCcCC
Confidence            4677766788999999984


No 88 
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A
Probab=35.94  E-value=14  Score=19.55  Aligned_cols=17  Identities=18%  Similarity=0.280  Sum_probs=12.1

Q ss_pred             CCcccCCccCccccccc
Q psy15037          8 CKRIGCTECGFVFCKDC   24 (149)
Q Consensus         8 ~~~v~Cp~C~~aFC~~C   24 (149)
                      .+...|+.|+..|=..-
T Consensus         4 ~k~~~C~~C~k~f~~~~   20 (39)
T 1njq_A            4 PRSYTCSFCKREFRSAQ   20 (39)
T ss_dssp             SSSEECTTTCCEESSHH
T ss_pred             CCceECCCCCcccCCHH
Confidence            45678888888886544


No 89 
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis}
Probab=35.72  E-value=34  Score=22.58  Aligned_cols=23  Identities=13%  Similarity=0.135  Sum_probs=19.9

Q ss_pred             CcCCCCCCcceeecCCcceeEeC
Q psy15037        111 TKPCPSCRTATERAGKGVYAYDL  133 (149)
Q Consensus       111 tK~CP~C~~~IEK~~GCNhM~~~  133 (149)
                      .-.||.|+.+++-+...+.++|.
T Consensus         8 iL~CP~ck~~L~~~~~~~~LiC~   30 (68)
T 2jr6_A            8 ILVCPVTKGRLEYHQDKQELWSR   30 (68)
T ss_dssp             CCBCSSSCCBCEEETTTTEEEET
T ss_pred             heECCCCCCcCeEeCCCCEEEcC
Confidence            34799999999999888999993


No 90 
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1
Probab=35.64  E-value=18  Score=24.66  Aligned_cols=21  Identities=33%  Similarity=0.493  Sum_probs=16.0

Q ss_pred             HHHHHhcCcCCCCCCcceeec
Q psy15037        104 QVTIKVSTKPCPSCRTATERA  124 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK~  124 (149)
                      ..|+......||.|+.++...
T Consensus        51 ~~~~~~~~~~CP~Cr~~~~~~   71 (116)
T 1rmd_A           51 LRCLKVMGSYCPSCRYPCFPT   71 (116)
T ss_dssp             HHHHHHTCSBCTTTCCBCCGG
T ss_pred             HHHHhHCcCcCCCCCCCCCHh
Confidence            456666567899999998653


No 91 
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major}
Probab=35.57  E-value=13  Score=25.06  Aligned_cols=14  Identities=50%  Similarity=1.516  Sum_probs=8.3

Q ss_pred             ccCCccCccccccc
Q psy15037         11 IGCTECGFVFCKDC   24 (149)
Q Consensus        11 v~Cp~C~~aFC~~C   24 (149)
                      -.|-.|+.+||..|
T Consensus        38 HHCR~CG~v~C~~C   51 (84)
T 1z2q_A           38 HHCRNCGYVLCGDC   51 (84)
T ss_dssp             EECTTTCCEECTGG
T ss_pred             ccccCCCcEEChHH
Confidence            34556666666666


No 92 
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=41.79  E-value=7.8  Score=18.82  Aligned_cols=13  Identities=31%  Similarity=0.769  Sum_probs=8.1

Q ss_pred             ccCCccCcccccc
Q psy15037         11 IGCTECGFVFCKD   23 (149)
Q Consensus        11 v~Cp~C~~aFC~~   23 (149)
                      ..|+.|+.+|-..
T Consensus         3 ~~C~~C~k~f~~~   15 (29)
T 2lvt_A            3 CQCVMCGKAFTQA   15 (29)
Confidence            4677777766543


No 93 
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A
Probab=35.47  E-value=14  Score=19.63  Aligned_cols=17  Identities=29%  Similarity=0.614  Sum_probs=12.4

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|-..
T Consensus         8 ~~~~~~C~~C~k~f~~~   24 (42)
T 2epc_A            8 GETPYLCGQCGKSFTQR   24 (42)
T ss_dssp             SSCCEECSSSCCEESSH
T ss_pred             CCCCeECCCCCcccCCH
Confidence            34567899998888654


No 94 
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2}
Probab=35.43  E-value=24  Score=24.49  Aligned_cols=15  Identities=47%  Similarity=0.979  Sum_probs=12.6

Q ss_pred             cCCCCCCcceeecCC
Q psy15037        112 KPCPSCRTATERAGK  126 (149)
Q Consensus       112 K~CP~C~~~IEK~~G  126 (149)
                      ..||.|..+|+.+++
T Consensus         3 ~~CP~C~~~l~~~~~   17 (81)
T 2jrp_A            3 ITCPVCHHALERNGD   17 (81)
T ss_dssp             CCCSSSCSCCEECSS
T ss_pred             CCCCCCCCccccCCC
Confidence            578999999888877


No 95 
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=35.31  E-value=5.7  Score=24.67  Aligned_cols=16  Identities=25%  Similarity=0.779  Sum_probs=13.9

Q ss_pred             ccCccccccccccccC
Q psy15037         15 ECGFVFCKDCLQGAHI   30 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH~   30 (149)
                      .|+..||..|...|-.
T Consensus        31 ~CgH~fc~~Ci~~~~~   46 (70)
T 2ecn_A           31 PCAHSFCQKCIDKWSD   46 (70)
T ss_dssp             TTTEEECHHHHHHSSC
T ss_pred             CCCCcccHHHHHHHHH
Confidence            4889999999999964


No 96 
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=35.31  E-value=16  Score=19.97  Aligned_cols=23  Identities=35%  Similarity=0.670  Sum_probs=15.2

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|-..=...-|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2yth_A            9 GEKPFQCEECGKRFTQNSHLHSH   31 (46)
T ss_dssp             CSSSBCCSSSCCCBSSHHHHHHH
T ss_pred             CCcCCCCCCCCcccCCHHHHHHH
Confidence            35667899998888665443333


No 97 
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=35.24  E-value=15  Score=19.61  Aligned_cols=19  Identities=32%  Similarity=0.586  Sum_probs=13.5

Q ss_pred             CCCcccCCccCcccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCL   25 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Ck   25 (149)
                      +.+...|+.|+..|=..-.
T Consensus         8 ~~k~~~C~~C~k~f~~~~~   26 (42)
T 2en2_A            8 GEKPYKCETCGARFVQVAH   26 (42)
T ss_dssp             SSCSEECTTTCCEESSHHH
T ss_pred             CCCCEeCCCcChhhCCHHH
Confidence            4566789999888865443


No 98 
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=35.20  E-value=14  Score=20.15  Aligned_cols=23  Identities=35%  Similarity=0.592  Sum_probs=15.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2eow_A            9 GEKPYKCNECGKAFRARSSLAIH   31 (46)
T ss_dssp             CCCCEECTTSCCEESSHHHHHHH
T ss_pred             CCCCeeccccCChhcCHHHHHHH
Confidence            45667899999888765544444


No 99 
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=34.90  E-value=22  Score=18.78  Aligned_cols=18  Identities=33%  Similarity=0.687  Sum_probs=12.9

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+..|=..-
T Consensus         7 ~~k~~~C~~C~k~f~~~~   24 (41)
T 2ept_A            7 GQRVYECQECGKSFRQKG   24 (41)
T ss_dssp             CCCCEECSSSCCEESSHH
T ss_pred             CCCCeECCCCCCCcCCHH
Confidence            456678998888885543


No 100
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1
Probab=34.83  E-value=12  Score=27.36  Aligned_cols=20  Identities=25%  Similarity=0.766  Sum_probs=14.5

Q ss_pred             CcccCCccCccccccccccc
Q psy15037          9 KRIGCTECGFVFCKDCLQGA   28 (149)
Q Consensus         9 ~~v~Cp~C~~aFC~~Cke~W   28 (149)
                      ++-.|-.||.+||..|-...
T Consensus        34 RkHHCR~CG~ifC~~Cs~~~   53 (120)
T 1y02_A           34 RKQTCLDCKKNFCMTCSSQV   53 (120)
T ss_dssp             GCEECTTTCCEECGGGEEC-
T ss_pred             ccccCCCCCCeeCHHHhCCC
Confidence            44568889999999996544


No 101
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B
Probab=34.65  E-value=12  Score=21.29  Aligned_cols=24  Identities=29%  Similarity=0.499  Sum_probs=17.3

Q ss_pred             CCCcccCCccCccccccccccccC
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAHI   30 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH~   30 (149)
                      +.++..|+.|+.+|=..-.-.-|.
T Consensus         5 gekp~~C~~CgK~F~~~s~L~~H~   28 (36)
T 1fv5_A            5 KPARFMCLPCGIAFSSPSTLEAHQ   28 (36)
T ss_dssp             SCCCCEETTTTEECSCHHHHHHHH
T ss_pred             CccCeECCCCCCccCCHhHccCcC
Confidence            456789999999997665544443


No 102
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=34.61  E-value=14  Score=19.80  Aligned_cols=23  Identities=30%  Similarity=0.453  Sum_probs=14.9

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (44)
T 2eof_A            9 GEKPYECNECQKAFNTKSNLMVH   31 (44)
T ss_dssp             CCCSEECTTTCCEESCHHHHHHH
T ss_pred             CCCCeECCCCCcccCCHhHHHHH
Confidence            35567899998888655433333


No 103
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=34.48  E-value=15  Score=19.71  Aligned_cols=23  Identities=35%  Similarity=0.567  Sum_probs=14.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (44)
T 2en7_A            9 GMKPYVCNECGKAFRSKSYLIIH   31 (44)
T ss_dssp             SSSSSCCTTTCCCCSSHHHHHHH
T ss_pred             CCcCeECCCCCCccCCHHHHHHH
Confidence            34567888888888655443333


No 104
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=34.29  E-value=16  Score=19.97  Aligned_cols=23  Identities=39%  Similarity=0.733  Sum_probs=15.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2yti_A            9 GEKPYKCNECGKVFTQNSHLARH   31 (46)
T ss_dssp             CCCTTCCSSSCCCCSSHHHHHHH
T ss_pred             CCcCeECCCCCcccCChhHHHHH
Confidence            35567899999888765544444


No 105
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1
Probab=34.18  E-value=14  Score=17.39  Aligned_cols=11  Identities=27%  Similarity=0.643  Sum_probs=7.3

Q ss_pred             cCCccCccccc
Q psy15037         12 GCTECGFVFCK   22 (149)
Q Consensus        12 ~Cp~C~~aFC~   22 (149)
                      .|+.|+..|-.
T Consensus         3 ~C~~C~k~f~~   13 (27)
T 1znf_A            3 KCGLCERSFVE   13 (27)
T ss_dssp             BCSSSCCBCSS
T ss_pred             cCCCCCCcCCC
Confidence            57777777654


No 106
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=34.15  E-value=16  Score=20.03  Aligned_cols=23  Identities=30%  Similarity=0.455  Sum_probs=15.9

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2eon_A            9 GEKPYKCQVCGKAFRVSSHLVQH   31 (46)
T ss_dssp             SCCSCBCSSSCCBCSSHHHHHHH
T ss_pred             CCcccCCCCCCcccCcHHHHHHH
Confidence            34667899999888765544444


No 107
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.94  E-value=15  Score=19.95  Aligned_cols=23  Identities=35%  Similarity=0.626  Sum_probs=15.7

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~~~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2yrj_A            9 GEKPYRCGECGKAFAQKANLTQH   31 (46)
T ss_dssp             CCCCEECSSSCCEESSHHHHHHH
T ss_pred             CCCCeECCCCCCccCCHHHHHHH
Confidence            35567899999888665544444


No 108
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.84  E-value=19  Score=19.70  Aligned_cols=18  Identities=22%  Similarity=0.445  Sum_probs=12.8

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+..|=..=
T Consensus         9 ~~k~~~C~~C~k~F~~~~   26 (46)
T 2elz_A            9 VEKPYKCEDCGKGYNRRL   26 (46)
T ss_dssp             CCSSCBCSSSCCBCSSHH
T ss_pred             CCCCeeCcccCchhCCHH
Confidence            456678988888885543


No 109
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus}
Probab=33.84  E-value=15  Score=27.79  Aligned_cols=21  Identities=43%  Similarity=0.937  Sum_probs=17.7

Q ss_pred             CCcccCCccCcccccccccccc
Q psy15037          8 CKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         8 ~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      .+.++|.+|++.+|..|. .|+
T Consensus        83 ~~g~~C~~C~~~VC~~C~-~~~  103 (153)
T 2zet_C           83 NSRRQCLECSLFVCKSCS-HAH  103 (153)
T ss_dssp             SCCEECTTTCCEECGGGE-ECC
T ss_pred             CCCCcCCCCCchhhcccc-ccc
Confidence            456789999999999998 466


No 110
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.80  E-value=18  Score=19.76  Aligned_cols=23  Identities=35%  Similarity=0.551  Sum_probs=15.7

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2emg_A            9 GENPFICSECGKVFTHKTNLIIH   31 (46)
T ss_dssp             SCCSCBCTTTCCBCSSHHHHHHH
T ss_pred             CCCCEECCccCcccCCHHHHHHH
Confidence            34567899999888765544444


No 111
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.78  E-value=17  Score=19.80  Aligned_cols=23  Identities=39%  Similarity=0.608  Sum_probs=15.2

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (44)
T 2epv_A            9 GEKPYECNECGKAFIWKSLLIVH   31 (44)
T ss_dssp             CCCSEECSSSCCEESSHHHHHHH
T ss_pred             CCcCeECCCCCcccCchHHHHHH
Confidence            45667899999888654443334


No 112
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.76  E-value=17  Score=19.76  Aligned_cols=17  Identities=35%  Similarity=0.728  Sum_probs=11.7

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|=..
T Consensus         9 ~~~~~~C~~C~k~f~~~   25 (46)
T 2eov_A            9 GEKPYKCSDCGKSFTWK   25 (46)
T ss_dssp             SCCSCBCSSSCCBCSSH
T ss_pred             CCCCccCCccChhhCCH
Confidence            34567888888887543


No 113
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.71  E-value=15  Score=19.93  Aligned_cols=23  Identities=30%  Similarity=0.478  Sum_probs=16.0

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2ytf_A            9 GEKPFECSECQKAFNTKSNLIVH   31 (46)
T ss_dssp             CCCSEECSSSCCEESSHHHHHHH
T ss_pred             CCCCcCCCCCCcccCCHHHHHHH
Confidence            45668899999988765544444


No 114
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens}
Probab=33.64  E-value=15  Score=20.86  Aligned_cols=23  Identities=22%  Similarity=0.254  Sum_probs=17.5

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+.+|-..-....|
T Consensus         4 ~~kp~~C~~C~k~F~~~~~L~~H   26 (48)
T 3iuf_A            4 RDKPYACDICGKRYKNRPGLSYH   26 (48)
T ss_dssp             TTSCEECTTTCCEESSHHHHHHH
T ss_pred             CCcCEECCCcCcccCCHHHHHHH
Confidence            45678899999999876665555


No 115
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=33.44  E-value=14  Score=24.70  Aligned_cols=13  Identities=46%  Similarity=1.487  Sum_probs=7.0

Q ss_pred             cCCccCccccccc
Q psy15037         12 GCTECGFVFCKDC   24 (149)
Q Consensus        12 ~Cp~C~~aFC~~C   24 (149)
                      -|-.||.+||..|
T Consensus        32 HCR~CG~vfC~~C   44 (84)
T 1x4u_A           32 SCSNCGNSFCSRC   44 (84)
T ss_dssp             ECSSSCCEECTTT
T ss_pred             hhcCCCcEEChhh
Confidence            3445555555555


No 116
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A
Probab=33.38  E-value=16  Score=20.02  Aligned_cols=23  Identities=35%  Similarity=0.654  Sum_probs=15.7

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2emj_A            9 GEKPFECAECGKSFSISSQLATH   31 (46)
T ss_dssp             CCCSEECSSSSCEESSHHHHHHH
T ss_pred             CCCCEECCCCCcccCCHHHHHHH
Confidence            35668899999988665444444


No 117
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.38  E-value=16  Score=19.94  Aligned_cols=23  Identities=35%  Similarity=0.676  Sum_probs=15.9

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2eq2_A            9 GGKPYQCNECGKAFSQTSKLARH   31 (46)
T ss_dssp             SSCSSSCCSSCCCCSSHHHHHHH
T ss_pred             CCCCeECCCCCcccCCHHHHHHH
Confidence            34567899999888765554444


No 118
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.31  E-value=15  Score=19.93  Aligned_cols=23  Identities=35%  Similarity=0.586  Sum_probs=16.1

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+.+|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2yts_A            9 GEKPYICNECGKSFIQKSHLNRH   31 (46)
T ss_dssp             SCCSEECSSSCCEESSHHHHHHH
T ss_pred             CCcCEECCCCChhhCChHHHHHH
Confidence            35667899999988765544444


No 119
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.28  E-value=18  Score=19.83  Aligned_cols=23  Identities=26%  Similarity=0.449  Sum_probs=16.0

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2enh_A            9 GEKPYECDVCRKAFSHHASLTQH   31 (46)
T ss_dssp             CSSSCBCTTTCCBCSSSHHHHHH
T ss_pred             CCCCcCCCCcCchhCCHHHHHHH
Confidence            45668899999888765544444


No 120
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A*
Probab=33.22  E-value=13  Score=29.17  Aligned_cols=15  Identities=40%  Similarity=1.296  Sum_probs=9.3

Q ss_pred             cccCCccCccccccc
Q psy15037         10 RIGCTECGFVFCKDC   24 (149)
Q Consensus        10 ~v~Cp~C~~aFC~~C   24 (149)
                      +-.|-.||.+||..|
T Consensus       180 rhHCR~CG~v~C~~C  194 (226)
T 3zyq_A          180 KHHCRACGQIFCGKC  194 (226)
T ss_dssp             CEECTTTCCEECTTT
T ss_pred             ccccCCCcCEeChhh
Confidence            344666666666666


No 121
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.14  E-value=16  Score=20.01  Aligned_cols=23  Identities=30%  Similarity=0.661  Sum_probs=15.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2ytp_A            9 GERHYECSECGKAFARKSTLIMH   31 (46)
T ss_dssp             CCCCEECSSSCCEESSHHHHHHH
T ss_pred             CCCCeECCcCCcccCCHHHHHHH
Confidence            34667899999888665544444


No 122
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.00  E-value=18  Score=19.77  Aligned_cols=23  Identities=30%  Similarity=0.531  Sum_probs=15.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|-..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2em6_A            9 GEKCYKCDVCGKEFSQSSHLQTH   31 (46)
T ss_dssp             CCCCCBCSSSCCBCSSHHHHHHH
T ss_pred             CCCCeECCCCCcccCCHHHHHHH
Confidence            35567899999988765544444


No 123
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.98  E-value=16  Score=19.84  Aligned_cols=23  Identities=43%  Similarity=0.716  Sum_probs=14.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.++..|+.|+..|-..=....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2epw_A            9 GEKPCKCTECGKAFCWKSQLIMH   31 (46)
T ss_dssp             CCCSEECSSSCCEESSSHHHHHH
T ss_pred             CCCCeeCCCCCCccCCHHHHHHH
Confidence            34567899888888655433333


No 124
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.96  E-value=16  Score=19.97  Aligned_cols=23  Identities=30%  Similarity=0.691  Sum_probs=15.5

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~~~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2emi_A            9 GERHYECSECGKAFIQKSTLSMH   31 (46)
T ss_dssp             SCCCEECSSSCCEESSHHHHHHH
T ss_pred             CCCCCCCCCCCcccCCHHHHHHH
Confidence            34567899999888765444444


No 125
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.84  E-value=17  Score=19.85  Aligned_cols=23  Identities=35%  Similarity=0.586  Sum_probs=15.7

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2eq1_A            9 GEKPYKCNECGKAFRAHSNLTTH   31 (46)
T ss_dssp             CSCCCCCTTTTCCCSSHHHHHHH
T ss_pred             CCCCeECCcCChhhCCHHHHHHH
Confidence            45667899998888665544444


No 126
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=32.82  E-value=16  Score=19.73  Aligned_cols=23  Identities=26%  Similarity=0.339  Sum_probs=15.1

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|-..=....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (44)
T 2emb_A            9 TRKRYECSKCQATFNLRKHLIQH   31 (44)
T ss_dssp             CCSSEECTTTCCEESCHHHHHHH
T ss_pred             CCCCeECCCCCCccCCHHHHHHH
Confidence            34567899999888654433333


No 127
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.81  E-value=16  Score=19.95  Aligned_cols=23  Identities=26%  Similarity=0.502  Sum_probs=15.3

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.++..|+.|+.+|=..-...-|
T Consensus         9 ~~~~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2em3_A            9 GEKPYECKVCSKAFTQKAHLAQH   31 (46)
T ss_dssp             SCCSEECSSSCCEESSHHHHHHH
T ss_pred             CCcCeECCCCCcccCCHHHHHHH
Confidence            35667899999888665443333


No 128
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.80  E-value=16  Score=19.90  Aligned_cols=23  Identities=35%  Similarity=0.557  Sum_probs=15.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2ep3_A            9 GEKPYRCAECGKAFTDRSNLFTH   31 (46)
T ss_dssp             CCCSEECSSSCCEESSHHHHHHH
T ss_pred             CCCCeECCCCCchhCCHHHHHHH
Confidence            34567899999888765544444


No 129
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A
Probab=32.79  E-value=19  Score=19.72  Aligned_cols=18  Identities=39%  Similarity=0.778  Sum_probs=12.2

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+..|=..=
T Consensus         9 ~~k~~~C~~C~k~f~~~~   26 (46)
T 2ely_A            9 GEKPFKCVECGKGFSRRS   26 (46)
T ss_dssp             CCCSBCCSSSCCCBSSTT
T ss_pred             CCCCcccCccCcccCCHH
Confidence            445678888888775443


No 130
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.67  E-value=19  Score=19.69  Aligned_cols=23  Identities=30%  Similarity=0.455  Sum_probs=15.0

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2eoh_A            9 GKKPYECKECRKTFIQIGHLNQH   31 (46)
T ss_dssp             CSCSCCCSSSCCCCSSHHHHHHH
T ss_pred             CCCCcCCCCcCchhCCHHHHHHH
Confidence            34567898888888665443334


No 131
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.67  E-value=18  Score=19.70  Aligned_cols=23  Identities=39%  Similarity=0.736  Sum_probs=14.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..=....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2ytn_A            9 GKKPYKCNECGKVFTQNSHLARH   31 (46)
T ss_dssp             CCSSCBCTTTCCBCSSHHHHHHH
T ss_pred             CCcCeECCCCCCeeCCHHHHHHH
Confidence            35567888888888654433333


No 132
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1
Probab=32.56  E-value=15  Score=18.82  Aligned_cols=12  Identities=33%  Similarity=0.836  Sum_probs=7.9

Q ss_pred             ccCCccCccccc
Q psy15037         11 IGCTECGFVFCK   22 (149)
Q Consensus        11 v~Cp~C~~aFC~   22 (149)
                      ..|+.|+..|-.
T Consensus         3 ~~C~~C~k~F~~   14 (33)
T 1rim_A            3 FACPECPKRFMR   14 (33)
T ss_dssp             CCCSSSCCCCSS
T ss_pred             ccCCCCCchhCC
Confidence            467777777744


No 133
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.43  E-value=21  Score=19.40  Aligned_cols=19  Identities=37%  Similarity=0.719  Sum_probs=12.8

Q ss_pred             CCCcccCCccCcccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCL   25 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Ck   25 (149)
                      +.+...|+.|+..|=..-.
T Consensus         9 ~~k~~~C~~C~k~F~~~~~   27 (47)
T 2epx_A            9 GKKPYECIECGKAFIQNTS   27 (47)
T ss_dssp             CCCSBCCSSSCCCBSSHHH
T ss_pred             CCCCEECCccCchhCChHH
Confidence            3456788888888755443


No 134
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=32.35  E-value=17  Score=19.88  Aligned_cols=23  Identities=30%  Similarity=0.538  Sum_probs=14.9

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..=....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2em4_A            9 GQRPYECIECGKAFKTKSSLICH   31 (46)
T ss_dssp             CSSSEECSSSCCEESSHHHHHHH
T ss_pred             CCcCcCCCCCCCccCCHHHHHHH
Confidence            34667899998888654433333


No 135
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.35  E-value=17  Score=19.74  Aligned_cols=23  Identities=35%  Similarity=0.654  Sum_probs=15.1

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|-..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2ep1_A            9 GEKPYECSDCGKSFIKKSQLHVH   31 (46)
T ss_dssp             SCCSSCCSSSCCCCSSHHHHHHH
T ss_pred             CCCCcCCCCCCchhCCHHHHHHH
Confidence            34567899888888665444334


No 136
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A
Probab=32.32  E-value=26  Score=21.81  Aligned_cols=14  Identities=43%  Similarity=1.073  Sum_probs=11.6

Q ss_pred             cCcCCCCCCcceee
Q psy15037        110 STKPCPSCRTATER  123 (149)
Q Consensus       110 ntK~CP~C~~~IEK  123 (149)
                      ..+.||-|+.+|++
T Consensus        44 ~~~~CPiCR~~i~~   57 (64)
T 2vje_A           44 RNKPCPVCRQPIQM   57 (64)
T ss_dssp             TTCCCTTTCCCCCE
T ss_pred             cCCcCCCcCcchhc
Confidence            45789999999964


No 137
>2l8e_A Polyhomeotic-like protein 1; DNA binding protein; NMR {Homo sapiens}
Probab=32.22  E-value=6  Score=24.98  Aligned_cols=11  Identities=27%  Similarity=0.736  Sum_probs=8.1

Q ss_pred             CCcccCCccCc
Q psy15037          8 CKRIGCTECGF   18 (149)
Q Consensus         8 ~~~v~Cp~C~~   18 (149)
                      ..+..|+.|+.
T Consensus        16 ~~~~~C~~CG~   26 (49)
T 2l8e_A           16 ANLLKCEYCGK   26 (49)
T ss_dssp             CSEEECTTTCC
T ss_pred             CCCCcChhccC
Confidence            45567998886


No 138
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.10  E-value=17  Score=19.77  Aligned_cols=23  Identities=39%  Similarity=0.722  Sum_probs=14.9

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.++..|+.|+.+|=..=....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2ene_A            9 GEKPYKCNECGKVFRHNSYLSRH   31 (46)
T ss_dssp             CSSSEECSSSCCEESSHHHHHHH
T ss_pred             CCCCeECCCCCchhCChHHHHHH
Confidence            45667899888888654433333


No 139
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.07  E-value=17  Score=19.75  Aligned_cols=18  Identities=39%  Similarity=0.802  Sum_probs=12.3

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+.+|=..=
T Consensus         9 ~~k~~~C~~C~k~f~~~~   26 (46)
T 2ytr_A            9 GEKPYKCNECGKAFSQTS   26 (46)
T ss_dssp             SCCTTCCTTTCCCCSSHH
T ss_pred             CCcCcCCCCCCCccCCHH
Confidence            345678888888875543


No 140
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.94  E-value=18  Score=19.74  Aligned_cols=20  Identities=30%  Similarity=0.539  Sum_probs=13.5

Q ss_pred             CCCcccCCccCccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQ   26 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke   26 (149)
                      +.+...|+.|+..|=..-..
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L   28 (46)
T 2en9_A            9 GKKLFKCNECKKTFTQSSSL   28 (46)
T ss_dssp             SSCCCBCTTTCCBCSSHHHH
T ss_pred             CCCCEECCccCcccCCHHHH
Confidence            34567888888888654433


No 141
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A
Probab=31.90  E-value=32  Score=21.66  Aligned_cols=27  Identities=22%  Similarity=0.501  Sum_probs=20.1

Q ss_pred             CCCCCcccCCccC----ccccccccccccCC
Q psy15037          5 EDGCKRIGCTECG----FVFCKDCLQGAHIG   31 (149)
Q Consensus         5 e~~~~~v~Cp~C~----~aFC~~Cke~WH~g   31 (149)
                      +++.....|..|+    ..+|-.|-..||..
T Consensus         4 ~~d~~~~~C~vC~~~g~ll~Cd~C~~~fH~~   34 (61)
T 1mm2_A            4 GSDHHMEFCRVCKDGGELLCCDTCPSSYHIH   34 (61)
T ss_dssp             CSCSSCSSCTTTCCCSSCBCCSSSCCCBCSS
T ss_pred             cccCCCCcCCCCCCCCCEEEcCCCCHHHccc
Confidence            3455566787776    78999999999943


No 142
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.85  E-value=14  Score=19.89  Aligned_cols=23  Identities=35%  Similarity=0.616  Sum_probs=15.2

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|-..=....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (44)
T 2eoj_A            9 GENPYECCECGKVFSRKDQLVSH   31 (44)
T ss_dssp             SCCSCEETTTTEECSSHHHHHHH
T ss_pred             CCcCeeCCCCCCccCCHHHHHHH
Confidence            34567899999888765443334


No 143
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens}
Probab=31.83  E-value=18  Score=19.69  Aligned_cols=23  Identities=30%  Similarity=0.585  Sum_probs=14.7

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.++..|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2em0_A            9 GEKTWKCRECDMCFSQASSLRLH   31 (46)
T ss_dssp             CCCCCCCSSSCCCCSSHHHHHHH
T ss_pred             CCcCeECCCCCcccCCHHHHHHH
Confidence            34567888888888654433333


No 144
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=31.82  E-value=17  Score=19.83  Aligned_cols=23  Identities=22%  Similarity=0.327  Sum_probs=15.1

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-...-|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2eoy_A            9 KEKCFKCNKCEKTFSCSKYLTQH   31 (46)
T ss_dssp             CSCCEECSSSCCEESSSHHHHHH
T ss_pred             CCCCEECcCCCCcCCCHHHHHHH
Confidence            34567899999888655443333


No 145
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.75  E-value=19  Score=19.59  Aligned_cols=23  Identities=30%  Similarity=0.618  Sum_probs=14.6

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+.+|=..=....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2epz_A            9 GEKPFDCIDCGKAFSDHIGLNQH   31 (46)
T ss_dssp             CCCSBCCTTTCCCBSSHHHHHHH
T ss_pred             CCCCeECCCCCceeCCHHHHHHH
Confidence            34567888888888654433333


No 146
>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi}
Probab=31.74  E-value=15  Score=24.63  Aligned_cols=15  Identities=13%  Similarity=0.497  Sum_probs=11.3

Q ss_pred             CCCcccCCccCcccc
Q psy15037          7 GCKRIGCTECGFVFC   21 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC   21 (149)
                      +...+.||+|+..|=
T Consensus        37 ~~g~~~CpYCg~~f~   51 (67)
T 2jrr_A           37 DTGWVECPYCDCKYV   51 (67)
T ss_dssp             TTSEEEETTTTEEEE
T ss_pred             CCCeEECCCCCCEEE
Confidence            346788999988873


No 147
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A
Probab=31.73  E-value=17  Score=19.70  Aligned_cols=23  Identities=35%  Similarity=0.491  Sum_probs=14.9

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.++..|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2em9_A            9 GEKPYNCKECGKSFRWASCLLKH   31 (46)
T ss_dssp             CCCSEECSSSCCEESSHHHHHHH
T ss_pred             CCcCeECCccccccCChHHHHHH
Confidence            45667899888888654433333


No 148
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.71  E-value=20  Score=19.62  Aligned_cols=23  Identities=39%  Similarity=0.728  Sum_probs=14.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2ytq_A            9 GEKPYGCSECGKAFSSKSYLIIH   31 (46)
T ss_dssp             CCCSCBCSSSCCBCSCHHHHHHH
T ss_pred             CCCCcCCCccChhhCChHHHHHH
Confidence            45667898888888654433333


No 149
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.68  E-value=17  Score=19.82  Aligned_cols=19  Identities=32%  Similarity=0.585  Sum_probs=13.1

Q ss_pred             CCCcccCCccCcccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCL   25 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Ck   25 (149)
                      +.+...|+.|+..|=..=.
T Consensus         9 ~~k~~~C~~C~k~f~~~~~   27 (46)
T 2eml_A            9 GEKPYECSVCGKAFSHRQS   27 (46)
T ss_dssp             SCCSEECSSSCCEESSHHH
T ss_pred             CCCCeeCCCcCCccCCHHH
Confidence            3556789888888865443


No 150
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.62  E-value=15  Score=20.03  Aligned_cols=23  Identities=30%  Similarity=0.580  Sum_probs=15.7

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2eq3_A            9 GEKPYECNQCGKAFSVRSSLTTH   31 (46)
T ss_dssp             CCCSSEETTTTEECSSHHHHHHH
T ss_pred             CCCCeECCCCChhhCCHHHHHHH
Confidence            35567899999988765544444


No 151
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A
Probab=31.61  E-value=19  Score=19.64  Aligned_cols=18  Identities=39%  Similarity=0.789  Sum_probs=12.1

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.++..|+.|+..|=..=
T Consensus         9 ~~k~~~C~~C~k~F~~~~   26 (46)
T 2emk_A            9 GEKPYECKECGKAFSQTT   26 (46)
T ss_dssp             SSCSCBCSSSCCBCSCHH
T ss_pred             CCCceECCCCCchhCCHH
Confidence            345678888888775543


No 152
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor}
Probab=31.61  E-value=48  Score=20.98  Aligned_cols=20  Identities=20%  Similarity=0.411  Sum_probs=16.2

Q ss_pred             cCCCCCCcceeecCCcceeEeC
Q psy15037        112 KPCPSCRTATERAGKGVYAYDL  133 (149)
Q Consensus       112 K~CP~C~~~IEK~~GCNhM~~~  133 (149)
                      -.||.|+.+.+-+.  +..+|.
T Consensus        11 L~CP~c~~~L~~~~--~~L~C~   30 (56)
T 2kpi_A           11 LACPACHAPLEERD--AELICT   30 (56)
T ss_dssp             CCCSSSCSCEEEET--TEEEEC
T ss_pred             eeCCCCCCcceecC--CEEEcC
Confidence            47999999988777  667776


No 153
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.57  E-value=17  Score=19.88  Aligned_cols=23  Identities=30%  Similarity=0.613  Sum_probs=15.5

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.++..|+.|+..|-..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2yto_A            9 GEKPYKCSDCGKAFTRKSGLHIH   31 (46)
T ss_dssp             SCCCEECSSSCCEESSHHHHHHH
T ss_pred             CCCCEECcccCCccCCHhHHHHH
Confidence            35567899999888765444333


No 154
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.40  E-value=19  Score=19.50  Aligned_cols=23  Identities=35%  Similarity=0.524  Sum_probs=14.5

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~~~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2eop_A            9 GEKPHECRECGKSFSFNSQLIVH   31 (46)
T ss_dssp             CCCSCBCTTTCCBCSSHHHHHHH
T ss_pred             CCCCeeCCCCCchhCCHHHHHHH
Confidence            34567888888888654433333


No 155
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.34  E-value=17  Score=19.79  Aligned_cols=20  Identities=30%  Similarity=0.491  Sum_probs=13.3

Q ss_pred             CCCcccCCccCccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQ   26 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke   26 (149)
                      +.+...|+.|+..|=..-..
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L   28 (46)
T 2emh_A            9 GERPYICTVCGKAFTDRSNL   28 (46)
T ss_dssp             CCCSEECTTTCCEESSHHHH
T ss_pred             CCCCcCCCCCCchhCCHHHH
Confidence            34567888888887654433


No 156
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.22  E-value=17  Score=19.77  Aligned_cols=23  Identities=35%  Similarity=0.465  Sum_probs=14.9

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..=....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2ytj_A            9 GEKPYICAECGKAFTIRSNLIKH   31 (46)
T ss_dssp             SCCSEECSSSCCEESSHHHHHHH
T ss_pred             CCcCeECCCCChhhCCHHHHHHH
Confidence            34567899888888655443333


No 157
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.16  E-value=19  Score=19.69  Aligned_cols=19  Identities=32%  Similarity=0.667  Sum_probs=12.8

Q ss_pred             CCCcccCCccCcccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCL   25 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Ck   25 (149)
                      +.+...|+.|+..|=..-.
T Consensus         9 ~~k~~~C~~C~k~f~~~~~   27 (46)
T 2emz_A            9 GERPFKCNECGKGFGRRSH   27 (46)
T ss_dssp             CCCSCCCSSSCCCCSSHHH
T ss_pred             CCCCeECCCCCcccCCHHH
Confidence            3456788888888765443


No 158
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.01  E-value=18  Score=19.69  Aligned_cols=20  Identities=40%  Similarity=0.841  Sum_probs=13.8

Q ss_pred             CCCcccCCccCccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQ   26 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke   26 (149)
                      +.+...|+.|+..|-..-..
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L   28 (46)
T 2en3_A            9 GEKPFQCKECGMNFSWSCSL   28 (46)
T ss_dssp             CCCSEECSSSCCEESSSHHH
T ss_pred             CCCCeeCcccChhhCCHHHH
Confidence            34567899998888654433


No 159
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=31.01  E-value=19  Score=19.73  Aligned_cols=21  Identities=24%  Similarity=0.468  Sum_probs=14.1

Q ss_pred             CCCcccCCccCcccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQG   27 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~   27 (149)
                      +.+...|+.|+..|=..-...
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~   29 (46)
T 2eom_A            9 GERGHRCSDCGKFFLQASNFI   29 (46)
T ss_dssp             CCSSCCCSSSCCCCSSHHHHH
T ss_pred             CCCCcCCCCCCCeeCChHHHH
Confidence            455678998888886544333


No 160
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.97  E-value=18  Score=19.66  Aligned_cols=23  Identities=39%  Similarity=0.733  Sum_probs=14.7

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+.+|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2yu8_A            9 GEKPYKCNECGKVFTQNSHLARH   31 (46)
T ss_dssp             CCSSEECSSSCCEESSSHHHHHH
T ss_pred             CCCCeECCcCCchhCCHHHHHHH
Confidence            45667888888888654433333


No 161
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1
Probab=30.94  E-value=16  Score=25.03  Aligned_cols=19  Identities=47%  Similarity=1.172  Sum_probs=13.8

Q ss_pred             CcccCCccCcccccccccc
Q psy15037          9 KRIGCTECGFVFCKDCLQG   27 (149)
Q Consensus         9 ~~v~Cp~C~~aFC~~Cke~   27 (149)
                      ++--|-.|+.+||..|-..
T Consensus        24 RrHHCR~CG~vfC~~Cs~~   42 (88)
T 1wfk_A           24 KEYGCKNCGRAFCNGCLSF   42 (88)
T ss_dssp             CEEECSSSCCEEETTTSCE
T ss_pred             ccccCCCCCCEEChhHcCC
Confidence            4456778888888888543


No 162
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=30.93  E-value=18  Score=19.65  Aligned_cols=23  Identities=39%  Similarity=0.654  Sum_probs=15.0

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.++..|+.|+..|=..=....|
T Consensus         9 ~~~~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2en8_A            9 GEKSHTCDECGKNFCYISALRIH   31 (46)
T ss_dssp             CCSSEECTTTCCEESSHHHHHHH
T ss_pred             CCCCeECCCcCcccCCHHHHHHH
Confidence            45667899888888655443333


No 163
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1
Probab=30.89  E-value=29  Score=25.15  Aligned_cols=21  Identities=19%  Similarity=0.377  Sum_probs=17.1

Q ss_pred             CcCCCCCCcceeecCCcceeEeC
Q psy15037        111 TKPCPSCRTATERAGKGVYAYDL  133 (149)
Q Consensus       111 tK~CP~C~~~IEK~~GCNhM~~~  133 (149)
                      ...||.|..+++.++|  +-+|.
T Consensus        32 ~~~CP~Cq~eL~~~g~--~~hC~   52 (101)
T 2jne_A           32 ELHCPQCQHVLDQDNG--HARCR   52 (101)
T ss_dssp             CCBCSSSCSBEEEETT--EEEET
T ss_pred             cccCccCCCcceecCC--EEECc
Confidence            4789999999999988  55564


No 164
>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2}
Probab=30.88  E-value=19  Score=25.05  Aligned_cols=15  Identities=13%  Similarity=0.361  Sum_probs=11.6

Q ss_pred             CCcccCCccCccccc
Q psy15037          8 CKRIGCTECGFVFCK   22 (149)
Q Consensus         8 ~~~v~Cp~C~~aFC~   22 (149)
                      ...+.||+|+..|=.
T Consensus        51 ~g~~~CpYCg~~f~l   65 (80)
T 2jvm_A           51 TGFVECGYCDRRYIH   65 (80)
T ss_dssp             TCEEECSSSSCEEEE
T ss_pred             CCeEECCCCCCEEEe
Confidence            457889999988843


No 165
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.85  E-value=18  Score=19.74  Aligned_cols=18  Identities=39%  Similarity=0.883  Sum_probs=12.4

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+.+|=..=
T Consensus         9 ~~k~~~C~~C~k~F~~~~   26 (46)
T 2eoo_A            9 GERPYGCNECGKNFGRHS   26 (46)
T ss_dssp             CCCCEECSSSCCEESSHH
T ss_pred             CCCCEEccccCcccCCHH
Confidence            355678888888875543


No 166
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.72  E-value=18  Score=19.75  Aligned_cols=23  Identities=39%  Similarity=0.778  Sum_probs=14.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.++..|+.|+..|=..=....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2emf_A            9 GGKHFECTECGKAFTRKSTLSMH   31 (46)
T ss_dssp             SSCCEECSSSCCEESCHHHHHHH
T ss_pred             CCCCeECCCCCchhCCHHHHHHH
Confidence            34567898888888654433333


No 167
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.71  E-value=19  Score=19.59  Aligned_cols=19  Identities=37%  Similarity=0.761  Sum_probs=13.0

Q ss_pred             CCCcccCCccCcccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCL   25 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Ck   25 (149)
                      +.+...|+.|+..|-..=.
T Consensus         9 ~~~~~~C~~C~k~f~~~~~   27 (46)
T 2eoq_A            9 GEKPFKCDICGKSFCGRSR   27 (46)
T ss_dssp             SSCSCCCSSSCCCCSSHHH
T ss_pred             CCCCcCCCcCCchhCCHHH
Confidence            3456788888888865443


No 168
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.57  E-value=19  Score=19.50  Aligned_cols=18  Identities=39%  Similarity=0.735  Sum_probs=12.1

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+..|=..=
T Consensus         9 ~~k~~~C~~C~k~f~~~~   26 (46)
T 2eq4_A            9 GEKLYNCKECGKSFSRAP   26 (46)
T ss_dssp             CCCCCCBTTTTBCCSCHH
T ss_pred             CCCCeECCCCCCccCchH
Confidence            345677888888776543


No 169
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=30.54  E-value=19  Score=19.44  Aligned_cols=17  Identities=35%  Similarity=0.759  Sum_probs=11.7

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|=..
T Consensus         7 ~~k~~~C~~C~k~f~~~   23 (44)
T 2emx_A            7 GEKPFGCSCCEKAFSSK   23 (44)
T ss_dssp             SCCCEECSSSSCEESSH
T ss_pred             CCcCccCCCCCcccCCH
Confidence            34567888888877544


No 170
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1
Probab=30.50  E-value=16  Score=28.33  Aligned_cols=13  Identities=54%  Similarity=1.523  Sum_probs=6.7

Q ss_pred             cCCccCccccccc
Q psy15037         12 GCTECGFVFCKDC   24 (149)
Q Consensus        12 ~Cp~C~~aFC~~C   24 (149)
                      .|-.||.+||..|
T Consensus       179 hCr~CG~v~C~~C  191 (220)
T 1dvp_A          179 HCRNCGQVFCGQC  191 (220)
T ss_dssp             ECTTTCCEECSTT
T ss_pred             ccCCcCCEEChHH
Confidence            3445555555555


No 171
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=30.49  E-value=19  Score=19.63  Aligned_cols=19  Identities=37%  Similarity=0.478  Sum_probs=13.1

Q ss_pred             CCCcccCCccCcccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCL   25 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Ck   25 (149)
                      +.+...|+.|+..|=..=.
T Consensus         9 ~~k~~~C~~C~k~f~~~~~   27 (46)
T 2em7_A            9 GEKPYKCEECGKGFICRRD   27 (46)
T ss_dssp             CCCSEECSSSCCEESCHHH
T ss_pred             CCcCccCCCccchhCCHHH
Confidence            3456789888888865443


No 172
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.45  E-value=19  Score=19.56  Aligned_cols=23  Identities=39%  Similarity=0.715  Sum_probs=15.5

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..=....|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2eq0_A            9 GEKPYKCHECGKVFRRNSHLARH   31 (46)
T ss_dssp             CCCCEECTTTCCEESSHHHHHHH
T ss_pred             CCCCeECCCCCchhCCHHHHHHH
Confidence            45667899998888665444444


No 173
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A
Probab=30.43  E-value=21  Score=19.37  Aligned_cols=23  Identities=30%  Similarity=0.612  Sum_probs=15.1

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..=....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2el4_A            9 GVKPYGCSQCAKTFSLKSQLIVH   31 (46)
T ss_dssp             CCCSEECSSSSCEESSHHHHHHH
T ss_pred             CCCceECCCCCchhCCHHHHHHH
Confidence            45667899888888655443333


No 174
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.42  E-value=19  Score=19.64  Aligned_cols=19  Identities=32%  Similarity=0.700  Sum_probs=12.9

Q ss_pred             CCCcccCCccCcccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCL   25 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Ck   25 (149)
                      +.+...|+.|+..|=..-.
T Consensus         9 ~~k~~~C~~C~k~F~~~~~   27 (46)
T 2emy_A            9 GENPYECHECGKAFSRKYQ   27 (46)
T ss_dssp             SSCCEECSSSCCEESSHHH
T ss_pred             CCcCcCCCCCCcccCcHHH
Confidence            3456788888888865443


No 175
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic}
Probab=30.39  E-value=16  Score=18.53  Aligned_cols=19  Identities=21%  Similarity=0.474  Sum_probs=11.3

Q ss_pred             ccCCccCcccccccccccc
Q psy15037         11 IGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus        11 v~Cp~C~~aFC~~Cke~WH   29 (149)
                      ..|+.|+.+|-..-...-|
T Consensus         3 ~~C~~C~k~f~~~~~L~~H   21 (32)
T 2kfq_A            3 FACPACPKRFMRSDALSKH   21 (32)
T ss_dssp             SSSSSSCTTHHHHHTTSSS
T ss_pred             CCCCCCCcccCCHHHHHHH
Confidence            4677787777654433333


No 176
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=30.36  E-value=20  Score=19.46  Aligned_cols=18  Identities=39%  Similarity=0.763  Sum_probs=12.6

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.++..|+.|+..|=..=
T Consensus         9 ~~k~~~C~~C~k~f~~~~   26 (46)
T 2enc_A            9 GEKPFKCEECGKGFYTNS   26 (46)
T ss_dssp             CCCSEECSSSCCEESSHH
T ss_pred             CCCCcCCCCCCCcCCChH
Confidence            456678888888885543


No 177
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=30.28  E-value=7.1  Score=26.33  Aligned_cols=20  Identities=15%  Similarity=0.358  Sum_probs=15.8

Q ss_pred             cccCCccCcccccccccccc
Q psy15037         10 RIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus        10 ~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +|.-+.||.+||..|-+.|-
T Consensus        20 PV~~~~cGh~f~r~cI~~~l   39 (94)
T 2yu4_A           20 PVKNKVCGHTYEEDAIVRMI   39 (94)
T ss_dssp             EEEESSSCCEEEHHHHHHHH
T ss_pred             CEEcCCCCCeecHHHHHHHH
Confidence            34445699999999998884


No 178
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A
Probab=30.24  E-value=19  Score=19.59  Aligned_cols=23  Identities=43%  Similarity=0.849  Sum_probs=14.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2ema_A            9 GEKRYKCNECGKVFSRNSQLSQH   31 (46)
T ss_dssp             TSCCEECSSSCCEESSHHHHHHH
T ss_pred             CCcCcCCCCCcchhCCHHHHHHH
Confidence            35567899888888654433333


No 179
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.20  E-value=21  Score=19.52  Aligned_cols=19  Identities=37%  Similarity=0.726  Sum_probs=13.1

Q ss_pred             CCCcccCCccCcccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCL   25 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Ck   25 (149)
                      +.+...|+.|+..|=..-.
T Consensus         9 ~~k~~~C~~C~k~f~~~~~   27 (46)
T 2em2_A            9 GEKPFKCKECGKAFRQNIH   27 (46)
T ss_dssp             CCCSEECSSSCCEESSHHH
T ss_pred             CCCCEECCcCCchhCCHHH
Confidence            4456788888888865443


No 180
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=30.20  E-value=19  Score=19.46  Aligned_cols=17  Identities=29%  Similarity=0.665  Sum_probs=11.6

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|=..
T Consensus         9 ~~~~~~C~~C~k~f~~~   25 (44)
T 2eou_A            9 AKTTSECQECGKIFRHS   25 (44)
T ss_dssp             SSCCCCCTTTCCCCSSH
T ss_pred             CCcCeECCCCCcccCCH
Confidence            34567788888877543


No 181
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.17  E-value=19  Score=19.61  Aligned_cols=17  Identities=47%  Similarity=0.942  Sum_probs=11.9

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|=..
T Consensus         9 ~~~~~~C~~C~k~f~~~   25 (46)
T 2ytk_A            9 GEKPYKCNECGKVFTQN   25 (46)
T ss_dssp             SSCSEECSSSCCEESSH
T ss_pred             CCCCEeCCcCCCccCCH
Confidence            35567888888887543


No 182
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=30.15  E-value=19  Score=19.64  Aligned_cols=23  Identities=30%  Similarity=0.491  Sum_probs=15.0

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-...-|
T Consensus         9 ~~~~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2em5_A            9 STKSHQCHECGRGFTLKSHLNQH   31 (46)
T ss_dssp             CSCSEECSSSCCEESSHHHHHHH
T ss_pred             CCCCeECCcCCCccCCHHHHHHH
Confidence            45667899888888655443333


No 183
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.15  E-value=19  Score=19.57  Aligned_cols=18  Identities=44%  Similarity=0.866  Sum_probs=12.5

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+..|=..-
T Consensus         9 ~~~~~~C~~C~k~f~~~~   26 (46)
T 2eor_A            9 GEKPYNCEECGKAFIHDS   26 (46)
T ss_dssp             CCCSEECTTTCCEESSHH
T ss_pred             CCcCccCCCCCCCcCCHH
Confidence            345678888888885543


No 184
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.00  E-value=19  Score=19.57  Aligned_cols=23  Identities=35%  Similarity=0.585  Sum_probs=14.6

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..=....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2ep2_A            9 GEKPYECSICGKSFTKKSQLHVH   31 (46)
T ss_dssp             CCCSEECSSSCCEESSHHHHHHH
T ss_pred             CCcCcCCCCCCcccCCHHHHHHH
Confidence            34567888888888654433333


No 185
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.84  E-value=16  Score=19.71  Aligned_cols=23  Identities=30%  Similarity=0.563  Sum_probs=15.5

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~~~~~C~~C~k~F~~~~~L~~H   31 (44)
T 2eox_A            9 DSKSYNCNECGKAFTRIFHLTRH   31 (44)
T ss_dssp             CCCCEEETTTTEEESSSHHHHTT
T ss_pred             CCCCeECcccCcccCCHHHHHHH
Confidence            45567899999888665544444


No 186
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.81  E-value=20  Score=19.47  Aligned_cols=17  Identities=35%  Similarity=0.569  Sum_probs=11.9

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|=..
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2eme_A            9 GEKPYVCDYCGKAFGLS   25 (46)
T ss_dssp             CCCSEECSSSCCEESSH
T ss_pred             CCCCeECCCCChhhCCH
Confidence            34567888888887543


No 187
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.77  E-value=20  Score=19.54  Aligned_cols=18  Identities=39%  Similarity=0.702  Sum_probs=12.3

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.++..|+.|+..|=..=
T Consensus         9 ~~k~~~C~~C~k~f~~~~   26 (46)
T 2emp_A            9 GVKPYMCNECGKAFSVYS   26 (46)
T ss_dssp             CCCSEECSSSCCEESCHH
T ss_pred             CCcCeECCCCCchhCCHH
Confidence            345678888888875543


No 188
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.53  E-value=20  Score=19.68  Aligned_cols=17  Identities=41%  Similarity=0.808  Sum_probs=11.5

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.++..|+.|+.+|=..
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2ytm_A            9 GEKPYKCMECGKAFGDN   25 (46)
T ss_dssp             SCCSSSBTTTTBCCSSH
T ss_pred             CCCCcCCCCCCchhCCH
Confidence            34567788888877544


No 189
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.36  E-value=21  Score=19.47  Aligned_cols=17  Identities=35%  Similarity=0.694  Sum_probs=12.0

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|=..
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2em8_A            9 GEKPYKCVECGKGYKRR   25 (46)
T ss_dssp             SCCSEECSSSCCEESSH
T ss_pred             CCCCeECcccCchhCCH
Confidence            45667888888887543


No 190
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.24  E-value=19  Score=19.59  Aligned_cols=23  Identities=30%  Similarity=0.570  Sum_probs=15.1

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~~~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2ytg_A            9 GEKPFKCGECGKSYNQRVHLTQH   31 (46)
T ss_dssp             SCCSEECTTTCCEESSSHHHHTT
T ss_pred             CCCCeECCCCCcccCCHHHHHHH
Confidence            45667898888888655444444


No 191
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens}
Probab=29.01  E-value=23  Score=19.35  Aligned_cols=23  Identities=22%  Similarity=0.417  Sum_probs=14.9

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|-..=....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2el6_A            9 GVNPYKCSQCEKSFSGKLRLLVH   31 (46)
T ss_dssp             CCCSEECSSSSCEESSHHHHHHH
T ss_pred             CCCCeECCCCCcccCCHHHHHHH
Confidence            45567898888888654433333


No 192
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.96  E-value=22  Score=19.41  Aligned_cols=18  Identities=39%  Similarity=0.752  Sum_probs=12.1

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+..|=..-
T Consensus         9 ~~k~~~C~~C~k~f~~~~   26 (46)
T 2ytt_A            9 GEKPYQCSECGKSFSGSY   26 (46)
T ss_dssp             CCCTTCCSSSCCCCSSHH
T ss_pred             CCCCeeCCCCCcccCCHH
Confidence            345677888888775543


No 193
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.95  E-value=17  Score=19.95  Aligned_cols=23  Identities=30%  Similarity=0.569  Sum_probs=15.5

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.++..|+.|+..|-..-....|
T Consensus         9 ~~k~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2eoz_A            9 GEKPYSCNVCGKAFVLSAHLNQH   31 (46)
T ss_dssp             SCCSEEETTTTEEESSHHHHHHH
T ss_pred             CCCCeECcccChhhCCHHHHHHH
Confidence            34567899999888765544444


No 194
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.94  E-value=21  Score=19.36  Aligned_cols=18  Identities=33%  Similarity=0.739  Sum_probs=12.2

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+..|=..-
T Consensus         9 ~~k~~~C~~C~k~f~~~~   26 (46)
T 2emm_A            9 GERPHKCNECGKSFIQSA   26 (46)
T ss_dssp             CCCSEECSSSCCEESSHH
T ss_pred             CCCCeeCCCCChhhCCHH
Confidence            345678888888875543


No 195
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=28.90  E-value=27  Score=23.24  Aligned_cols=13  Identities=23%  Similarity=0.838  Sum_probs=10.8

Q ss_pred             cCCCCCCcceeec
Q psy15037        112 KPCPSCRTATERA  124 (149)
Q Consensus       112 K~CP~C~~~IEK~  124 (149)
                      ..||.|+.++...
T Consensus        59 ~~CP~Cr~~~~~~   71 (112)
T 1jm7_A           59 SQCPLCKNDITKR   71 (112)
T ss_dssp             CCCTTTSCCCCTT
T ss_pred             CCCcCCCCcCCHh
Confidence            5899999998653


No 196
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C
Probab=28.60  E-value=7.8  Score=27.68  Aligned_cols=16  Identities=25%  Similarity=0.725  Sum_probs=14.1

Q ss_pred             ccCccccccccccccC
Q psy15037         15 ECGFVFCKDCLQGAHI   30 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH~   30 (149)
                      .|+..||..|-..|-.
T Consensus        70 ~CgH~fc~~Ci~~~~~   85 (138)
T 4ayc_A           70 NCAHSFCSYCINEWMK   85 (138)
T ss_dssp             TTSCEEEHHHHHHHTT
T ss_pred             CCCCCccHHHHHHHHH
Confidence            4999999999999864


No 197
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=28.51  E-value=24  Score=19.06  Aligned_cols=17  Identities=29%  Similarity=0.673  Sum_probs=11.7

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+..|=..
T Consensus         7 ~~k~~~C~~C~k~f~~~   23 (43)
T 2yrm_A            7 GNGAFFCNECDCRFSEE   23 (43)
T ss_dssp             SSCCBCCSSSCCCBSSH
T ss_pred             CCCCEECCCCCCeeCCh
Confidence            34567888888887543


No 198
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.42  E-value=18  Score=19.64  Aligned_cols=23  Identities=39%  Similarity=0.738  Sum_probs=14.8

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+.+|=..=....|
T Consensus         9 ~~~~~~C~~C~k~F~~~~~L~~H   31 (46)
T 2eoe_A            9 GEKPYKCNECGKVFTQNSHLANH   31 (46)
T ss_dssp             CCCSSEETTTTEECSSHHHHHHH
T ss_pred             CCCCeECCCcChhhCCHHHHHHH
Confidence            35667888888888654433333


No 199
>4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae}
Probab=28.41  E-value=32  Score=28.64  Aligned_cols=23  Identities=13%  Similarity=0.271  Sum_probs=18.0

Q ss_pred             HhhHHHHHhcCcCCCCCCc-ceeec
Q psy15037        101 DASQVTIKVSTKPCPSCRT-ATERA  124 (149)
Q Consensus       101 ~~s~~~I~~ntK~CP~C~~-~IEK~  124 (149)
                      ..|+.|+..|. .||+|.. +|.+-
T Consensus        25 VLTE~Wv~~n~-yCPnCG~~~l~~f   48 (257)
T 4esj_A           25 ILTEDWVYRQS-YCPNCGNNPLNHF   48 (257)
T ss_dssp             HHHHHHHHHHC-CCTTTCCSSCEEC
T ss_pred             hhhHHHHHHCC-cCCCCCChhhhhc
Confidence            46899998885 7999999 56543


No 200
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2
Probab=28.07  E-value=20  Score=21.50  Aligned_cols=12  Identities=25%  Similarity=0.999  Sum_probs=8.3

Q ss_pred             cccccccccccc
Q psy15037         18 FVFCKDCLQGAH   29 (149)
Q Consensus        18 ~aFC~~Cke~WH   29 (149)
                      ..+|-.|...||
T Consensus        15 ll~Cd~C~~~~H   26 (51)
T 1f62_A           15 LILCDECNKAFH   26 (51)
T ss_dssp             CEECTTTCCEEC
T ss_pred             EEECCCCChhhC
Confidence            456667777777


No 201
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=27.68  E-value=8.3  Score=25.64  Aligned_cols=16  Identities=31%  Similarity=0.864  Sum_probs=13.5

Q ss_pred             CccCcccccccccccc
Q psy15037         14 TECGFVFCKDCLQGAH   29 (149)
Q Consensus        14 p~C~~aFC~~Cke~WH   29 (149)
                      ..|+..||..|.+.|-
T Consensus        24 ~~CgH~FC~~Cl~~~~   39 (94)
T 1wim_A           24 AQCQCIFCTLCLKQYV   39 (94)
T ss_dssp             TTTTEEEEHHHHHHHH
T ss_pred             CCCCCcccHHHHHHHH
Confidence            3599999999988875


No 202
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.49  E-value=18  Score=19.66  Aligned_cols=23  Identities=35%  Similarity=0.530  Sum_probs=15.4

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-...-|
T Consensus         9 ~~k~~~C~~C~k~F~~~~~L~~H   31 (45)
T 2epu_A            9 GQKPFECTHCGKSFRAKGNLVTH   31 (45)
T ss_dssp             SCCSEEETTTTEEESSHHHHHHH
T ss_pred             CCcCccCCCCCCccCChHHHHHH
Confidence            44667899999888665444444


No 203
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.49  E-value=19  Score=19.63  Aligned_cols=20  Identities=35%  Similarity=0.679  Sum_probs=13.7

Q ss_pred             CCCcccCCccCccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQ   26 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke   26 (149)
                      +.+...|+.|+..|=..-..
T Consensus         9 ~~~~~~C~~C~k~f~~~~~L   28 (46)
T 2en1_A            9 GEKPFKCEECGKRFTQNSQL   28 (46)
T ss_dssp             CCCSEEETTTTEEESSHHHH
T ss_pred             CCCCeeCCCCCcccCCHHHH
Confidence            35567888888888654433


No 204
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=27.26  E-value=10  Score=24.78  Aligned_cols=20  Identities=20%  Similarity=0.300  Sum_probs=14.2

Q ss_pred             cccCCccCcccccccccccc
Q psy15037         10 RIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus        10 ~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      .+.-+.|+..|+..|...|-
T Consensus        42 ~~~~~~C~H~FH~~Ci~~Wl   61 (81)
T 2ecl_A           42 VVVWGECNHSFHNCCMSLWV   61 (81)
T ss_dssp             CEEEETTSCEEEHHHHHHHT
T ss_pred             EEEeCCCCCccChHHHHHHH
Confidence            33445688888888888874


No 205
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.23  E-value=25  Score=19.07  Aligned_cols=19  Identities=37%  Similarity=0.737  Sum_probs=12.8

Q ss_pred             CCCcccCCccCcccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCL   25 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Ck   25 (149)
                      +.+...|+.|+..|=..-.
T Consensus         9 ~~k~~~C~~C~k~f~~~~~   27 (46)
T 2ytd_A            9 GEKPYKCSECGKAFHRHTH   27 (46)
T ss_dssp             CCCSEECSSSCCEESSHHH
T ss_pred             CCcCeECCCCCCeeCChHH
Confidence            3456788888888865443


No 206
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}
Probab=27.23  E-value=31  Score=25.19  Aligned_cols=21  Identities=29%  Similarity=0.615  Sum_probs=16.4

Q ss_pred             HHHHHhcCcCCCCCCcceeec
Q psy15037        104 QVTIKVSTKPCPSCRTATERA  124 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK~  124 (149)
                      ..|+......||.|+.++...
T Consensus       106 ~~~~~~~~~~CP~Cr~~~~~~  126 (150)
T 1z6u_A          106 QRSFKAQVFSCPACRHDLGQN  126 (150)
T ss_dssp             HHHHHTTCCBCTTTCCBCCTT
T ss_pred             HHHHHhCCCcCCCCCccCCCC
Confidence            467776667899999998654


No 207
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A*
Probab=27.07  E-value=22  Score=20.34  Aligned_cols=17  Identities=18%  Similarity=0.233  Sum_probs=11.9

Q ss_pred             CCcccCCccCccccccc
Q psy15037          8 CKRIGCTECGFVFCKDC   24 (149)
Q Consensus         8 ~~~v~Cp~C~~aFC~~C   24 (149)
                      .+...|+.|+..|=..-
T Consensus        22 ~k~~~C~~C~k~f~~~~   38 (54)
T 1yui_A           22 EQPATCPICYAVIRQSR   38 (54)
T ss_dssp             SCCEECTTTCCEESSHH
T ss_pred             CCCccCCCCCcccCCHH
Confidence            45678888888885543


No 208
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=26.74  E-value=24  Score=19.18  Aligned_cols=23  Identities=26%  Similarity=0.345  Sum_probs=15.2

Q ss_pred             CCCcccCCccCcccccccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +.+...|+.|+..|=..-....|
T Consensus         9 ~~~~~~C~~C~k~f~~~~~L~~H   31 (46)
T 2ep0_A            9 GEKPYKCDVCHKSFRYGSSLTVH   31 (46)
T ss_dssp             TCCSEECSSSCCEESSHHHHHHH
T ss_pred             CCCCeeCcccCcccCChHHHHHH
Confidence            45567899888888665444444


No 209
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=26.59  E-value=21  Score=19.39  Aligned_cols=17  Identities=47%  Similarity=1.005  Sum_probs=11.5

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +.+...|+.|+.+|=..
T Consensus         9 ~~~~~~C~~C~k~f~~~   25 (46)
T 2en6_A            9 GEKPYGCNECGKTFSQK   25 (46)
T ss_dssp             SSCCEEETTTTEEESSH
T ss_pred             CCcCeECCCCCcccCch
Confidence            34567788888877544


No 210
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}
Probab=26.56  E-value=30  Score=25.11  Aligned_cols=21  Identities=14%  Similarity=0.192  Sum_probs=15.8

Q ss_pred             HHHHHhcCcCCCCCCcceeec
Q psy15037        104 QVTIKVSTKPCPSCRTATERA  124 (149)
Q Consensus       104 ~~~I~~ntK~CP~C~~~IEK~  124 (149)
                      ..|+......||.|+.+|..+
T Consensus        46 ~~~~~~~~~~CP~Cr~~~~~~   66 (170)
T 3hcs_A           46 IKSIRDAGHKCPVDNEILLEN   66 (170)
T ss_dssp             HHHHHHHCSBCTTTCCBCCGG
T ss_pred             HHHHHhCCCCCCCCccCcchh
Confidence            346666667999999998764


No 211
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=26.24  E-value=24  Score=19.16  Aligned_cols=18  Identities=33%  Similarity=0.610  Sum_probs=12.5

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+.+|=..-
T Consensus         9 ~~~~~~C~~C~k~f~~~~   26 (46)
T 2yso_A            9 REKSHQCRECGEIFFQYV   26 (46)
T ss_dssp             CCCCEECTTTCCEESSHH
T ss_pred             CCCCEEccccChhhCCHH
Confidence            345678888888886544


No 212
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=26.24  E-value=20  Score=19.53  Aligned_cols=19  Identities=26%  Similarity=0.497  Sum_probs=13.0

Q ss_pred             CCCcccCCccCcccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDCL   25 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~Ck   25 (149)
                      +.+...|+.|+..|=..=.
T Consensus         9 ~~k~~~C~~C~k~f~~~~~   27 (46)
T 2ysp_A            9 GEKPYKCEKCGKGYNSKFN   27 (46)
T ss_dssp             SCCSEEETTTTEEESCHHH
T ss_pred             CCCCeECCCCCCccCCHHH
Confidence            4456788888888855443


No 213
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens}
Probab=25.89  E-value=22  Score=20.08  Aligned_cols=17  Identities=24%  Similarity=0.559  Sum_probs=9.7

Q ss_pred             CcccCCccCcccccccc
Q psy15037          9 KRIGCTECGFVFCKDCL   25 (149)
Q Consensus         9 ~~v~Cp~C~~aFC~~Ck   25 (149)
                      +...|+.|+.+|=..=.
T Consensus         3 ~~~~C~~C~~~f~~~~~   19 (57)
T 3uk3_C            3 SSRECSYCGKFFRSNYY   19 (57)
T ss_dssp             --CBCTTTCCBCSCHHH
T ss_pred             CCccCCCCcchhCChHH
Confidence            45677777777755443


No 214
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1
Probab=25.79  E-value=28  Score=20.75  Aligned_cols=14  Identities=21%  Similarity=0.555  Sum_probs=9.3

Q ss_pred             CCCcccCCccCccc
Q psy15037          7 GCKRIGCTECGFVF   20 (149)
Q Consensus         7 ~~~~v~Cp~C~~aF   20 (149)
                      +.+...|+.|+.+|
T Consensus        11 ~~k~~~C~~C~k~F   24 (62)
T 1vd4_A           11 NRASFKCPVCSSTF   24 (62)
T ss_dssp             SSSEEECSSSCCEE
T ss_pred             CCCCccCCCCCchh
Confidence            34566788887754


No 215
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1
Probab=25.68  E-value=23  Score=26.19  Aligned_cols=20  Identities=20%  Similarity=0.589  Sum_probs=16.6

Q ss_pred             CCcccCCccCcccccccccc
Q psy15037          8 CKRIGCTECGFVFCKDCLQG   27 (149)
Q Consensus         8 ~~~v~Cp~C~~aFC~~Cke~   27 (149)
                      .....|.+|++.+|..|...
T Consensus        70 ~~g~~C~~C~~~VC~~C~~~   89 (134)
T 1zbd_B           70 SASVVCEDCKKNVCTKCGVE   89 (134)
T ss_dssp             CCEEECTTTCCEEETTSEEE
T ss_pred             CCCCCCCCCCcccccccCCc
Confidence            34578999999999999764


No 216
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=25.64  E-value=21  Score=19.39  Aligned_cols=18  Identities=33%  Similarity=0.696  Sum_probs=12.3

Q ss_pred             CCCcccCCccCccccccc
Q psy15037          7 GCKRIGCTECGFVFCKDC   24 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~C   24 (149)
                      +.+...|+.|+..|-..-
T Consensus         7 ~~k~~~C~~C~k~f~~~~   24 (45)
T 2epq_A            7 GEKPYSCPVCGLRFKRKD   24 (45)
T ss_dssp             SCCSSEETTTTEECSCHH
T ss_pred             CCCCCcCCCCCcccCCHH
Confidence            456678888888875443


No 217
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=25.04  E-value=27  Score=22.26  Aligned_cols=12  Identities=33%  Similarity=0.825  Sum_probs=9.9

Q ss_pred             cCcCCCCCCcce
Q psy15037        110 STKPCPSCRTAT  121 (149)
Q Consensus       110 ntK~CP~C~~~I  121 (149)
                      ++..||+|++.-
T Consensus        11 ~~~~CPrCn~~f   22 (49)
T 2e72_A           11 GRKICPRCNAQF   22 (49)
T ss_dssp             SCCCCTTTCCCC
T ss_pred             CceeCCcccccc
Confidence            788999998753


No 218
>1x4v_A Hypothetical protein LOC130617; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=24.36  E-value=31  Score=22.65  Aligned_cols=17  Identities=24%  Similarity=0.716  Sum_probs=13.4

Q ss_pred             CCCcccCCccCcccccc
Q psy15037          7 GCKRIGCTECGFVFCKD   23 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~~   23 (149)
                      +-..+.|..|+..||..
T Consensus        24 ~ll~f~C~~C~~~FC~~   40 (63)
T 1x4v_A           24 EMMKLTCERCSRNFCIK   40 (63)
T ss_dssp             CSSCCBCSSSCCBCCHH
T ss_pred             CccceECCCCCcccCcc
Confidence            34567899999999976


No 219
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=24.05  E-value=37  Score=20.09  Aligned_cols=24  Identities=25%  Similarity=0.310  Sum_probs=16.4

Q ss_pred             CCCCCcccCCccCcccccccccccc
Q psy15037          5 EDGCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         5 e~~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      +=+.++..|+.|+.+|= .-...-|
T Consensus         5 ~C~~~~~~C~~C~k~f~-~~~L~~H   28 (66)
T 2eod_A            5 SSGKRTQPCTYCTKEFV-FDTIQSH   28 (66)
T ss_dssp             CCCCCEEECSSSCCEEE-HHHHHHH
T ss_pred             cCCCCCeeccccCCccC-HHHHHHH
Confidence            34566788999999887 5444445


No 220
>1lv3_A Hypothetical protein YACG; zinc finger, rubredoxin knuckle, C4 tetrahedral Zn+2, antiparallel beta strand and alpha helix, NESG project; NMR {Escherichia coli} SCOP: g.39.1.9
Probab=24.04  E-value=19  Score=24.21  Aligned_cols=13  Identities=31%  Similarity=0.718  Sum_probs=11.5

Q ss_pred             cCcCCCCCCccee
Q psy15037        110 STKPCPSCRTATE  122 (149)
Q Consensus       110 ntK~CP~C~~~IE  122 (149)
                      .+++||.|..+++
T Consensus         8 ~~~~CP~Cgkp~~   20 (68)
T 1lv3_A            8 ITVNCPTCGKTVV   20 (68)
T ss_dssp             CEEECTTTCCEEE
T ss_pred             CcCcCCCCCCccc
Confidence            5689999999986


No 221
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A
Probab=23.97  E-value=28  Score=19.58  Aligned_cols=15  Identities=33%  Similarity=0.738  Sum_probs=9.8

Q ss_pred             CCcccCCccCccccc
Q psy15037          8 CKRIGCTECGFVFCK   22 (149)
Q Consensus         8 ~~~v~Cp~C~~aFC~   22 (149)
                      .+...|+.|+..|=.
T Consensus        27 ~~~~~C~~C~~~f~~   41 (57)
T 1bbo_A           27 VRPYHCTYCNFSFKT   41 (57)
T ss_dssp             CCCEECSSSSCEESS
T ss_pred             CCCccCCCCCchhcC
Confidence            345677777777743


No 222
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=23.60  E-value=35  Score=18.84  Aligned_cols=24  Identities=25%  Similarity=0.494  Sum_probs=15.0

Q ss_pred             CCCCcccCCccCcccccccccccc
Q psy15037          6 DGCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         6 ~~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      .+.+...|+.|+..|=..-...-|
T Consensus         8 ~~~k~~~C~~C~k~f~~~~~L~~H   31 (48)
T 2epr_A            8 RTRKQVACEICGKIFRDVYHLNRH   31 (48)
T ss_dssp             CCCCSEEETTTTEEESSHHHHHHH
T ss_pred             CCCcCeeCCCCCcccCCHHHHHHH
Confidence            345667888888887654433333


No 223
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=23.56  E-value=50  Score=20.22  Aligned_cols=28  Identities=21%  Similarity=0.602  Sum_probs=20.1

Q ss_pred             CCCcccCCccC----ccccccccccccCCCCCC
Q psy15037          7 GCKRIGCTECG----FVFCKDCLQGAHIGPCDP   35 (149)
Q Consensus         7 ~~~~v~Cp~C~----~aFC~~Cke~WH~g~C~~   35 (149)
                      +.....|..|+    ..+|-.|-..||.. |-.
T Consensus         6 ~~~~~~C~vC~~~g~ll~Cd~C~~~~H~~-Cl~   37 (56)
T 2yql_A            6 SGHEDFCSVCRKSGQLLMCDTCSRVYHLD-CLD   37 (56)
T ss_dssp             CSSCCSCSSSCCSSCCEECSSSSCEECSS-SSS
T ss_pred             CCCCCCCccCCCCCeEEEcCCCCcceECc-cCC
Confidence            34455677777    88999999999953 443


No 224
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}
Probab=22.92  E-value=41  Score=20.14  Aligned_cols=25  Identities=20%  Similarity=0.286  Sum_probs=16.5

Q ss_pred             CCCCCcccCCccCcccccccccccc
Q psy15037          5 EDGCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         5 e~~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      ..+.+...|+.|+..|=..-...-|
T Consensus        12 ~~~~~~~~C~~C~k~f~~~~~l~~H   36 (74)
T 2lce_A           12 THSDKPYKCDRCQASFRYKGNLASH   36 (74)
T ss_dssp             CCCCCSBCCTTSSCCBSCHHHHHHH
T ss_pred             cCCCCCeECCCCCceeCCHHHHHHH
Confidence            3456678899998888665444344


No 225
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1
Probab=22.75  E-value=29  Score=20.24  Aligned_cols=16  Identities=25%  Similarity=0.362  Sum_probs=10.5

Q ss_pred             CCCcccCCccCccccc
Q psy15037          7 GCKRIGCTECGFVFCK   22 (149)
Q Consensus         7 ~~~~v~Cp~C~~aFC~   22 (149)
                      +.++..|+.|+.+|=.
T Consensus        37 ~~~~~~C~~C~k~f~~   52 (66)
T 2drp_A           37 NVKVYPCPFCFKEFTR   52 (66)
T ss_dssp             SCCCEECTTTCCEESC
T ss_pred             CCcCeECCCCCCccCC
Confidence            3456778888777743


No 226
>2a20_A Regulating synaptic membrane exocytosis protein 2; zinc-finger domain, metal binding protein; NMR {Rattus norvegicus} PDB: 2cjs_C
Probab=22.47  E-value=25  Score=23.40  Aligned_cols=19  Identities=26%  Similarity=0.752  Sum_probs=16.3

Q ss_pred             cCCccCccccccccccccC
Q psy15037         12 GCTECGFVFCKDCLQGAHI   30 (149)
Q Consensus        12 ~Cp~C~~aFC~~Cke~WH~   30 (149)
                      .|.+|...||..|..-++.
T Consensus        27 ~C~yCk~r~CaRCGg~v~l   45 (62)
T 2a20_A           27 NCSYCQTKFCARCGGRVSL   45 (62)
T ss_dssp             EBTTTCCEECTTSEEEEES
T ss_pred             cccccCCeeecccCCEeee
Confidence            5889999999999887774


No 227
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A
Probab=22.31  E-value=33  Score=16.77  Aligned_cols=12  Identities=42%  Similarity=0.855  Sum_probs=7.1

Q ss_pred             ccCC--ccCccccc
Q psy15037         11 IGCT--ECGFVFCK   22 (149)
Q Consensus        11 v~Cp--~C~~aFC~   22 (149)
                      ..|+  .|+.+|=.
T Consensus         3 ~~C~~~~C~k~f~~   16 (31)
T 1sp2_A            3 FMCTWSYCGKRFTR   16 (31)
T ss_dssp             CBCCSTTCCCBCSS
T ss_pred             cCCcCCCCCcccCC
Confidence            4565  67766643


No 228
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii}
Probab=21.76  E-value=35  Score=24.98  Aligned_cols=13  Identities=23%  Similarity=0.680  Sum_probs=10.6

Q ss_pred             cCCCCCCcceeec
Q psy15037        112 KPCPSCRTATERA  124 (149)
Q Consensus       112 K~CP~C~~~IEK~  124 (149)
                      +.||.|.+++.|.
T Consensus       149 ~~Cp~CG~~~~~~  161 (165)
T 2lcq_A          149 GVCPDCGSKVKLI  161 (165)
T ss_dssp             GBCTTTCCBEEEC
T ss_pred             CcCCCCCCcceeC
Confidence            4799999998764


No 229
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A
Probab=21.63  E-value=95  Score=24.78  Aligned_cols=35  Identities=20%  Similarity=0.259  Sum_probs=24.3

Q ss_pred             HhcCcCCCCCCcceeecCCcceeEeC------CCceeeeee
Q psy15037        108 KVSTKPCPSCRTATERAGKGVYAYDL------YPMFIPLVL  142 (149)
Q Consensus       108 ~~ntK~CP~C~~~IEK~~GCNhM~~~------~~~~~~~~~  142 (149)
                      ..+.+-||.|..+.+...+=-.+.|.      ||-..|.|+
T Consensus       104 ~~~~~fC~~CG~~~~~~~~~~~~~C~~C~~~~yp~~~~~vi  144 (269)
T 1vk6_A          104 YRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCII  144 (269)
T ss_dssp             HHTTSBCTTTCCBEEECSSSSCEEESSSSCEECCCCEEEEE
T ss_pred             hhcCCccccCCCcCccCCCceeeeCCCCCCEecCCCCcEEE
Confidence            35689999999999777665555553      565555443


No 230
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=21.15  E-value=33  Score=21.75  Aligned_cols=13  Identities=31%  Similarity=0.841  Sum_probs=11.4

Q ss_pred             CcCCCCCCcceee
Q psy15037        111 TKPCPSCRTATER  123 (149)
Q Consensus       111 tK~CP~C~~~IEK  123 (149)
                      .+.||-|+.+|+.
T Consensus        46 ~~~CP~CR~~i~~   58 (68)
T 2ea5_A           46 FQQCPMCRQFVQE   58 (68)
T ss_dssp             CSSCTTTCCCCCC
T ss_pred             CCCCCCCCcchhc
Confidence            4899999999965


No 231
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=21.12  E-value=38  Score=16.54  Aligned_cols=13  Identities=23%  Similarity=0.708  Sum_probs=7.8

Q ss_pred             cccCC--ccCccccc
Q psy15037         10 RIGCT--ECGFVFCK   22 (149)
Q Consensus        10 ~v~Cp--~C~~aFC~   22 (149)
                      ...|+  .|+.+|=.
T Consensus         3 ~~~C~~~~C~k~f~~   17 (32)
T 1zfd_A            3 PYSCDHPGCDKAFVR   17 (32)
T ss_dssp             SBCCCCTTCCCCBSS
T ss_pred             CCcCcCCCCCCccCC
Confidence            35676  67766643


No 232
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=21.08  E-value=47  Score=21.93  Aligned_cols=19  Identities=37%  Similarity=0.431  Sum_probs=14.4

Q ss_pred             HHHHHhc-CcCCCCCCccee
Q psy15037        104 QVTIKVS-TKPCPSCRTATE  122 (149)
Q Consensus       104 ~~~I~~n-tK~CP~C~~~IE  122 (149)
                      ..||..+ ...||-|+..+.
T Consensus        50 ~~Wl~~~~~~~CplCr~~~~   69 (80)
T 2d8s_A           50 QQWIKSSDTRCCELCKYEFI   69 (80)
T ss_dssp             HHHHHHHCCSBCSSSCCBCC
T ss_pred             HHHHhhCCCCCCCCCCCeee
Confidence            4677665 478999999874


No 233
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}
Probab=20.93  E-value=13  Score=26.98  Aligned_cols=15  Identities=33%  Similarity=0.952  Sum_probs=13.7

Q ss_pred             ccCcccccccccccc
Q psy15037         15 ECGFVFCKDCLQGAH   29 (149)
Q Consensus        15 ~C~~aFC~~Cke~WH   29 (149)
                      .|+..||..|...|-
T Consensus        48 ~CgH~FC~~Ci~~~~   62 (141)
T 3knv_A           48 QCGHRYCSFCLASIL   62 (141)
T ss_dssp             TTSCEEEHHHHHHHG
T ss_pred             CCCCccCHHHHHHHH
Confidence            699999999999995


No 234
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1
Probab=20.87  E-value=34  Score=19.50  Aligned_cols=14  Identities=29%  Similarity=0.610  Sum_probs=9.0

Q ss_pred             CcccCCccCccccc
Q psy15037          9 KRIGCTECGFVFCK   22 (149)
Q Consensus         9 ~~v~Cp~C~~aFC~   22 (149)
                      +...|+.|+..|=.
T Consensus        29 ~~~~C~~C~~~f~~   42 (60)
T 2adr_A           29 KPYPCGLCNRAFTR   42 (60)
T ss_dssp             CSEECTTTCCEESS
T ss_pred             CCccCCCCCCccCC
Confidence            45667777777643


No 235
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1
Probab=20.69  E-value=43  Score=20.73  Aligned_cols=24  Identities=25%  Similarity=0.566  Sum_probs=16.7

Q ss_pred             CCCCcccCCccCcccccccccccc
Q psy15037          6 DGCKRIGCTECGFVFCKDCLQGAH   29 (149)
Q Consensus         6 ~~~~~v~Cp~C~~aFC~~Cke~WH   29 (149)
                      .+.....|+.|+..|=..-...-|
T Consensus         3 ~~~~~~~C~~C~~~f~~~~~l~~H   26 (95)
T 2yt9_A            3 SGSSGVACEICGKIFRDVYHLNRH   26 (95)
T ss_dssp             CCCSCEECSSSCCEESSSHHHHHH
T ss_pred             CCCCCeECCCCCCccCChHHHHHH
Confidence            456778999999988665544444


No 236
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1
Probab=20.51  E-value=35  Score=20.29  Aligned_cols=14  Identities=21%  Similarity=0.591  Sum_probs=7.4

Q ss_pred             CCCcccCC--ccCccc
Q psy15037          7 GCKRIGCT--ECGFVF   20 (149)
Q Consensus         7 ~~~~v~Cp--~C~~aF   20 (149)
                      +.+...|+  .|+..|
T Consensus        16 ~~~~~~C~~~~C~k~f   31 (73)
T 1f2i_G           16 KMRPYACPVESCDRRF   31 (73)
T ss_dssp             CCCCEECSSTTBCCEE
T ss_pred             CCCccCCcCCCCCCcc
Confidence            34455565  466554


No 237
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens}
Probab=20.36  E-value=21  Score=29.50  Aligned_cols=14  Identities=36%  Similarity=1.272  Sum_probs=0.0

Q ss_pred             ccCCccCccccccc
Q psy15037         11 IGCTECGFVFCKDC   24 (149)
Q Consensus        11 v~Cp~C~~aFC~~C   24 (149)
                      -.|-.||.+||..|
T Consensus       392 h~Cr~Cg~~~C~~C  405 (434)
T 3mpx_A          392 HHCHACGKIVCRNC  405 (434)
T ss_dssp             --------------
T ss_pred             hhcccCcCEeehhh
Confidence            34555566666555


No 238
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens}
Probab=20.26  E-value=61  Score=20.93  Aligned_cols=22  Identities=27%  Similarity=0.738  Sum_probs=14.5

Q ss_pred             CCcccCCccC----cccccccccccc
Q psy15037          8 CKRIGCTECG----FVFCKDCLQGAH   29 (149)
Q Consensus         8 ~~~v~Cp~C~----~aFC~~Cke~WH   29 (149)
                      .....|..|+    ..+|-.|-..||
T Consensus        10 ~~~~~C~vC~~~~~ll~Cd~C~~~~H   35 (66)
T 2lri_C           10 APGARCGVCGDGTDVLRCTHCAAAFH   35 (66)
T ss_dssp             CTTCCCTTTSCCTTCEECSSSCCEEC
T ss_pred             CCCCCcCCCCCCCeEEECCCCCCcee
Confidence            3344566554    567888888888


Done!