Query         psy15038
Match_columns 67
No_of_seqs    49 out of 51
Neff          3.6 
Searched_HMMs 46136
Date          Fri Aug 16 18:50:33 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15038.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15038hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04849 HAP1_N:  HAP1 N-termin  99.6 3.1E-16 6.7E-21  118.1   2.1   47   17-67      1-47  (306)
  2 KOG4360|consensus               98.5 2.9E-08 6.3E-13   80.4   0.0   45   20-67      1-47  (596)
  3 COG5435 Uncharacterized conser  50.3      13 0.00027   26.2   1.9   18   11-28     56-73  (147)
  4 cd08976 BaFpgNei_N_4 Uncharact  44.0      21 0.00046   22.4   2.1   22    6-27      2-24  (117)
  5 PF08383 Maf_N:  Maf N-terminal  44.0      19 0.00041   20.0   1.6   24   41-64      8-32  (35)
  6 cd08975 BaFpgNei_N_3 Uncharact  40.3      26 0.00057   22.6   2.1   22    6-27      2-24  (117)
  7 cd08966 EcFpg-like_N N-termina  31.8      24 0.00053   22.1   0.9   20    6-25      2-22  (120)
  8 cd08972 PF_Nei_N N-terminal do  28.1      26 0.00056   23.3   0.6   22    6-27      3-25  (137)
  9 cd03315 MLE_like Muconate lact  27.7      57  0.0012   22.8   2.3   22    9-30    115-137 (265)
 10 PF04135 Nop10p:  Nucleolar RNA  26.5      57  0.0012   19.2   1.8   29   18-51      9-39  (53)
 11 PF04255 DUF433:  Protein of un  26.3      32 0.00068   19.5   0.7   13   54-66     43-55  (56)
 12 cd08967 MeNeil1_N N-terminal d  25.5      42 0.00091   22.4   1.2   22    6-27      3-25  (131)
 13 PF08331 DUF1730:  Domain of un  24.9      71  0.0015   19.0   2.1   19   11-29     58-78  (78)
 14 PF02013 CBM_10:  Cellulose or   23.1      28  0.0006   19.0   0.0    8   35-42     27-34  (36)
 15 TIGR00256 D-tyrosyl-tRNA(Tyr)   22.7      52  0.0011   22.7   1.3   19   49-67     91-109 (145)
 16 cd08973 BaFpgNei_N_1 Uncharact  22.6      72  0.0016   20.4   1.9   25    6-30      3-28  (122)
 17 KOG3687|consensus               22.6      25 0.00054   32.4  -0.3   32   12-43    591-624 (1697)
 18 PRK05273 D-tyrosyl-tRNA(Tyr) d  22.5      53  0.0012   22.8   1.3   20   48-67     90-109 (147)
 19 cd08974 BaFpgNei_N_2 Uncharact  22.0      41 0.00088   21.0   0.6   23    6-28      3-25  (98)
 20 COG2442 Uncharacterized conser  21.5      51  0.0011   20.5   1.0   13   54-66     55-67  (79)
 21 COG1441 MenC O-succinylbenzoat  21.3      63  0.0014   25.2   1.6   18   12-29    146-163 (321)
 22 cd00563 Dtyr_deacylase D-Tyros  20.9      58  0.0013   22.5   1.3   20   48-67     90-109 (145)
 23 PF07981 Plasmod_MYXSPDY:  Plas  20.9      50  0.0011   15.7   0.6    7   21-27      5-11  (17)
 24 cd06562 GH20_HexA_HexB-like Be  20.1      56  0.0012   24.5   1.1   54   10-66     17-78  (348)

No 1  
>PF04849 HAP1_N:  HAP1 N-terminal conserved region;  InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues. HAP1 binds to huntingtin in a polyglutamine repeat-length-dependent manner. However, its possible role in the pathogenesis of Huntingtons disease is unclear. This family also includes a similar N-terminal conserved region from hypothetical protein products of ALS2CR3 genes found in the human juvenile amyotrophic lateral sclerosis critical region 2q33-2q34 [].
Probab=99.59  E-value=3.1e-16  Score=118.13  Aligned_cols=47  Identities=62%  Similarity=1.028  Sum_probs=43.3

Q ss_pred             HhhcCceeeeccccccccccccCcccccCCCCCCCCCCCCHHHHHHhhcCC
Q psy15038         17 EEQLPQYKLRADTLTEFIGYENQDWFVPCPLQADDPTALTPDQIRETLNYF   67 (67)
Q Consensus        17 eeqiP~YkLRaDsl~~~~gYenqDW~~~~p~~~~~~~~LSp~q~eETl~Yf   67 (67)
                      +||+|+|||||||||   ||+|+||+ +|+..|+.+.+|||+|++||||||
T Consensus         1 ~e~~~~y~~r~d~l~---~~~~~dw~-~p~~~~~~~~~ls~~~~~~~l~y~   47 (306)
T PF04849_consen    1 EEQLPPYKLRADTLY---GYDNQDWL-TPAAPPDRRPELSPEQIEETLRYF   47 (306)
T ss_pred             CCCCCCCCccccccc---cccccccc-CCCCCCCCCCCCCHHHHHHHHHHH
Confidence            589999999999996   99999999 557788888999999999999998


No 2  
>KOG4360|consensus
Probab=98.47  E-value=2.9e-08  Score=80.40  Aligned_cols=45  Identities=42%  Similarity=0.586  Sum_probs=39.5

Q ss_pred             cCceeeeccccccccccccCcccccCCCCCCCCCC--CCHHHHHHhhcCC
Q psy15038         20 LPQYKLRADTLTEFIGYENQDWFVPCPLQADDPTA--LTPDQIRETLNYF   67 (67)
Q Consensus        20 iP~YkLRaDsl~~~~gYenqDW~~~~p~~~~~~~~--LSp~q~eETl~Yf   67 (67)
                      +|+|||++|+.+   ||+|+||.+.|.-.+|...+  +|+.+++||++||
T Consensus         1 lpqykl~~~~~~---g~~h~~~~~~p~i~~d~~~a~s~s~~~a~et~~~~   47 (596)
T KOG4360|consen    1 LPQYKLMRDTRL---GYCHADWRLGPGIPADATCAPSLSASPAEETSAYP   47 (596)
T ss_pred             CCchhhccchhh---cccccchhhCCCCchhhccCCCCcccccccCccch
Confidence            699999999996   99999999875446677666  9999999999997


No 3  
>COG5435 Uncharacterized conserved protein [Function unknown]
Probab=50.27  E-value=13  Score=26.18  Aligned_cols=18  Identities=39%  Similarity=0.700  Sum_probs=15.5

Q ss_pred             HHhHHHHhhcCceeeecc
Q psy15038         11 EIISLLEEQLPQYKLRAD   28 (67)
Q Consensus        11 EliSlleeqiP~YkLRaD   28 (67)
                      +.|++|.+|||.|+|..-
T Consensus        56 rql~~l~k~Lpgy~~~~~   73 (147)
T COG5435          56 RQLALLRKQLPGYELHHR   73 (147)
T ss_pred             HHHHHHHhhCCCeEEeec
Confidence            478999999999999763


No 4  
>cd08976 BaFpgNei_N_4 Uncharacterized bacterial subgroup of the N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei  (endonuclease VIII) base-excision repair DNA glycosylases. This family is an uncharacterized bacterial subgroup of the FpgNei_N domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. This N-terminal proline is conserved in this family. Escherichia coli Fpg prefers 8
Probab=44.00  E-value=21  Score=22.43  Aligned_cols=22  Identities=36%  Similarity=0.505  Sum_probs=15.3

Q ss_pred             CCChhHHh-HHHHhhcCceeeec
Q psy15038          6 DLPEVEII-SLLEEQLPQYKLRA   27 (67)
Q Consensus         6 dlpEvEli-SlleeqiP~YkLRa   27 (67)
                      .|||||.+ ..|+..+--.++..
T Consensus         2 ELPEVe~~~~~l~~~~~g~~I~~   24 (117)
T cd08976           2 ELPEVEVQKQYLERTSLHRKIVE   24 (117)
T ss_pred             CCcchHHHHHHHHHHhCCCEEEE
Confidence            68999955 55666777666654


No 5  
>PF08383 Maf_N:  Maf N-terminal region;  InterPro: IPR013592 This region is found in various leucine zipper transcription factors of the Maf family. These are implicated in the regulation of insulin gene expression [], in erythroid differentiation [], and in differentiation of the neuroretina []. 
Probab=43.96  E-value=19  Score=20.00  Aligned_cols=24  Identities=29%  Similarity=0.552  Sum_probs=16.3

Q ss_pred             ccccCCCC-CCCCCCCCHHHHHHhh
Q psy15038         41 WFVPCPLQ-ADDPTALTPDQIRETL   64 (67)
Q Consensus        41 W~~~~p~~-~~~~~~LSp~q~eETl   64 (67)
                      |..+.+.+ ......||||.+-|+|
T Consensus         8 Wm~~~~Qq~~pe~l~LtpEDAvEaL   32 (35)
T PF08383_consen    8 WMANYQQQMNPEALGLTPEDAVEAL   32 (35)
T ss_pred             ccccchhhcChhhcCCCHHHHHHHH
Confidence            76443332 2346789999999987


No 6  
>cd08975 BaFpgNei_N_3 Uncharacterized bacterial subgroup of the N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei  (endonuclease VIII) base-excision repair DNA glycosylases. This family is an uncharacterized bacterial subgroup of the FpgNei_N domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. One exception is mouse Nei-like glycosylase 3 (Neil3) which forms a Schiff base int
Probab=40.25  E-value=26  Score=22.59  Aligned_cols=22  Identities=27%  Similarity=0.477  Sum_probs=16.2

Q ss_pred             CCChhHHh-HHHHhhcCceeeec
Q psy15038          6 DLPEVEII-SLLEEQLPQYKLRA   27 (67)
Q Consensus         6 dlpEvEli-SlleeqiP~YkLRa   27 (67)
                      .|||||.+ .-|+..+--.|+..
T Consensus         2 ELPEVEtv~r~L~~~l~G~~I~~   24 (117)
T cd08975           2 ELPESATLSKQLNETLKGKRITD   24 (117)
T ss_pred             CchhHHHHHHHHHHHcCCCEEeE
Confidence            58999955 45777787777665


No 7  
>cd08966 EcFpg-like_N N-terminal domain of Escherichia coli Fpg1/MutM and related bacterial DNA glycosylases. This family contains the N-terminal domain of Escherichia coli Fpg1/MutM and related bacterial DNA glycosylases. It belongs to the FpgNei_N, [N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei (endonuclease VIII)] domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate.  Es
Probab=31.83  E-value=24  Score=22.08  Aligned_cols=20  Identities=35%  Similarity=0.577  Sum_probs=12.5

Q ss_pred             CCChhHHhHH-HHhhcCceee
Q psy15038          6 DLPEVEIISL-LEEQLPQYKL   25 (67)
Q Consensus         6 dlpEvEliSl-leeqiP~YkL   25 (67)
                      .|||||.++. |++.+=--++
T Consensus         2 ELPEve~~~~~l~~~l~G~~I   22 (120)
T cd08966           2 ELPEVETVRRGLAPHLVGRRI   22 (120)
T ss_pred             CCccHHHHHHHHHHHhCCCEE
Confidence            6899996654 4455544444


No 8  
>cd08972 PF_Nei_N N-terminal domain of the plant and fungal Nei and related proteins. This family contains the N-terminal domain of plant and Fungi Nei and related proteins. It belongs to the FpgNei_N, [N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei (endonuclease VIII)] domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. The plant and fungal FpgNei glycosylases prefer the 
Probab=28.06  E-value=26  Score=23.28  Aligned_cols=22  Identities=41%  Similarity=0.458  Sum_probs=14.4

Q ss_pred             CCChhHHhHH-HHhhcCceeeec
Q psy15038          6 DLPEVEIISL-LEEQLPQYKLRA   27 (67)
Q Consensus         6 dlpEvEliSl-leeqiP~YkLRa   27 (67)
                      .|||||.++- |+..+---++..
T Consensus         3 ELPEVe~v~~~L~~~l~G~~I~~   25 (137)
T cd08972           3 ELPEVERARRLLEEHCLGKKITK   25 (137)
T ss_pred             chHHHHHHHHHHHHHhCCCEEEE
Confidence            6899996654 555666555544


No 9  
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily. Enzymes of this subgroup share three conserved carboxylate ligands for the essential divalent metal ion (usually Mg2+), two aspartates and a glutamate, and residues that can function as general acid/base catalysts, a Lys-X-Lys motif and another conserved lysine. Despite these conserved residues, the members of the MLE subgroup, like muconate lactonizing enzyme, o-succinylbenzoate synthase (OSBS) and N-acylamino acid racemase (NAAAR), catalyze different reactions.
Probab=27.67  E-value=57  Score=22.82  Aligned_cols=22  Identities=27%  Similarity=0.474  Sum_probs=19.1

Q ss_pred             hhHHhHHHHhhcC-ceeeecccc
Q psy15038          9 EVEIISLLEEQLP-QYKLRADTL   30 (67)
Q Consensus         9 EvEliSlleeqiP-~YkLRaDsl   30 (67)
                      ++|+|..+.|.+| ..+||+|.=
T Consensus       115 d~~~v~~vr~~~g~~~~l~vDan  137 (265)
T cd03315         115 DVAVVAALREAVGDDAELRVDAN  137 (265)
T ss_pred             HHHHHHHHHHhcCCCCEEEEeCC
Confidence            5789999999996 899999974


No 10 
>PF04135 Nop10p:  Nucleolar RNA-binding protein, Nop10p family;  InterPro: IPR007264 H/ACA ribonucleoprotein particles (RNPs) are a family of RNA pseudouridine synthases that specify modification sites through guide RNAs. More than 100 mammalian H/ACA RNAs form an equal number of ribonucleoproteins (RNPs) by associating with the same four core proteins: Cbf5, Gar1, Nhp2 and Nop10. The function of these H/ACA RNPs is essential for biogenesis of the ribosome, splicing of precursor mRNAs (pre-mRNAs), maintenance of telomeres and probably for additional cellular processes []. Recent crystal structures of archaeal H/ACA protein complexes show how the same four proteins accommodate >100 distinct but related H/ACA RNAs []. The complex contains a stable core composed of Cbf5 and Nop10, to which Gar1 and Nhp2 subsequently bind, the complex interacts with snoRNAs []. In eukaryotes Nop10 is a nucleolar protein that is specifically associated with H/ACA snoRNAs. It is essential for normal 18S rRNA production and rRNA pseudouridylation by the ribonucleoprotein particles containing H/ACA snoRNAs (H/ACA snoRNPs). Nop10 is probably necessary for the stability of these RNPs [].; PDB: 2RFK_B 3LWR_B 2HVY_C 3HAX_C 3MQK_B 3LWO_B 3LWV_B 3HAY_C 3HJY_B 2EY4_E ....
Probab=26.51  E-value=57  Score=19.20  Aligned_cols=29  Identities=21%  Similarity=0.122  Sum_probs=19.7

Q ss_pred             hhcCceeeeccccccccccccCcccccCCC--CCCC
Q psy15038         18 EQLPQYKLRADTLTEFIGYENQDWFVPCPL--QADD   51 (67)
Q Consensus        18 eqiP~YkLRaDsl~~~~gYenqDW~~~~p~--~~~~   51 (67)
                      .+.=+|||+ |..    -.++..+..+-|+  .|++
T Consensus         9 ~~~~~YTLk-~~c----p~cG~~T~~ahPaRFSPdD   39 (53)
T PF04135_consen    9 PGCRVYTLK-DKC----PPCGGPTESAHPARFSPDD   39 (53)
T ss_dssp             TTTCEEESS-SBB----TTTSSBSEESSSSSS-TTT
T ss_pred             CCCCcEeCC-Ccc----CCCCCCCcCCcCCCCCCCC
Confidence            455589999 666    5688888866555  4554


No 11 
>PF04255 DUF433:  Protein of unknown function (DUF433);  InterPro: IPR007367 This is a family of uncharacterised proteins.; PDB: 2GA1_B.
Probab=26.32  E-value=32  Score=19.49  Aligned_cols=13  Identities=46%  Similarity=0.761  Sum_probs=9.8

Q ss_pred             CCCHHHHHHhhcC
Q psy15038         54 ALTPDQIRETLNY   66 (67)
Q Consensus        54 ~LSp~q~eETl~Y   66 (67)
                      .||+++++++|.|
T Consensus        43 ~Lt~~~i~aAl~y   55 (56)
T PF04255_consen   43 SLTLEDIRAALAY   55 (56)
T ss_dssp             T--HHHHHHHHHH
T ss_pred             CCCHHHHHHHHHh
Confidence            5999999999987


No 12 
>cd08967 MeNeil1_N N-terminal domain of metazoan Nei-like glycosylase 1 (NEIL1). This family contains the N-terminal domain of metazoan NEIL1. It belongs to the FpgNei_N, [N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei (endonuclease VIII)] domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. NEIL1 recognizes the oxidized pyrimidines 2,6-diamino-4-hydroxy-5-formamidopyrimidi
Probab=25.46  E-value=42  Score=22.43  Aligned_cols=22  Identities=18%  Similarity=0.306  Sum_probs=14.1

Q ss_pred             CCChhHHhHHH-HhhcCceeeec
Q psy15038          6 DLPEVEIISLL-EEQLPQYKLRA   27 (67)
Q Consensus         6 dlpEvEliSll-eeqiP~YkLRa   27 (67)
                      .|||||.++.- +..+=--++..
T Consensus         3 ELPEVe~vr~~L~~~~~g~~I~~   25 (131)
T cd08967           3 EGPELHLASLFVNKMCKGLIFTG   25 (131)
T ss_pred             CcHHHHHHHHHHHHhcCCCEEEE
Confidence            68999977754 44465555443


No 13 
>PF08331 DUF1730:  Domain of unknown function (DUF1730);  InterPro: IPR013542 This domain of unknown function occurs in iron-sulphur cluster-binding proteins together with the 4Fe-4S binding domain (IPR001450 from INTERPRO). 
Probab=24.90  E-value=71  Score=19.01  Aligned_cols=19  Identities=26%  Similarity=0.525  Sum_probs=15.7

Q ss_pred             HHhHHHHhhcCc--eeeeccc
Q psy15038         11 EIISLLEEQLPQ--YKLRADT   29 (67)
Q Consensus        11 EliSlleeqiP~--YkLRaDs   29 (67)
                      +|...|+++.|.  ||.=+||
T Consensus        58 ~l~~~i~~~~~~~~~r~~VDT   78 (78)
T PF08331_consen   58 QLAEWIRELGPDFEYRIFVDT   78 (78)
T ss_pred             HHHHHHHHHCCCCCeEEeecC
Confidence            478889999999  7877776


No 14 
>PF02013 CBM_10:  Cellulose or protein binding domain;  InterPro: IPR002883 This domain is found in two distinct sets of proteins with different functions. Those found in aerobic bacteria bind cellulose (or other carbohydrates); but in anaerobic fungi they are protein binding domains, referred to as dockerin domains or docking domains. They are believed to be responsible for the assembly of a multiprotein cellulase/hemicellulase complex, similar to the cellulosome found in certain anaerobic bacteria. The recycling of photosynthetically fixed carbon in plant cell walls is a key microbial process. Enzyme systems that attack the plant cell wall contain noncatalytic carbohydrate-binding modules that mediate attachment to this composite structure and play a pivotal role in maximizing the hydrolytic process. In anaerobes, the degradation is carried out by a high molecular weight, multifunctional complex termed the cellulosome. This consists of a number of independent enzyme components, each of which contains a conserved 40-residue dockerin domain, which functions to bind the enzyme to a cohesin domain within the scaffoldin protein [, ].  In anaerobic bacteria that degrade plant cell walls, exemplified by Clostridium thermocellum, the dockerin domains of the catalytic polypeptides can bind equally well to any cohesin from the same organism. More recently, anaerobic fungi, typified by Piromyces equi, have been suggested to also synthesise a cellulosome complex, although the dockerin sequences of the bacterial and fungal enzymes are completely different []. For example, the fungal enzymes contain one, two or three copies of the dockerin sequence in tandem within the catalytic polypeptide. In contrast, all the C. thermocellum cellulosome catalytic components contain a single dockerin domain. The anaerobic bacterial dockerins are homologous to EF hands (calcium-binding motifs) and require calcium for activity whereas the fungal dockerin does not require calcium. Finally, the interaction between cohesin and dockerin appears to be species specific in bacteria, there is almost no species specificity of binding within fungal species and no identified sites that distinguish different species.  The structure of dockerin from P. equi contains two helical stretches and four short beta-strands which form an antiparallel sheet structure adjacent to an additional short twisted parallel strand. The N- and C-termini are adjacent to each other.  Aerobic bacteria contain related regions, however these appear to function as cellulose/carbohydrate binding domains.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 2J4M_A 2J4N_A 1E8R_A 1QLD_A 1E8P_A 1E8Q_A.
Probab=23.09  E-value=28  Score=19.04  Aligned_cols=8  Identities=63%  Similarity=1.248  Sum_probs=6.6

Q ss_pred             ccccCccc
Q psy15038         35 GYENQDWF   42 (67)
Q Consensus        35 gYenqDW~   42 (67)
                      |+||.+|-
T Consensus        27 GvEN~~wC   34 (36)
T PF02013_consen   27 GVENGDWC   34 (36)
T ss_dssp             EEETTEEE
T ss_pred             eeECCceE
Confidence            78888885


No 15 
>TIGR00256 D-tyrosyl-tRNA(Tyr) deacylase. This homodimeric enzyme appears able to cleave any D-amino acid (and glycine, which does not have distinct D/L forms) from charged tRNA. The name reflects characterization with respect to D-Tyr on tRNA(Tyr) as established in the literature, but substrate specificity seems much broader.
Probab=22.65  E-value=52  Score=22.73  Aligned_cols=19  Identities=26%  Similarity=0.510  Sum_probs=14.3

Q ss_pred             CCCCCCCCHHHHHHhhcCC
Q psy15038         49 ADDPTALTPDQIRETLNYF   67 (67)
Q Consensus        49 ~~~~~~LSp~q~eETl~Yf   67 (67)
                      |+=+.+.+|+.+++-+.+|
T Consensus        91 PsF~~a~~~~~A~~ly~~f  109 (145)
T TIGR00256        91 PSFSKGASPDRAEELYEYF  109 (145)
T ss_pred             CCccccCCHHHHHHHHHHH
Confidence            3445688999999988775


No 16 
>cd08973 BaFpgNei_N_1 Uncharacterized bacterial subgroup of the N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei  (endonuclease VIII) base-excision repair DNA glycosylases. This family is an uncharacterized bacterial subgroup of the FpgNei_N domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. This N-terminal proline is conserved in this family. Escherichia coli Fpg prefers 8
Probab=22.62  E-value=72  Score=20.35  Aligned_cols=25  Identities=36%  Similarity=0.521  Sum_probs=17.4

Q ss_pred             CCChhHHhH-HHHhhcCceeeecccc
Q psy15038          6 DLPEVEIIS-LLEEQLPQYKLRADTL   30 (67)
Q Consensus         6 dlpEvEliS-lleeqiP~YkLRaDsl   30 (67)
                      .+||||.++ .|++++---++..=.+
T Consensus         3 ELPEve~~~~~L~~~l~Gk~I~~v~~   28 (122)
T cd08973           3 ELPEVEVYAENLERRLTGKTITRVEL   28 (122)
T ss_pred             ChHHHHHHHHHHHHhcCCCEEEEEEE
Confidence            589999655 5567787777765444


No 17 
>KOG3687|consensus
Probab=22.58  E-value=25  Score=32.38  Aligned_cols=32  Identities=34%  Similarity=0.201  Sum_probs=23.2

Q ss_pred             HhHHHHhhcC--ceeeeccccccccccccCcccc
Q psy15038         12 IISLLEEQLP--QYKLRADTLTEFIGYENQDWFV   43 (67)
Q Consensus        12 liSlleeqiP--~YkLRaDsl~~~~gYenqDW~~   43 (67)
                      ++|-+.=|+=  .++||||++|....-+|+||.+
T Consensus       591 ~~s~ir~~~f~~l~llRa~~~Y~lg~Pcn~~~Vv  624 (1697)
T KOG3687|consen  591 IASSIRLQAFDFLFLLRADSLYRLGLPCNKDGVV  624 (1697)
T ss_pred             hhhHHHHHHHHHHHHHhhcccceecccCCCccEE
Confidence            4444433333  4579999999998889999984


No 18 
>PRK05273 D-tyrosyl-tRNA(Tyr) deacylase; Provisional
Probab=22.53  E-value=53  Score=22.77  Aligned_cols=20  Identities=20%  Similarity=0.449  Sum_probs=14.8

Q ss_pred             CCCCCCCCCHHHHHHhhcCC
Q psy15038         48 QADDPTALTPDQIRETLNYF   67 (67)
Q Consensus        48 ~~~~~~~LSp~q~eETl~Yf   67 (67)
                      .|+=+.+.+|+.+++-+.+|
T Consensus        90 rP~F~~a~~~~~A~~ly~~f  109 (147)
T PRK05273         90 RPSFSAAAPPEEAEPLYDYF  109 (147)
T ss_pred             CCCccccCCHHHHHHHHHHH
Confidence            34445788999999887765


No 19 
>cd08974 BaFpgNei_N_2 Uncharacterized bacterial subgroup of the N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei  (endonuclease VIII) base-excision repair DNA glycosylases. This family is an uncharacterized bacterial subgroup of the FpgNei_N domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. This N-terminal proline is conserved in this family. Escherichia coli Fpg prefers 8
Probab=22.04  E-value=41  Score=21.05  Aligned_cols=23  Identities=9%  Similarity=0.104  Sum_probs=14.6

Q ss_pred             CCChhHHhHHHHhhcCceeeecc
Q psy15038          6 DLPEVEIISLLEEQLPQYKLRAD   28 (67)
Q Consensus         6 dlpEvEliSlleeqiP~YkLRaD   28 (67)
                      ++||||.+.---+.+-.-++..-
T Consensus         3 ELPEVe~~~~~L~~~~g~~I~~v   25 (98)
T cd08974           3 EGPSIVILREAAAAFKGQTVIRA   25 (98)
T ss_pred             ccHHHHHHHHHHHHhCCCEEEEE
Confidence            68999966554443666555443


No 20 
>COG2442 Uncharacterized conserved protein [Function unknown]
Probab=21.53  E-value=51  Score=20.54  Aligned_cols=13  Identities=46%  Similarity=0.741  Sum_probs=11.6

Q ss_pred             CCCHHHHHHhhcC
Q psy15038         54 ALTPDQIRETLNY   66 (67)
Q Consensus        54 ~LSp~q~eETl~Y   66 (67)
                      .||.+|+.++++|
T Consensus        55 ~Lt~~dI~aal~y   67 (79)
T COG2442          55 DLTLEDIRAALRY   67 (79)
T ss_pred             CCCHHHHHHHHHH
Confidence            5999999999987


No 21 
>COG1441 MenC O-succinylbenzoate synthase [Coenzyme metabolism]
Probab=21.26  E-value=63  Score=25.21  Aligned_cols=18  Identities=44%  Similarity=0.765  Sum_probs=16.7

Q ss_pred             HhHHHHhhcCceeeeccc
Q psy15038         12 IISLLEEQLPQYKLRADT   29 (67)
Q Consensus        12 liSlleeqiP~YkLRaDs   29 (67)
                      |+.|+.|-||.-.||.|.
T Consensus       146 ivnllLEaiPDL~LRLDA  163 (321)
T COG1441         146 IVNLLLEAIPDLHLRLDA  163 (321)
T ss_pred             HHHHHHHhCccceeeecc
Confidence            789999999999999985


No 22 
>cd00563 Dtyr_deacylase D-Tyrosyl-tRNAtyr deacylases; a class of tRNA-dependent hydrolases which are capable of hydrolyzing the ester bond of D-Tyrosyl-tRNA reducing the level of cellular D-Tyrosine while recycling the peptidyl-tRNA; found in bacteria and in eukaryotes but not in archea; beta barrel-like fold structure; forms homodimers in which two surface cavities serve as the active site for tRNA binding
Probab=20.87  E-value=58  Score=22.48  Aligned_cols=20  Identities=20%  Similarity=0.296  Sum_probs=14.8

Q ss_pred             CCCCCCCCCHHHHHHhhcCC
Q psy15038         48 QADDPTALTPDQIRETLNYF   67 (67)
Q Consensus        48 ~~~~~~~LSp~q~eETl~Yf   67 (67)
                      .|+=+.+.+|+.+++-+.+|
T Consensus        90 rP~F~~a~~~e~A~~ly~~f  109 (145)
T cd00563          90 RPSFSAAAPPDKAEPLYESF  109 (145)
T ss_pred             CCCccccCCHHHHHHHHHHH
Confidence            34445688999999988775


No 23 
>PF07981 Plasmod_MYXSPDY:  Plasmodium repeat_MYXSPDY;  InterPro: IPR012598 This repeat is found in two hypothetical Plasmodium proteins.
Probab=20.85  E-value=50  Score=15.73  Aligned_cols=7  Identities=57%  Similarity=1.137  Sum_probs=5.8

Q ss_pred             Cceeeec
Q psy15038         21 PQYKLRA   27 (67)
Q Consensus        21 P~YkLRa   27 (67)
                      |.|+||.
T Consensus         5 PdytL~~   11 (17)
T PF07981_consen    5 PDYTLRL   11 (17)
T ss_pred             CCceEEE
Confidence            8899885


No 24 
>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. The hexA and hexB genes encode the alpha- and beta-subunits of the two major beta-N-acetylhexosaminidase isoenzymes, N-acetyl-beta-D-hexosaminidase A (HexA) and beta-N-acetylhexosaminidase B  (HexB). Both the alpha and the beta catalytic subunits have a TIM-barrel fold and belong to the glycosyl hydrolase family 20 (GH20).  The HexA enzyme is a heterodimer containing one alpha and one beta subunit while the HexB enzyme is a homodimer containing two beta-subunits.  Hexosaminidase mutations cause an inability to properly hydrolyze certain sphingolipids which accumulate in lysosomes within the brain, resulting in the lipid storage disorders Tay-Sachs and Sandhoff.  Mutations in the alpha subunit cause in a deficiency in the HexA enzyme and result in 
Probab=20.08  E-value=56  Score=24.48  Aligned_cols=54  Identities=19%  Similarity=0.314  Sum_probs=38.6

Q ss_pred             hHHhHHHHhhcCceeeeccccccccccccCcccccCCCCCCC--------CCCCCHHHHHHhhcC
Q psy15038         10 VEIISLLEEQLPQYKLRADTLTEFIGYENQDWFVPCPLQADD--------PTALTPDQIRETLNY   66 (67)
Q Consensus        10 vEliSlleeqiP~YkLRaDsl~~~~gYenqDW~~~~p~~~~~--------~~~LSp~q~eETl~Y   66 (67)
                      ++-|..+-+++-.||+.+   +.+-+-++|-|-...+.-|..        ..-+|.++++|..+|
T Consensus        17 ~~~ik~~Id~ma~~KlN~---lh~HltDd~~~rle~~~~P~Lt~~ga~~~~~~YT~~di~eiv~y   78 (348)
T cd06562          17 VDSIKRTIDAMAYNKLNV---LHWHITDSQSFPLESPSYPELSKKGAYSPSEVYTPEDVKEIVEY   78 (348)
T ss_pred             HHHHHHHHHHHHHhCCcE---EEEeEEcCCCceEeeCCCchhhhccCcCCCceECHHHHHHHHHH
Confidence            565666667778888876   344577899998776665543        224899999999877


Done!