Diaphorina citri psyllid: psy1503

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MYAWEKPFTALVDQARKIEIGVVQKTSYLRGLYMTFNLFTTRMALFCTLTSFIFFGGRLSTDRVLNFLLLGEHEPRKINSVHSNGKGHVSLDNVTAQWSLQNADLTLNAVSITFKPKQLACIIGAIGAGKTSLLHIILNELRISSGKVSLGGTVSYASQEPWIFAATIRQNILFGLPYLRRRYADVIRVCALQDDFDSLPNGDFTVVGERGASLSGGQKARINLARAVYKNADIYLLDDPLSAVDMHVGKHLFEDCISGCLTSGL
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEEccccEEEEEccccccHHHHHHHHHcccccccCEEEEccEEEEEcccccccccccHHHHcccccccHHHHHHHHHHHcccHHHccccccccccccccccccccHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHHcccc
MYAWEKPFTALVDQARKIEIGVVQKTSYLRGLYMTFNLFTTRMALFCTLTSFIFFGGRLSTDRVLNFLLLGEHEPRKINSVHSNGKGHVSLDNVTAQWSLQNADLTLNAVSITFKPKQLACIIGAIGAGKTSLLHIILNELRISSGKVSLGGTVSYASQEPWIFAATIRQNILFGLPYLRRRYADVIRVCALQDDFDSLPNGDFTVVGERGASLSGGQKARINLARAVYKNADIYLLDDPLSAVDMHVGKHLFEDCISGCLTSG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYAWEKPFTALVDQARKIEIGVVQKTSYLRGLYMTFNLFTTRMALFCTLTSFIFFGGRLSTDRVLNFLLLGEHEPRKINSVHSNGKGHVSLDNVTAQWSLQNADLTLNAVSITFKPKQLACIIGAIGAGKTSLLHIILNELRISSGKVSLGGTVSYASQEPWIFAATIRQNILFGLPYLRRRYADVIRVCALQDDFDSLPNGDFTVVGERGASLSGGQKARINLARAVYKNADIYLLDDPLSAVDMHVGKHLFEDCISGCLTSGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042626 [MF]ATPase activity, coupled to transmembrane movement of substancesprobableGO:0016787, GO:0016818, GO:0016820, GO:0042623, GO:0005215, GO:0043492, GO:0016817, GO:0003824, GO:0017111, GO:0015399, GO:0022857, GO:0003674, GO:0016887, GO:0016462, GO:0015405, GO:0022804
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0000325 [CC]plant-type vacuoleprobableGO:0005737, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032502 [BP]developmental processprobableGO:0008150
GO:0032501 [BP]multicellular organismal processprobableGO:0008150
GO:0015075 [MF]ion transmembrane transporter activityprobableGO:0022891, GO:0005215, GO:0022857, GO:0022892, GO:0003674
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0006820 [BP]anion transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0032991 [CC]macromolecular complexprobableGO:0005575
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000329 [CC]fungal-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000324, GO:0000323, GO:0000322, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0043231, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 62-264
View the alignment between query and template
View the model in PyMOL
Template: 3B5W, chain A
Confidence level:probable
Coverage over the Query: 38-245
View the alignment between query and template
View the model in PyMOL