Diaphorina citri psyllid: psy15045


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MQKIMAQYIYVTNNLEEDGMEIPSEDDGTILLSTLQAQYPSAIGLKYKVESRYRAVKLADGHLYAPLDGWQDRVYYCTFDASGNSSATQSKRSYPDNSGPVQNTDLVVLGIPWTFTDNDLKEYFEQFGTLEFANVKVDKNTGRSKGFGFIRFSSHESALKAMLKKHKIGNRICDVRIPESTKIGTEEPVASKVFVGSLTPDLTESDLREHFEYYGAVVDVLIPKPFREFAFVTFELDSVAKSLIGQHVNIKDKKVVVMEATPKKKMNERQDNRNNFDRRNDRSRSPMSNSRQYGGGNGYYDNRQQQQGGYNNKRRRNDYDDWHHGNGGNSNNATVSPDVLQAVVSKAVSEVLNVQKAIDESKY
cHHcccccEEEEccccccccccccccccEEEEcEEEEEccccccccccccccEEEEEccccCECcccccccccEEEEEcccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHcccEEEEEEEEEccccccccccEEEEEccHHHHHHHHHcccEEccCEEECccccccccccccccccEEEEccccccccHHHHHHHHHccccEEEEEcccccccEEEEEEcccHHHHHHHcccCEEccEEEEEEEcccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccc
****MAQYIYVTNNLEEDGMEIPSEDDGTILLSTLQAQYPSAIGLKYKVESRYRAVKLADGHLYAPLDGWQDRVYYCTFD**********************NTDLVVLGIPWTFTDNDLKEYFEQFGTLEFANVKVDKNTGRSKGFGFIRFSSHESALKAMLKKHKIGNRICDVRIPES*******PVASKVFVGSLTPDLTESDLREHFEYYGAVVDVLIPKPFREFAFVTFELDSVAKSLIGQHVNIKDKKVVVM*********************************************************************************LQAVVSKAV***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKIMAQYIYVTNNLEEDGMEIPSEDDGTILLSTLQAQYPSAIGLKYKVESRYRAVKLADGHLYAPLDGWQDRVYYCTFDASGNSSATQSKRSYPDNSGPVQNTDLVVLGIPWTFTDNDLKEYFEQFGTLEFANVKVDKNTGRSKGFGFIRFSSHESALKAMLKKHKIGNRICDVRIPESTKIGTEEPVASKVFVGSLTPDLTESDLREHFEYYGAVVDVLIPKPFREFAFVTFELDSVAKSLIGQHVNIKDKKVVVMEATPKKKMNERQDNRNNFDRRNDRSRSPMSNSRQYGGGNGYYDNRQQQQGGYNNKRRRNDYDDWHHGNGGNSNNATVSPDVLQAVVSKAVSEVLNVQKAIDESKY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
TAR DNA-binding protein 43 DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division.confidentQ5R5W2
TAR DNA-binding protein 43 DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division.confidentQ921F2
TAR DNA-binding protein 43 DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR.confidentQ13148

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045111 [CC]intermediate filament cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051168 [BP]nuclear exportprobableGO:0051169, GO:0051234, GO:0046907, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0043922 [BP]negative regulation by host of viral transcriptionprobableGO:0019219, GO:0080090, GO:0009890, GO:2000242, GO:0031326, GO:2000241, GO:0031323, GO:0044403, GO:0052472, GO:0009892, GO:0050789, GO:0010605, GO:0019222, GO:0051171, GO:0051851, GO:0044419, GO:0031327, GO:0051817, GO:0046782, GO:0048518, GO:0048519, GO:0051704, GO:0065008, GO:0031324, GO:0045934, GO:0060255, GO:0050792, GO:0009889, GO:0050794, GO:0043902, GO:0043900, GO:0008150, GO:0043921, GO:0051172, GO:2001141, GO:0051702, GO:0032897, GO:0052312, GO:0051253, GO:0051252, GO:0035821, GO:0065007, GO:0010556, GO:0048524, GO:0010558, GO:0048523, GO:0048522
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0070935 [BP]3'-UTR-mediated mRNA stabilizationprobableGO:0019222, GO:0043489, GO:0043488, GO:0043487, GO:0010608, GO:0050789, GO:0060255, GO:0065007, GO:0048255, GO:0008150, GO:0065008, GO:0010468
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0000902 [BP]cell morphogenesisprobableGO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:0010557 [BP]positive regulation of macromolecule biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0060255, GO:0009889, GO:0010556, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0010604
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0003730 [MF]mRNA 3'-UTR bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723
GO:0042162 [MF]telomeric DNA bindingprobableGO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:2000112 [BP]regulation of cellular macromolecule biosynthetic processprobableGO:0009889, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0050794, GO:0010556, GO:0065007, GO:0008150, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005726 [CC]perichromatin fibrilsprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031328 [BP]positive regulation of cellular biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0009889, GO:0050794, GO:0031323, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0051170 [BP]nuclear importprobableGO:0051169, GO:0009987, GO:0046907, GO:0006810, GO:0006913, GO:0044765, GO:0008150, GO:0051641, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0016482
GO:0035061 [CC]interchromatin granuleprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0005703 [CC]polytene chromosome puffprobableGO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0000380 [BP]alternative mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0006396, GO:0006397
GO:0048027 [MF]mRNA 5'-UTR bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 102-267
View the alignment between query and template
View the model in PyMOL
Template: 2GHP, chain A
Confidence level:very confident
Coverage over the Query: 28-264
View the alignment between query and template
View the model in PyMOL