BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15048
(207 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4B7L|A Chain A, Crystal Structure Of Human Filamin B Actin Binding Domain
With 1st Filamin Repeat
pdb|4B7L|B Chain B, Crystal Structure Of Human Filamin B Actin Binding Domain
With 1st Filamin Repeat
Length = 347
Score = 26.9 bits (58), Expect = 8.5, Method: Compositional matrix adjust.
Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 8/67 (11%)
Query: 4 PGTDQHRVTFYASETPQAE---GSMNIPGINQNKATGH-----PEYNTLDEPIRTTIMRD 55
P D+H V Y S+ P+A+ G+ P +N KA + P N + +P + T+
Sbjct: 223 PDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTI 282
Query: 56 LSAVGDL 62
+ GD+
Sbjct: 283 SAGQGDV 289
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.142 0.444
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,967,059
Number of Sequences: 62578
Number of extensions: 219385
Number of successful extensions: 406
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 406
Number of HSP's gapped (non-prelim): 1
length of query: 207
length of database: 14,973,337
effective HSP length: 94
effective length of query: 113
effective length of database: 9,091,005
effective search space: 1027283565
effective search space used: 1027283565
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 49 (23.5 bits)