BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15048
         (207 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4B7L|A Chain A, Crystal Structure Of Human Filamin B Actin Binding Domain
           With 1st Filamin Repeat
 pdb|4B7L|B Chain B, Crystal Structure Of Human Filamin B Actin Binding Domain
           With 1st Filamin Repeat
          Length = 347

 Score = 26.9 bits (58), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 4   PGTDQHRVTFYASETPQAE---GSMNIPGINQNKATGH-----PEYNTLDEPIRTTIMRD 55
           P  D+H V  Y S+ P+A+   G+   P +N  KA  +     P  N + +P + T+   
Sbjct: 223 PDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTI 282

Query: 56  LSAVGDL 62
            +  GD+
Sbjct: 283 SAGQGDV 289


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.142    0.444 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,967,059
Number of Sequences: 62578
Number of extensions: 219385
Number of successful extensions: 406
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 406
Number of HSP's gapped (non-prelim): 1
length of query: 207
length of database: 14,973,337
effective HSP length: 94
effective length of query: 113
effective length of database: 9,091,005
effective search space: 1027283565
effective search space used: 1027283565
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 49 (23.5 bits)