Diaphorina citri psyllid: psy15057


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MDSLRELKSQLNILSRSDGSVIFSQGQTVVVASMYGPVEAKIQKTIIDKASVEVIFRPKSGLSFVQDRLKESVIKSTCESALLTMLHPRTSVILTIQELQDQGSLLSCCINAACLALINSGISMRYILAAVSCIINDKNEVILDANQIQSN
cccccccEEEEcccccccCEEEEEEccEEEEEEEEcccccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHccccccccEEEEEEEECccccEEEcccccccc
MDSLRELKSQLNILSRSDGSVIFSQGQTVVVASMYGPVEAKIQKTIIDKASVEVIFRPKSGLSFVQDRLKESVIKSTCESALLTMLHPRTSVILTIQELQDQGSLLSCCINAACLALINSGISMRYILAAVSCIINDKNEVILDAN*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSLRELKSQLNILSRSDGSVIFSQGQTVVVASMYGPVEAKIQKTIIDKASVEVIFRPKSGLSFVQDRLKESVIKSTCESALLTMLHPRTSVILTIQELQDQGSLLSCCINAACLALINSGISMRYILAAVSCIINDKNEVILDANQIQSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Exosome complex exonuclease RRP46 homolog Probable component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. May form a homodimer separately from exosome complexes and function in DNA cleavage process. Binds double-stranded DNA (dsDNA) and single-stranded RNA (ssRNA), and possesses hydrolytic DNase and phosphorolytic RNase activities in vitro.confidentQ84T68
Exosome complex component RRP46 Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes.confidentQ9CRA8
Exosome complex component RRP46 Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes.confidentQ9NQT4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032077 [BP]positive regulation of deoxyribonuclease activityprobableGO:0032069, GO:0051336, GO:0080090, GO:0051345, GO:0065009, GO:0060255, GO:0032070, GO:0050790, GO:0031323, GO:0032075, GO:0019219, GO:0065007, GO:0051171, GO:0044093, GO:0008150, GO:0019222, GO:0050794, GO:0050789, GO:0043085
GO:0004536 [MF]deoxyribonuclease activityprobableGO:0004518, GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0004532 [MF]exoribonuclease activityprobableGO:0016787, GO:0004518, GO:0004527, GO:0004540, GO:0016788, GO:0003824, GO:0003674
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003727 [MF]single-stranded RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0010467 [BP]gene expressionprobableGO:0071704, GO:0008150, GO:0008152, GO:0043170
GO:0006402 [BP]mRNA catabolic processprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0071038 [BP]nuclear polyadenylation-dependent tRNA catabolic processprobableGO:0071046, GO:0071029, GO:0071025, GO:0071027, GO:0090304, GO:0034641, GO:0006807, GO:0034661, GO:0034660, GO:0043632, GO:0043633, GO:0043634, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0016070, GO:0044248, GO:0044270, GO:0016078, GO:0044237, GO:0043170, GO:0006399, GO:0019439
GO:0045006 [BP]DNA deaminationprobableGO:0006139, GO:0006304, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0043412, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0000176 [CC]nuclear exosome (RNase complex)probableGO:0043234, GO:0005575, GO:0000178, GO:0032991, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000177 [CC]cytoplasmic exosome (RNase complex)probableGO:0005737, GO:0043234, GO:0000178, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NN6, chain D
Confidence level:very confident
Coverage over the Query: 3-151
View the alignment between query and template
View the model in PyMOL