Diaphorina citri psyllid: psy15072


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MSNEWQVCNVDENGKIHRLRRECTSEQCGAGVFMAAMSDRHYCGNKFSSLSVELKSARSQVRFPPGANFLTFVLGTASFLVSYPVLLFDSDFTFLIL
cccccEEEEEcccccEEEECccccccccccEEEEEEEccccccccccEEEEEEcHHHcccccccccccEEEEEEccEEEEEEEEEEEECccCEEEEc
***EWQVCNVDENGKIHRLRRECTSEQCGAGVFMAAMSDRHYCGNKFSSLSVELKSARSQVRFPPGANFLTFVLGTASFLVSYPVLLFDSDFTFLIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNEWQVCNVDENGKIHRLRRECTSEQCGAGVFMAAMSDRHYCGNKFSSLSVELKSARSQVRFPPGANFLTFVLGTASFLVSYPVLLFDSDFTFLIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-40S ribosomal protein S27a-3 Ribosomal protein RSP27a-3 is a component of the 40S subunit of the ribosome.confidentP59233
Ubiquitin-40S ribosomal protein S27a Ribosomal protein S27a is a component of the 40S subunit of the ribosome.confidentP14797
Ubiquitin-40S ribosomal protein S27a-2 Ribosomal protein RSP27a-2 is a component of the 40S subunit of the ribosome.confidentP59232

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022627 [CC]cytosolic small ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0015935, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0044424, GO:0032991, GO:0043228, GO:0030529, GO:0043226, GO:0044422, GO:0005840
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XZM, chain 9
Confidence level:very confident
Coverage over the Query: 3-53
View the alignment between query and template
View the model in PyMOL
Template: 1L1O, chain C
Confidence level:probable
Coverage over the Query: 5-50,64-90
View the alignment between query and template
View the model in PyMOL