Query         psy15097
Match_columns 106
No_of_seqs    137 out of 613
Neff          5.6 
Searched_HMMs 46136
Date          Fri Aug 16 20:31:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15097.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15097hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0469|consensus               99.9 2.8E-28   6E-33  205.1   7.3   77    1-78    184-261 (842)
  2 KOG0468|consensus               99.9 6.3E-23 1.4E-27  176.3   6.7   90    2-92    284-379 (971)
  3 KOG0467|consensus               99.7 6.8E-18 1.5E-22  146.4   4.0   95    2-97    159-268 (887)
  4 PLN00116 translation elongatio  99.6 3.5E-16 7.7E-21  136.9   6.7   76    2-78    185-261 (843)
  5 PTZ00416 elongation factor 2;   99.5 2.2E-14 4.8E-19  125.7   5.7   76    2-78    179-255 (836)
  6 cd01885 EF2 EF2 (for archaea a  99.3 6.2E-13 1.3E-17  100.9   2.1   45    2-46    160-210 (222)
  7 cd04167 Snu114p Snu114p subfam  98.6 3.1E-08 6.7E-13   73.1   3.1   43    3-46    159-201 (213)
  8 PRK07560 elongation factor EF-  96.6  0.0011 2.3E-08   58.0   1.6   43    2-44    174-218 (731)
  9 TIGR00490 aEF-2 translation el  95.8  0.0034 7.3E-08   54.9   0.8   41    3-43    174-216 (720)
 10 KOG0468|consensus               95.6  0.0062 1.4E-07   54.2   1.7   26   76-101   593-618 (971)
 11 PF14492 EFG_II:  Elongation Fa  93.4   0.021 4.6E-07   36.4  -0.0   30   73-102     9-38  (75)
 12 COG0480 FusA Translation elong  91.8    0.12 2.5E-06   45.8   2.3   30   74-103   411-440 (697)
 13 PRK12739 elongation factor G;   89.7    0.25 5.5E-06   43.1   2.4   27   76-102   412-438 (691)
 14 PLN00116 translation elongatio  89.5    0.25 5.5E-06   44.2   2.4   31   73-103   492-522 (843)
 15 PTZ00416 elongation factor 2;   87.4    0.32   7E-06   43.5   1.7   31   73-103   486-516 (836)
 16 PRK13351 elongation factor G;   86.9    0.57 1.2E-05   40.7   2.8   29   74-102   409-437 (687)
 17 TIGR00484 EF-G translation elo  86.2    0.56 1.2E-05   40.9   2.4   27   76-102   413-439 (689)
 18 PRK00007 elongation factor G;   86.2    0.58 1.3E-05   40.9   2.5   27   76-102   415-441 (693)
 19 KOG0467|consensus               86.1    0.18 3.9E-06   45.4  -0.6   27   76-102   478-504 (887)
 20 PRK07560 elongation factor EF-  83.9    0.64 1.4E-05   40.9   1.8   27   76-102   397-423 (731)
 21 PRK12740 elongation factor G;   83.7    0.87 1.9E-05   39.3   2.5   27   76-102   394-420 (668)
 22 TIGR00490 aEF-2 translation el  81.7    0.83 1.8E-05   40.2   1.6   28   75-102   396-423 (720)
 23 PF11411 DNA_ligase_IV:  DNA li  60.9     3.6 7.7E-05   23.4   0.5   22   63-94     14-35  (36)
 24 TIGR00503 prfC peptide chain r  59.2     7.3 0.00016   33.3   2.2   27   75-102   400-426 (527)
 25 PF07443 HARP:  HepA-related pr  55.6     3.8 8.3E-05   25.2  -0.0   25   67-92     23-47  (55)
 26 PRK05433 GTP-binding protein L  47.3      15 0.00033   31.8   2.4   27   76-102   304-330 (600)
 27 KOG2795|consensus               47.0      33 0.00072   28.6   4.1   91   14-106   155-256 (372)
 28 KOG0465|consensus               46.1      17 0.00036   32.6   2.4   29   75-103   442-470 (721)
 29 PRK10757 inositol monophosphat  45.8     8.7 0.00019   29.4   0.6   25   15-39     80-104 (267)
 30 PRK00741 prfC peptide chain re  45.7      17 0.00037   31.1   2.4   26   76-102   400-425 (526)
 31 TIGR01393 lepA GTP-binding pro  45.7      14  0.0003   32.1   1.8   27   76-102   300-326 (595)
 32 cd01642 Arch_FBPase_2 Putative  44.6       9 0.00019   29.2   0.5   25   15-39     76-100 (244)
 33 PLN02553 inositol-phosphate ph  44.4       9  0.0002   29.2   0.5   25   15-39     87-111 (270)
 34 PRK07080 hypothetical protein;  42.3      48   0.001   27.1   4.3   47   14-64    267-317 (317)
 35 cd01636 FIG FIG, FBPase/IMPase  42.1      12 0.00027   26.6   0.9   26   15-40     80-105 (184)
 36 COG1570 XseA Exonuclease VII,   40.8      52  0.0011   28.1   4.5   52   54-105   110-169 (440)
 37 cd00383 trans_reg_C Effector d  40.7      66  0.0014   19.8   4.1   50   15-66      5-57  (95)
 38 PRK10931 adenosine-3'(2'),5'-b  40.1      10 0.00022   28.6   0.2   24   16-39     80-103 (246)
 39 PF00165 HTH_AraC:  Bacterial r  40.0      35 0.00076   18.6   2.4   24   34-58     18-41  (42)
 40 PF14056 DUF4250:  Domain of un  39.9      38 0.00082   20.8   2.7   24   51-74     31-55  (55)
 41 cd01643 Bacterial_IMPase_like_  39.1      12 0.00026   28.3   0.4   25   15-39     73-97  (242)
 42 cd01639 IMPase IMPase, inosito  38.8      13 0.00028   27.8   0.5   25   15-39     77-101 (244)
 43 COG0483 SuhB Archaeal fructose  38.7      11 0.00025   29.0   0.3   25   15-39     81-105 (260)
 44 TIGR01331 bisphos_cysQ 3'(2'),  38.3      12 0.00026   28.3   0.3   25   15-39     78-102 (249)
 45 cd01517 PAP_phosphatase PAP-ph  36.9      16 0.00035   27.9   0.9   24   15-39     74-97  (274)
 46 COG1312 UxuA D-mannonate dehyd  36.3      46 0.00099   27.7   3.4   31   30-61    158-190 (362)
 47 PRK12676 bifunctional inositol  35.8      17 0.00037   27.7   0.8   25   15-39     83-107 (263)
 48 TIGR02067 his_9_proposed histi  35.2      16 0.00035   27.6   0.6   25   15-39     76-100 (251)
 49 cd01515 Arch_FBPase_1 Archaeal  33.4      18  0.0004   27.5   0.6   25   15-39     78-102 (257)
 50 cd01641 Bacterial_IMPase_like_  32.9      20 0.00043   27.0   0.7   25   15-39     74-98  (248)
 51 PF05240 APOBEC_C:  APOBEC-like  31.8      48   0.001   20.3   2.2   21   83-103     2-22  (55)
 52 PLN02911 inositol-phosphate ph  31.0      20 0.00043   28.1   0.5   25   15-39    111-135 (296)
 53 TIGR02753 sodN superoxide dism  30.2      34 0.00074   25.0   1.6    9   58-66     83-91  (145)
 54 cd01637 IMPase_like Inositol-m  30.0      20 0.00044   26.5   0.4   25   15-39     76-100 (238)
 55 cd07013 S14_ClpP Caseinolytic   29.8      48   0.001   23.7   2.3   31   39-70    121-151 (162)
 56 PF00459 Inositol_P:  Inositol   29.5      10 0.00023   28.6  -1.3   25   15-39     86-110 (270)
 57 cd01638 CysQ CysQ, a 3'-Phosph  29.1      19  0.0004   27.0   0.0   25   15-39     76-100 (242)
 58 TIGR02378 nirD_assim_sml nitri  29.0      29 0.00062   22.6   0.9   17   23-39     61-77  (105)
 59 PRK09511 nirD nitrite reductas  29.0      26 0.00057   23.4   0.8   17   24-40     65-81  (108)
 60 PF13413 HTH_25:  Helix-turn-he  27.2      72  0.0016   19.4   2.5   19   38-57     44-62  (62)
 61 KOG3806|consensus               25.7 1.3E+02  0.0028   22.7   4.0   50   19-70     81-135 (177)
 62 PF11874 DUF3394:  Domain of un  24.9      10 0.00023   28.5  -2.0   19   22-40     11-29  (183)
 63 PLN02737 inositol monophosphat  24.7      25 0.00055   28.7   0.1   25   15-39    153-177 (363)
 64 cd03528 Rieske_RO_ferredoxin R  24.4      33 0.00071   21.8   0.5   14   26-39     57-70  (98)
 65 PF13806 Rieske_2:  Rieske-like  24.1      66  0.0014   21.5   2.0   23   17-39     55-77  (104)
 66 PRK09685 DNA-binding transcrip  24.1      67  0.0014   24.3   2.3   26   34-60    274-300 (302)
 67 PF15595 Imm31:  Immunity prote  23.9      57  0.0012   22.3   1.7   54   30-91     34-89  (107)
 68 cd03530 Rieske_NirD_small_Baci  23.2      34 0.00073   21.9   0.4   14   26-39     58-71  (98)
 69 PF08971 GlgS:  Glycogen synthe  23.1      46   0.001   21.3   1.0   28   33-61     10-37  (66)
 70 PF08027 Albumin_I:  Albumin I;  23.1      28  0.0006   24.7   0.0   18   31-48     95-112 (120)
 71 cd05491 Bromo_TBP7_like Bromod  22.8      39 0.00084   23.9   0.7   21   51-71     64-84  (119)
 72 PF05174 CDRN:  Cysteine-rich D  22.7      75  0.0016   19.2   1.8   17   33-49      2-18  (52)
 73 PF12368 DUF3650:  Protein of u  22.1      96  0.0021   16.6   2.0   18   43-61      8-25  (28)
 74 cd03529 Rieske_NirD Assimilato  20.9      42  0.0009   21.8   0.5   14   26-39     63-76  (103)
 75 cd03474 Rieske_T4moC Toluene-4  20.7      41  0.0009   21.9   0.5   19   21-40     54-72  (108)
 76 cd03478 Rieske_AIFL_N AIFL (ap  20.5      43 0.00093   21.3   0.5   14   26-39     56-69  (95)
 77 cd03548 Rieske_RO_Alpha_OMO_CA  20.4      42 0.00092   23.2   0.5   14   26-39     73-86  (136)
 78 KOG0066|consensus               20.3 2.2E+02  0.0048   25.3   4.9   52   51-103   678-729 (807)
 79 PF15650 Tox-REase-9:  Restrict  20.3      93   0.002   21.0   2.1   30   66-95     41-70  (89)
 80 PRK10219 DNA-binding transcrip  20.2      97  0.0021   19.9   2.2   24   37-61     84-107 (107)

No 1  
>KOG0469|consensus
Probab=99.95  E-value=2.8e-28  Score=205.11  Aligned_cols=77  Identities=30%  Similarity=0.472  Sum_probs=73.2

Q ss_pred             CccccccccccC-CCceeeecCCCceEeeecccceeeeHHHHHHHHHhhCCCCCHHHHHHhhhccceecCCCcccccCC
Q psy15097          1 MLASQFDLYSGE-EDYKYLSPILGNVCFASTQYAMCFTLHSFASLYAQTSPTLNTQEFARRLWGDMYFNSKTKIVEPVN   78 (106)
Q Consensus         1 ~~n~ii~~~~~~-~~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~Y~~k~~~~~~~~l~k~LWGd~Y~~~ktkk~~p~~   78 (106)
                      +||++|+||.++ .++..+.|++|+|.|||++|||+|||++||++|++|| +++..+|+++||||.|||++|++|....
T Consensus       184 ~vNviisTy~d~~~g~~~v~P~kg~v~F~SGLhGWaFTlrQFa~~Y~~KF-~~~~~kmm~~LWg~~~f~~ktkk~~~s~  261 (842)
T KOG0469|consen  184 NVNVIISTYGDGPMGDVQVDPEKGTVGFGSGLHGWAFTLRQFAEMYAKKF-GIDVRKMMNRLWGDNFFNPKTKKWSKSA  261 (842)
T ss_pred             cccEEEEecccCCcCceEecCCCCceeeccccchhhhhHHHHHHHHHHHh-CCcHHHHHHHhhcccccCccCCcccccc
Confidence            589999999986 4789999999999999999999999999999999999 9999999999999999999999999764


No 2  
>KOG0468|consensus
Probab=99.88  E-value=6.3e-23  Score=176.28  Aligned_cols=90  Identities=43%  Similarity=0.820  Sum_probs=79.3

Q ss_pred             ccccccccccCCCceeeecCCCceEeeecccceeeeHHHHHHHHHhhCCCCCHHHHHHhhhccceecCCCcccccCCCC-
Q psy15097          2 LASQFDLYSGEEDYKYLSPILGNVCFASTQYAMCFTLHSFASLYAQTSPTLNTQEFARRLWGDMYFNSKTKIVEPVNPS-   80 (106)
Q Consensus         2 ~n~ii~~~~~~~~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~Y~~k~~~~~~~~l~k~LWGd~Y~~~ktkk~~p~~p~-   80 (106)
                      +|.+|++|+.+ ....+||..|||||||+..||||||.+||++|++.+.+++.++|++|||||.||+++|++|.++.|+ 
T Consensus       284 iN~~is~~s~~-~~~~~sP~~gNvcFaS~~~g~cFtl~sFak~Y~~~~~~~~~d~Fa~RLWGdvYf~~ktrkF~kk~~~~  362 (971)
T KOG0468|consen  284 INNLISTFSKD-DNPVVSPILGNVCFASGKLGFCFTLKSFAKLYADAHGHIDVDDFAKRLWGDVYFHSKTRKFVKKPPDG  362 (971)
T ss_pred             hcchhhhcccc-cccccccccCceeeeccccceeeehHHHHHHHHHhcCCcchhhhhhhhhccccccccccccccCCCCC
Confidence            68889999887 5688999999999999999999999999999999996799999999999999999999999988764 


Q ss_pred             CCch-----HHHHHHHH
Q psy15097         81 ELPK-----MLDGLRKV   92 (106)
Q Consensus        81 dlpk-----l~e~L~~l   92 (106)
                      ..+.     ++|.|++|
T Consensus       363 ~~~rsFVeFILePlYKi  379 (971)
T KOG0468|consen  363 SGSRSFVEFILEPLYKI  379 (971)
T ss_pred             cccchhhhhhHhHHHHH
Confidence            3333     56677765


No 3  
>KOG0467|consensus
Probab=99.70  E-value=6.8e-18  Score=146.37  Aligned_cols=95  Identities=25%  Similarity=0.388  Sum_probs=79.7

Q ss_pred             ccccccccccC------------CCceeeecCCCceEeeecccceeeeHHHHHHHHHhhCCCCCHHHHHHhhhccceecC
Q psy15097          2 LASQFDLYSGE------------EDYKYLSPILGNVCFASTQYAMCFTLHSFASLYAQTSPTLNTQEFARRLWGDMYFNS   69 (106)
Q Consensus         2 ~n~ii~~~~~~------------~~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~Y~~k~~~~~~~~l~k~LWGd~Y~~~   69 (106)
                      ||++|++|-.+            ++..+|+|++|||+||||++||+|.+++||++|++|+ +.+.+.+.+.||||+|+++
T Consensus       159 vn~~i~~~~~~~v~l~~~~~~i~d~~~~F~p~kgNVif~~A~~~~~f~~~~fak~~~~kl-~~k~~al~k~lwgd~y~~~  237 (887)
T KOG0467|consen  159 VNGVIGQFLGGIVELDDNWENIEDEEITFGPEDGNVIFASALDGWGFGIEQFAKFYAKKL-GLKDAALLKFLWGDRYIDP  237 (887)
T ss_pred             hhhHHHHhhcchhhccchhhhhhhcceeecCCCCcEEEEEecccccccHHHHHHHHHHhc-Chhhhhhhhhhccceeecc
Confidence            78888877311            2478999999999999999999999999999999999 8999999999999999999


Q ss_pred             CCcccc-cCCCCCCchHHH--HHHHHHhhCC
Q psy15097         70 KTKIVE-PVNPSELPKMLD--GLRKVNKSYP   97 (106)
Q Consensus        70 ktkk~~-p~~p~dlpkl~e--~L~~l~~~~~   97 (106)
                      +||++. +.+++-.++|+.  .|.-||+.|-
T Consensus       238 ktk~I~~~~~~~grkplf~~~vle~lw~iy~  268 (887)
T KOG0467|consen  238 KTKRICEGKKLKGRKPLFVQFVLENLWRIYE  268 (887)
T ss_pred             hhhhhhcccCcccCCCccceeehhhHHHHHH
Confidence            999888 445555566665  6667776654


No 4  
>PLN00116 translation elongation factor EF-2 subunit; Provisional
Probab=99.63  E-value=3.5e-16  Score=136.91  Aligned_cols=76  Identities=26%  Similarity=0.437  Sum_probs=68.1

Q ss_pred             ccccccccccCC-CceeeecCCCceEeeecccceeeeHHHHHHHHHhhCCCCCHHHHHHhhhccceecCCCcccccCC
Q psy15097          2 LASQFDLYSGEE-DYKYLSPILGNVCFASTQYAMCFTLHSFASLYAQTSPTLNTQEFARRLWGDMYFNSKTKIVEPVN   78 (106)
Q Consensus         2 ~n~ii~~~~~~~-~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~Y~~k~~~~~~~~l~k~LWGd~Y~~~ktkk~~p~~   78 (106)
                      +|++|+.|.++. +...|+|.+|||+|||+++||+|++++||.+|.+++ +++.+.|.++||||+||++++++++..+
T Consensus       185 in~~~~~~~~~~~~~~~~~P~~~nv~F~s~~~~~~~~l~~~~~~y~~~~-~~~~~~l~~~lwg~~~~~~~~~~~~~~~  261 (843)
T PLN00116        185 ANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKF-GVDESKMMERLWGENFFDPATKKWTTKN  261 (843)
T ss_pred             HHHHHHhccccccCceEEccCCCeeeeeecccCEEEEhHHHHHHHHHHh-CCcHHHHHHHhhccceEcCCCceEEecC
Confidence            577788887542 467899999999999999999999999999999999 7899999999999999999999887655


No 5  
>PTZ00416 elongation factor 2; Provisional
Probab=99.50  E-value=2.2e-14  Score=125.70  Aligned_cols=76  Identities=30%  Similarity=0.469  Sum_probs=64.5

Q ss_pred             ccccccccccCC-CceeeecCCCceEeeecccceeeeHHHHHHHHHhhCCCCCHHHHHHhhhccceecCCCcccccCC
Q psy15097          2 LASQFDLYSGEE-DYKYLSPILGNVCFASTQYAMCFTLHSFASLYAQTSPTLNTQEFARRLWGDMYFNSKTKIVEPVN   78 (106)
Q Consensus         2 ~n~ii~~~~~~~-~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~Y~~k~~~~~~~~l~k~LWGd~Y~~~ktkk~~p~~   78 (106)
                      ||..+..+..+. +.+.|+|..|||.|+|+.+|||||+++|+.+|++++ +++...+.+++|||+||+++++++...+
T Consensus       179 in~~l~~~~~~~~~~~~~~p~~~~vp~~s~~~~~~f~~~~F~~~y~~~~-~~~~~~l~~~~wg~~~~~~~~~~~~~~~  255 (836)
T PTZ00416        179 VNVIIATYNDELMGDVQVYPEKGTVAFGSGLQGWAFTLTTFARIYAKKF-GVEESKMMERLWGDNFFDAKTKKWIKDE  255 (836)
T ss_pred             HHHHHHhcccccccceecceeccEEEEEeccccceeehHHhhhhhhhhc-CCcHHHHHHHHhccccccCCCCEEEecc
Confidence            455555555432 246799999999999999999999999999999999 8999999999999999999998877543


No 6  
>cd01885 EF2 EF2 (for archaea and eukarya).  Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome.  The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins.  Two major mechanisms are known to regulate protein elongation and both involve eEF2.  First, eEF2 can be modulated by reversible phosphorylation.  Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes.  Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2.  In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation.  Seco
Probab=99.31  E-value=6.2e-13  Score=100.87  Aligned_cols=45  Identities=36%  Similarity=0.587  Sum_probs=38.6

Q ss_pred             ccccccccccC------CCceeeecCCCceEeeecccceeeeHHHHHHHHH
Q psy15097          2 LASQFDLYSGE------EDYKYLSPILGNVCFASTQYAMCFTLHSFASLYA   46 (106)
Q Consensus         2 ~n~ii~~~~~~------~~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~Y~   46 (106)
                      +|++|.++.++      ++.+.|||++|||+||||++||||||++||++|.
T Consensus       160 ~n~~i~~~~~~~~~~~~~~~~~~~p~~gnv~f~S~~~gw~f~~~~f~~~~~  210 (222)
T cd01885         160 VNAIIGTYADEEFKEKDDEKWYFSPQKGNVAFGSALHGWGFTIIKFARIYA  210 (222)
T ss_pred             HhHHHHhcccccccccCcCCcEEeeCCCcEEEEecccCEEeccccccchHH
Confidence            67788887543      2457899999999999999999999999999994


No 7  
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=98.59  E-value=3.1e-08  Score=73.15  Aligned_cols=43  Identities=42%  Similarity=0.703  Sum_probs=34.4

Q ss_pred             cccccccccCCCceeeecCCCceEeeecccceeeeHHHHHHHHH
Q psy15097          3 ASQFDLYSGEEDYKYLSPILGNVCFASTQYAMCFTLHSFASLYA   46 (106)
Q Consensus         3 n~ii~~~~~~~~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~Y~   46 (106)
                      |.++..+.-+ ....|.|.+|||+|+|+++||+||+++||++|.
T Consensus       159 n~~~~~~~~~-~~~~~~p~~~nv~~~s~~~~w~~~~~~~~~~~~  201 (213)
T cd04167         159 NNIIASFSTT-LSFLFSPENGNVCFASSKFGFCFTLESFAKKYG  201 (213)
T ss_pred             HHHHHHhcCC-CceEeccCCCeEEEEecCCCeEEecHHHHhhhh
Confidence            4444444332 237899999999999999999999999999993


No 8  
>PRK07560 elongation factor EF-2; Reviewed
Probab=96.56  E-value=0.0011  Score=58.04  Aligned_cols=43  Identities=16%  Similarity=0.166  Sum_probs=33.3

Q ss_pred             ccccccccccCC--CceeeecCCCceEeeecccceeeeHHHHHHH
Q psy15097          2 LASQFDLYSGEE--DYKYLSPILGNVCFASTQYAMCFTLHSFASL   44 (106)
Q Consensus         2 ~n~ii~~~~~~~--~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~   44 (106)
                      +|.+|..|.+++  +.+.++|.+|||+|+|+++||+|+++.+.+.
T Consensus       174 ~~~~l~~~~~~~~~~~~~~~~~~~~v~~~sa~~~~~~~~~~~~~~  218 (731)
T PRK07560        174 VNKLIKGMAPEEFKEKWKVDVEDGTVAFGSALYNWAISVPMMQKT  218 (731)
T ss_pred             HHHHHHHhhhhhhhcceeecCCCCcEeeeecccccceeHHHHHHh
Confidence            355666665442  3567899999999999999999998877653


No 9  
>TIGR00490 aEF-2 translation elongation factor aEF-2. This model represents archaeal elongation factor 2, a protein more similar to eukaryotic EF-2 than to bacterial EF-G, both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD.
Probab=95.79  E-value=0.0034  Score=54.89  Aligned_cols=41  Identities=22%  Similarity=0.236  Sum_probs=31.0

Q ss_pred             cccccccccCC--CceeeecCCCceEeeecccceeeeHHHHHH
Q psy15097          3 ASQFDLYSGEE--DYKYLSPILGNVCFASTQYAMCFTLHSFAS   43 (106)
Q Consensus         3 n~ii~~~~~~~--~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~   43 (106)
                      |.++..+.+++  +.+.++|..|||+|+|++++|+|++++|.+
T Consensus       174 ~~~~~~~~~~~~~~~~~~~~~~~~~~f~s~~~~~~~~~~~~~~  216 (720)
T TIGR00490       174 NKLIKAMAPEEFRDKWKVRVEDGSVAFGSAYYNWAISVPSMKK  216 (720)
T ss_pred             HhhhhccCCHHHhhceEechhhCCHHHHhhhhcccccchhHhh
Confidence            44444443332  346789999999999999999999998844


No 10 
>KOG0468|consensus
Probab=95.58  E-value=0.0062  Score=54.18  Aligned_cols=26  Identities=81%  Similarity=1.338  Sum_probs=23.9

Q ss_pred             cCCCCCCchHHHHHHHHHhhCCceeE
Q psy15097         76 PVNPSELPKMLDGLRKVNKSYPLLTL  101 (106)
Q Consensus        76 p~~p~dlpkl~e~L~~l~~~~~~~~~  101 (106)
                      |.+|+|+|||+|||++++|+||.+.+
T Consensus       593 P~nPsELPKmldgLrKinKsYPl~~t  618 (971)
T KOG0468|consen  593 PLNPSELPKMLDGLRKINKSYPLVIT  618 (971)
T ss_pred             cCChhhhhHHHHHHHhhcccCCcEEE
Confidence            67999999999999999999999754


No 11 
>PF14492 EFG_II:  Elongation Factor G, domain II; PDB: 1WDT_A 2DY1_A 2XEX_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y 2XUY_Y 3J0E_H ....
Probab=93.44  E-value=0.021  Score=36.43  Aligned_cols=30  Identities=30%  Similarity=0.535  Sum_probs=26.0

Q ss_pred             ccccCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         73 IVEPVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        73 k~~p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      .+.|.++.|.++|.++|.+|+..||++++-
T Consensus         9 ~i~p~~~~d~~kl~~aL~~l~~eDP~l~~~   38 (75)
T PF14492_consen    9 AIEPKNKEDEPKLSEALQKLSEEDPSLRVE   38 (75)
T ss_dssp             EEEESSHHHHHHHHHHHHHHHHH-TTSEEE
T ss_pred             EEEECCHhHHHHHHHHHHHHHhcCCeEEEE
Confidence            467889999999999999999999998864


No 12 
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]
Probab=91.80  E-value=0.12  Score=45.79  Aligned_cols=30  Identities=23%  Similarity=0.405  Sum_probs=26.6

Q ss_pred             cccCCCCCCchHHHHHHHHHhhCCceeEEe
Q psy15097         74 VEPVNPSELPKMLDGLRKVNKSYPLLTLLQ  103 (106)
Q Consensus        74 ~~p~~p~dlpkl~e~L~~l~~~~~~~~~~~  103 (106)
                      +.|++++|++||.|+|++|++.||++++..
T Consensus       411 vepk~~~d~~Kl~~aL~~l~~eDPt~~v~~  440 (697)
T COG0480         411 VEPKTKADQEKLSEALNKLAEEDPTFRVET  440 (697)
T ss_pred             EeECChhhHHHHHHHHHHHHhhCCceEEEE
Confidence            346789999999999999999999998864


No 13 
>PRK12739 elongation factor G; Reviewed
Probab=89.65  E-value=0.25  Score=43.06  Aligned_cols=27  Identities=22%  Similarity=0.283  Sum_probs=25.1

Q ss_pred             cCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         76 PVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        76 p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      |.++.|.++|.++|++|++.||+++|.
T Consensus       412 p~~~~d~~kL~~aL~~L~~eDpsl~v~  438 (691)
T PRK12739        412 PKTKADQDKMGLALQKLAEEDPTFRVE  438 (691)
T ss_pred             ECCcccHHHHHHHHHHHHHhCCeEEEE
Confidence            568899999999999999999999985


No 14 
>PLN00116 translation elongation factor EF-2 subunit; Provisional
Probab=89.50  E-value=0.25  Score=44.16  Aligned_cols=31  Identities=35%  Similarity=0.626  Sum_probs=27.1

Q ss_pred             ccccCCCCCCchHHHHHHHHHhhCCceeEEe
Q psy15097         73 IVEPVNPSELPKMLDGLRKVNKSYPLLTLLQ  103 (106)
Q Consensus        73 k~~p~~p~dlpkl~e~L~~l~~~~~~~~~~~  103 (106)
                      .+.|.+++|.++|.+||++|++.||++++.+
T Consensus       492 aIeP~~~~d~~kL~~aL~~L~~eDPsl~v~~  522 (843)
T PLN00116        492 AVQCKNASDLPKLVEGLKRLAKSDPMVQCTI  522 (843)
T ss_pred             EEEECChhhHHHHHHHHHHHHHhCCCeEEEE
Confidence            3447789999999999999999999999753


No 15 
>PTZ00416 elongation factor 2; Provisional
Probab=87.43  E-value=0.32  Score=43.51  Aligned_cols=31  Identities=45%  Similarity=0.850  Sum_probs=27.1

Q ss_pred             ccccCCCCCCchHHHHHHHHHhhCCceeEEe
Q psy15097         73 IVEPVNPSELPKMLDGLRKVNKSYPLLTLLQ  103 (106)
Q Consensus        73 k~~p~~p~dlpkl~e~L~~l~~~~~~~~~~~  103 (106)
                      .+.|.+++|.++|.++|++|++.||++++.+
T Consensus       486 aIep~~~~d~~kL~~aL~~L~~eDPsl~~~~  516 (836)
T PTZ00416        486 AVEPKNPKDLPKLVEGLKRLAKSDPLVVCTT  516 (836)
T ss_pred             EEEECCHHHHHHHHHHHHHHHhhCCceEEEE
Confidence            3447889999999999999999999998754


No 16 
>PRK13351 elongation factor G; Reviewed
Probab=86.90  E-value=0.57  Score=40.69  Aligned_cols=29  Identities=28%  Similarity=0.342  Sum_probs=26.0

Q ss_pred             cccCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         74 VEPVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        74 ~~p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      +.|.+++|.++|.++|++|++.||++++.
T Consensus       409 Iep~~~~d~~kL~~aL~~L~~eDpsl~v~  437 (687)
T PRK13351        409 VEPERRGDEQKLAEALEKLVWEDPSLRVE  437 (687)
T ss_pred             EEECCcccHHHHHHHHHHHHHhCCeEEEE
Confidence            34678999999999999999999999986


No 17 
>TIGR00484 EF-G translation elongation factor EF-G. After peptide bond formation, this elongation factor of bacteria and organelles catalyzes the translocation of the tRNA-mRNA complex, with its attached nascent polypeptide chain, from the A-site to the P-site of the ribosome. Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. E. coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis PCC6803 has a few proteins more closely related to EF-G than to any other characterized protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G.
Probab=86.20  E-value=0.56  Score=40.89  Aligned_cols=27  Identities=22%  Similarity=0.278  Sum_probs=24.8

Q ss_pred             cCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         76 PVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        76 p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      |.++.|.++|.++|++|++.||+++|.
T Consensus       413 p~~~~d~~kL~~aL~~L~~eDpsl~v~  439 (689)
T TIGR00484       413 PKTKADQEKMGIALGKLAEEDPTFRTF  439 (689)
T ss_pred             ECCcccHHHHHHHHHHHHHhCCEEEEE
Confidence            568899999999999999999999984


No 18 
>PRK00007 elongation factor G; Reviewed
Probab=86.15  E-value=0.58  Score=40.92  Aligned_cols=27  Identities=22%  Similarity=0.287  Sum_probs=24.9

Q ss_pred             cCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         76 PVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        76 p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      |.++.|.++|.++|++|++.||+++|.
T Consensus       415 p~~~~d~~kL~~aL~~L~~eDpsl~v~  441 (693)
T PRK00007        415 PKTKADQEKMGIALQKLAEEDPSFRVS  441 (693)
T ss_pred             ECCcccHHHHHHHHHHHHHhCCeEEEE
Confidence            567899999999999999999999985


No 19 
>KOG0467|consensus
Probab=86.10  E-value=0.18  Score=45.43  Aligned_cols=27  Identities=30%  Similarity=0.739  Sum_probs=24.8

Q ss_pred             cCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         76 PVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        76 p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      |.+|+|+++++++||.+++.||||+++
T Consensus       478 p~~p~em~~L~~glkll~~adp~v~i~  504 (887)
T KOG0467|consen  478 PDDPDEMDKLVEGLKLLNQADPFVKIR  504 (887)
T ss_pred             cCChHHhHHHHHHHHhhcccchhhHHH
Confidence            568999999999999999999999874


No 20 
>PRK07560 elongation factor EF-2; Reviewed
Probab=83.86  E-value=0.64  Score=40.89  Aligned_cols=27  Identities=37%  Similarity=0.678  Sum_probs=24.5

Q ss_pred             cCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         76 PVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        76 p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      |.+++|.++|.++|.+|++.||+++|.
T Consensus       397 p~~~~d~~kL~~aL~~L~~eDPsl~v~  423 (731)
T PRK07560        397 AKNPKDLPKLIEVLRQLAKEDPTLVVK  423 (731)
T ss_pred             ECCHHHHHHHHHHHHHHHhhCCcEEEE
Confidence            457889999999999999999999885


No 21 
>PRK12740 elongation factor G; Reviewed
Probab=83.73  E-value=0.87  Score=39.30  Aligned_cols=27  Identities=22%  Similarity=0.369  Sum_probs=24.7

Q ss_pred             cCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         76 PVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        76 p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      |.+++|.++|.++|++|++.||+++|.
T Consensus       394 p~~~~d~~~L~~aL~~l~~~Dpsl~v~  420 (668)
T PRK12740        394 PKDKGDEEKLSEALGKLAEEDPTLRVE  420 (668)
T ss_pred             ECCcchHHHHHHHHHHHHHhCCeEEEE
Confidence            457889999999999999999999985


No 22 
>TIGR00490 aEF-2 translation elongation factor aEF-2. This model represents archaeal elongation factor 2, a protein more similar to eukaryotic EF-2 than to bacterial EF-G, both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD.
Probab=81.66  E-value=0.83  Score=40.15  Aligned_cols=28  Identities=36%  Similarity=0.589  Sum_probs=25.3

Q ss_pred             ccCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         75 EPVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        75 ~p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      .|.+++|.++|.++|.+|++.||++++.
T Consensus       396 ~p~~~~d~~kL~~aL~~L~~eDPsl~v~  423 (720)
T TIGR00490       396 EAKNTKDLPKLIEVLRQVAKEDPTVHVE  423 (720)
T ss_pred             EECCHHHHHHHHHHHHHHHhhCCeEEEE
Confidence            3568899999999999999999999885


No 23 
>PF11411 DNA_ligase_IV:  DNA ligase IV;  InterPro: IPR021536  DNA ligase IV along with Xrcc4 functions in DNA non-homologous end joining. This process is required to mend double-strand breaks. Upon ligase binding to an Xrcc4 dimer, the helical tails unwind leading to a flat interaction surface []. ; GO: 0003910 DNA ligase (ATP) activity; PDB: 3II6_Y 2E2W_A 1IK9_C.
Probab=60.93  E-value=3.6  Score=23.41  Aligned_cols=22  Identities=18%  Similarity=0.366  Sum_probs=10.9

Q ss_pred             ccceecCCCcccccCCCCCCchHHHHHHHHHh
Q psy15097         63 GDMYFNSKTKIVEPVNPSELPKMLDGLRKVNK   94 (106)
Q Consensus        63 Gd~Y~~~ktkk~~p~~p~dlpkl~e~L~~l~~   94 (106)
                      ||.|+...+          ...|+|.+.+|.+
T Consensus        14 GDSY~~Dtd----------~~~Lk~vF~~i~~   35 (36)
T PF11411_consen   14 GDSYTVDTD----------EDQLKEVFNRIKK   35 (36)
T ss_dssp             S-BSSS-------------HHHHHHHHHCS--
T ss_pred             cccccccCC----------HHHHHHHHHHhcc
Confidence            677764332          4667777777654


No 24 
>TIGR00503 prfC peptide chain release factor 3. This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. More recently, RF-3 was shown to be active primarily at UGA stop codons in E. coli. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis PCC6803, and in Staphylococcus aureus.
Probab=59.17  E-value=7.3  Score=33.32  Aligned_cols=27  Identities=15%  Similarity=0.347  Sum_probs=23.6

Q ss_pred             ccCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         75 EPVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        75 ~p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      .|++++|.++|.+||.||+.-|| ++++
T Consensus       400 ~~~~~~d~~kl~~aL~~L~eED~-l~v~  426 (527)
T TIGR00503       400 RLKDPLKQKQLLKGLVQLSEEGA-VQVF  426 (527)
T ss_pred             EECChhhHHHHHHHHHHHHhhCC-eEEE
Confidence            35688999999999999999998 7775


No 25 
>PF07443 HARP:  HepA-related protein (HARP);  InterPro: IPR010003 This entry represents a conserved region approximately 60 residues long within eukaryotic HepA-related protein (HARP). This exhibits single-stranded DNA-dependent ATPase activity, and is ubiquitously expressed in human and mouse tissues []. Family members may contain more than one copy of this region.; GO: 0004386 helicase activity, 0005524 ATP binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0016568 chromatin modification, 0005634 nucleus
Probab=55.62  E-value=3.8  Score=25.24  Aligned_cols=25  Identities=12%  Similarity=0.381  Sum_probs=19.9

Q ss_pred             ecCCCcccccCCCCCCchHHHHHHHH
Q psy15097         67 FNSKTKIVEPVNPSELPKMLDGLRKV   92 (106)
Q Consensus        67 ~~~ktkk~~p~~p~dlpkl~e~L~~l   92 (106)
                      ||++||+|. -..+|-.+|++.++.|
T Consensus        23 YD~~Tr~W~-F~L~Dy~~L~~~~~~l   47 (55)
T PF07443_consen   23 YDPKTRKWN-FSLEDYSTLMKKVRNL   47 (55)
T ss_pred             cCccceeee-eeHHHHHHHHHHHhcC
Confidence            699999886 5667888888888777


No 26 
>PRK05433 GTP-binding protein LepA; Provisional
Probab=47.28  E-value=15  Score=31.84  Aligned_cols=27  Identities=26%  Similarity=0.379  Sum_probs=23.9

Q ss_pred             cCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         76 PVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        76 p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      |.+.+|-++|.++|.+|+.-||++++.
T Consensus       304 p~~~~d~~kL~~aL~kL~~eD~sl~~~  330 (600)
T PRK05433        304 PVDSDDYEDLRDALEKLQLNDASLTYE  330 (600)
T ss_pred             ECCccCHHHHHHHHHHHHHhCCeEEEE
Confidence            457888999999999999999998874


No 27 
>KOG2795|consensus
Probab=46.96  E-value=33  Score=28.64  Aligned_cols=91  Identities=15%  Similarity=0.156  Sum_probs=64.0

Q ss_pred             CceeeecCCCceEeeecccceeeeHHHHHHHHHhhCCC------CCHHHHHHhhhccceecCCCcccc---cCCCCCCch
Q psy15097         14 DYKYLSPILGNVCFASTQYAMCFTLHSFASLYAQTSPT------LNTQEFARRLWGDMYFNSKTKIVE---PVNPSELPK   84 (106)
Q Consensus        14 ~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~Y~~k~~~------~~~~~l~k~LWGd~Y~~~ktkk~~---p~~p~dlpk   84 (106)
                      +.+.|.-++|.|+=|++..|=++.|..+......-...      +..+..-++|=.|++++.-.+.+.   +.-|+=.+.
T Consensus       155 G~l~~~~~ng~~id~~~~~~~~~~lp~d~~~i~~i~tdA~~IlIVEKeavFqrL~~d~~~~~~~~~ilITgKGyPD~~TR  234 (372)
T KOG2795|consen  155 GRLRFLEENGDVIDCTESGGGPKALPPDIDDISNITTDAKFILIVEKEAVFQRLAEDNFFNTFNRCILITGKGYPDIATR  234 (372)
T ss_pred             eeEEEEEcCCcEEEeccCCCCCccCCCCHHHHhhhhccceEEEEEehHHHHHHHHHHHHHhhcCCeEEEecCCCCcHHHH
Confidence            45777788999999998888888887766666552211      346777788889999876654333   222444443


Q ss_pred             HHHHHHHHHhhC--CceeEEeecC
Q psy15097         85 MLDGLRKVNKSY--PLLTLLQWNP  106 (106)
Q Consensus        85 l~e~L~~l~~~~--~~~~~~~~~~  106 (106)
                      +  .|++|+...  |+.-++||+|
T Consensus       235 ~--fLkkL~~~~~lpv~~LvDaDP  256 (372)
T KOG2795|consen  235 L--FLKKLEEKLKLPVYGLVDADP  256 (372)
T ss_pred             H--HHHHHHHHhCCCEEEEeecCC
Confidence            3  577777777  9999999998


No 28 
>KOG0465|consensus
Probab=46.14  E-value=17  Score=32.62  Aligned_cols=29  Identities=21%  Similarity=0.369  Sum_probs=25.6

Q ss_pred             ccCCCCCCchHHHHHHHHHhhCCceeEEe
Q psy15097         75 EPVNPSELPKMLDGLRKVNKSYPLLTLLQ  103 (106)
Q Consensus        75 ~p~~p~dlpkl~e~L~~l~~~~~~~~~~~  103 (106)
                      +|.+.+|.++|.+||.++.+-||+.++.+
T Consensus       442 kP~~k~d~~~fskaL~rf~~EDPtFrv~~  470 (721)
T KOG0465|consen  442 KPVNKKDADNFSKALNRFTKEDPTFRVSL  470 (721)
T ss_pred             cccccccHHHHHHHHHhhcccCCceEEEe
Confidence            35678899999999999999999998865


No 29 
>PRK10757 inositol monophosphatase; Provisional
Probab=45.80  E-value=8.7  Score=29.41  Aligned_cols=25  Identities=12%  Similarity=0.202  Sum_probs=23.0

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+.-|..++..||.+|-
T Consensus        80 ~WiIDPIDGT~nf~~g~p~~~vsia  104 (267)
T PRK10757         80 QWVIDPLDGTTNFIKRLPHFAVSIA  104 (267)
T ss_pred             EEEEeCccCchHHHhCCCcEEEEEE
Confidence            4889999999999999999999884


No 30 
>PRK00741 prfC peptide chain release factor 3; Provisional
Probab=45.70  E-value=17  Score=31.10  Aligned_cols=26  Identities=15%  Similarity=0.304  Sum_probs=22.6

Q ss_pred             cCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         76 PVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        76 p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      |++++|-++|.+||.||+.-|+ ++++
T Consensus       400 p~~~~d~~kl~~aL~~L~eED~-l~~~  425 (526)
T PRK00741        400 LKNPLKQKQLQKGLVQLSEEGA-VQVF  425 (526)
T ss_pred             ECCchhHHHHHHHHHHHhhcCC-eEEE
Confidence            4578899999999999999996 6765


No 31 
>TIGR01393 lepA GTP-binding protein LepA. LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function is unknown.
Probab=45.67  E-value=14  Score=32.12  Aligned_cols=27  Identities=22%  Similarity=0.369  Sum_probs=23.9

Q ss_pred             cCCCCCCchHHHHHHHHHhhCCceeEE
Q psy15097         76 PVNPSELPKMLDGLRKVNKSYPLLTLL  102 (106)
Q Consensus        76 p~~p~dlpkl~e~L~~l~~~~~~~~~~  102 (106)
                      |.+.+|-++|.++|.+|..-||++++.
T Consensus       300 p~~~~d~~kL~~aL~kL~~eD~sl~~~  326 (595)
T TIGR01393       300 PIDTEDYEDLRDALEKLKLNDASLTYE  326 (595)
T ss_pred             ECCcccHHHHHHHHHHHhccCCeEEEE
Confidence            457789999999999999999998874


No 32 
>cd01642 Arch_FBPase_2 Putative fructose-1,6-bisphosphatase or related enzymes of inositol monophosphatase family. These are Mg++ dependent phosphatases. Members in this family may have fructose-1,6-bisphosphatase and/or inositol-monophosphatase activity. Fructose-1,6-bisphosphatase catalyzes the hydrolysis of fructose-1,6-biphosphate  into fructose-6-phosphate and is critical in gluconeogenesis pathway.
Probab=44.59  E-value=9  Score=29.24  Aligned_cols=25  Identities=16%  Similarity=0.196  Sum_probs=23.0

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+.=|..++..||.+|-
T Consensus        76 ~WiIDPIDGT~NFi~g~P~favsIa  100 (244)
T cd01642          76 IAVLDPLDGSTNYLSGIPFYSVSVA  100 (244)
T ss_pred             EEEEeCCcCcHHHHcCCCCeEEEEE
Confidence            4899999999999999999999883


No 33 
>PLN02553 inositol-phosphate phosphatase
Probab=44.36  E-value=9  Score=29.25  Aligned_cols=25  Identities=16%  Similarity=0.292  Sum_probs=23.1

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+.-|..++..||.+|-
T Consensus        87 ~WiIDPIDGT~NF~~g~p~~avsIa  111 (270)
T PLN02553         87 TWIVDPLDGTTNFVHGFPFVCVSIG  111 (270)
T ss_pred             EEEEecccchhhHhhcCCceEEEEE
Confidence            4899999999999999999999884


No 34 
>PRK07080 hypothetical protein; Validated
Probab=42.31  E-value=48  Score=27.11  Aligned_cols=47  Identities=19%  Similarity=0.226  Sum_probs=36.5

Q ss_pred             CceeeecCCCceEeeecccceeeeHHHHHHHHHhhCCCCC----HHHHHHhhhcc
Q psy15097         14 DYKYLSPILGNVCFASTQYAMCFTLHSFASLYAQTSPTLN----TQEFARRLWGD   64 (106)
Q Consensus        14 ~~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~Y~~k~~~~~----~~~l~k~LWGd   64 (106)
                      +.+-|.-+.|.|+.+++   -+|-|+-.|--....+ |++    ++.+.++|||+
T Consensus       267 ~~f~I~~~~g~~ahTgC---vGFGlER~a~All~~h-G~d~~~WP~~Vr~~l~~~  317 (317)
T PRK07080        267 LTWGIRTADGAVAHTGC---VGFGLERLALALFRHH-GLDPAAWPAAVRDVLWGT  317 (317)
T ss_pred             cccCcccCCCCEeEEee---eecCHHHHHHHHHHHh-CCChhhccHHHHHHhcCC
Confidence            34566778899988875   4789998888777777 766    56899999985


No 35 
>cd01636 FIG FIG, FBPase/IMPase/glpX-like domain. A superfamily of metal-dependent phosphatases with various substrates. Fructose-1,6-bisphospatase (both the major and the glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate to fructose-6-phosphate in gluconeogenesis. Inositol-monophosphatases and inositol polyphosphatases play vital roles in eukaryotic signalling, as they participate in metabolizing the messenger molecule Inositol-1,4,5-triphosphate. Many of these enzymes are inhibited by Li+.
Probab=42.10  E-value=12  Score=26.62  Aligned_cols=26  Identities=15%  Similarity=0.133  Sum_probs=23.5

Q ss_pred             ceeeecCCCceEeeecccceeeeHHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLHS   40 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~s   40 (106)
                      .|.++|..|+--|..++..||-++--
T Consensus        80 ~WiiDPiDGT~nf~~g~p~~~vsial  105 (184)
T cd01636          80 TWVIDPIDGTKNFINGLPFVAVVIAV  105 (184)
T ss_pred             EEEEecccChHHHHhCCCCEEEeHHH
Confidence            48899999999999999999988853


No 36 
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair]
Probab=40.77  E-value=52  Score=28.06  Aligned_cols=52  Identities=13%  Similarity=0.295  Sum_probs=45.3

Q ss_pred             HHHHHHhhhccceecCCCcccccC--------CCCCCchHHHHHHHHHhhCCceeEEeec
Q psy15097         54 TQEFARRLWGDMYFNSKTKIVEPV--------NPSELPKMLDGLRKVNKSYPLLTLLQWN  105 (106)
Q Consensus        54 ~~~l~k~LWGd~Y~~~ktkk~~p~--------~p~dlpkl~e~L~~l~~~~~~~~~~~~~  105 (106)
                      -|+|.++|=.+=+||++-|+-.|.        ++..+--+++-+..|++.+|.++|.-|+
T Consensus       110 ~E~lK~kL~aEGlFd~~~KkpLP~~p~~IGVITS~tgAairDIl~~~~rR~P~~~viv~p  169 (440)
T COG1570         110 FEQLKAKLAAEGLFDPERKKPLPFFPKKIGVITSPTGAALRDILHTLSRRFPSVEVIVYP  169 (440)
T ss_pred             HHHHHHHHHhCCCcChhhcCCCCCCCCeEEEEcCCchHHHHHHHHHHHhhCCCCeEEEEe
Confidence            478999999999999999988875        4556777999999999999999998775


No 37 
>cd00383 trans_reg_C Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and a response regulator. The former autophosphorylates in a histidine residue on detecting an external stimulus. The phosphate is then transferred to an invariant aspartate residue in a highly conserved receiver domain of the response regulator. Phosphorylation activates a variable effector domain of the response regulator, which triggers the cellular response. The C-terminal effector domain contains DNA and RNA polymerase binding sites. Several dimers or monomers bind head to tail to small tandem repeats upstream of the genes. The RNA polymerase binding sites interact with the alpha or sigma subunite of RNA polymerase.
Probab=40.70  E-value=66  Score=19.84  Aligned_cols=50  Identities=24%  Similarity=0.372  Sum_probs=31.7

Q ss_pred             ceeeecCCCceEeeecccceeeeHHHHHHH--HHhhC-CCCCHHHHHHhhhccce
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLHSFASL--YAQTS-PTLNTQEFARRLWGDMY   66 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~sFA~~--Y~~k~-~~~~~~~l~k~LWGd~Y   66 (106)
                      .+.++|....|.+..  .-..+|-..++=+  .+..- .-++.++|.+.+||+..
T Consensus         5 ~~~~d~~~~~l~~~~--~~v~Lt~~e~~lL~~L~~~~~~~vs~~~l~~~lw~~~~   57 (95)
T cd00383           5 DLVLDPARREVTRDG--EPVELTPKEFELLELLARNPGRVLSREQLLEAVWGDDY   57 (95)
T ss_pred             CEEEehhhCEEEECC--EEEEeCHHHHHHHHHHHhCCCCcCCHHHHHHHhcCCCC
Confidence            577888877776543  4455666555432  22222 12789999999999754


No 38 
>PRK10931 adenosine-3'(2'),5'-bisphosphate nucleotidase; Provisional
Probab=40.12  E-value=10  Score=28.61  Aligned_cols=24  Identities=13%  Similarity=0.198  Sum_probs=22.5

Q ss_pred             eeeecCCCceEeeecccceeeeHH
Q psy15097         16 KYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        16 ~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      |.++|..|+.-|..++..||.+|-
T Consensus        80 WiIDPIDGT~nF~~g~p~~~vsIa  103 (246)
T PRK10931         80 WLVDPLDGTKEFIKRNGEFTVNIA  103 (246)
T ss_pred             EEEecCcChHHHHcCCCCEEEEEE
Confidence            889999999999999999999884


No 39 
>PF00165 HTH_AraC:  Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A.
Probab=40.00  E-value=35  Score=18.61  Aligned_cols=24  Identities=13%  Similarity=0.430  Sum_probs=17.5

Q ss_pred             eeeeHHHHHHHHHhhCCCCCHHHHH
Q psy15097         34 MCFTLHSFASLYAQTSPTLNTQEFA   58 (106)
Q Consensus        34 w~Ftl~sFA~~Y~~k~~~~~~~~l~   58 (106)
                      ++|+...|.+.+.+.+ |+.+.+..
T Consensus        18 ~g~S~~~f~r~Fk~~~-g~tp~~y~   41 (42)
T PF00165_consen   18 AGFSPSYFSRLFKKET-GMTPKQYR   41 (42)
T ss_dssp             HTS-HHHHHHHHHHHT-SS-HHHHH
T ss_pred             HCCCHHHHHHHHHHHH-CcCHHHHh
Confidence            4568889999999988 88887654


No 40 
>PF14056 DUF4250:  Domain of unknown function (DUF4250)
Probab=39.90  E-value=38  Score=20.77  Aligned_cols=24  Identities=8%  Similarity=0.296  Sum_probs=20.2

Q ss_pred             CCCHHHHHHhhhc-cceecCCCccc
Q psy15097         51 TLNTQEFARRLWG-DMYFNSKTKIV   74 (106)
Q Consensus        51 ~~~~~~l~k~LWG-d~Y~~~ktkk~   74 (106)
                      +++.++|.++|=. ++.|+++++.|
T Consensus        31 ~id~~~l~~kL~~~Gy~Y~~~~NQF   55 (55)
T PF14056_consen   31 DIDKEELEEKLASIGYEYDEEQNQF   55 (55)
T ss_pred             CCCHHHHHHHHHHcCCeEchhhCCC
Confidence            6899999999976 78899988764


No 41 
>cd01643 Bacterial_IMPase_like_2 Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases. These enzymes may dephosphorylate inositol monophosphate or similar substrates.
Probab=39.06  E-value=12  Score=28.25  Aligned_cols=25  Identities=24%  Similarity=0.344  Sum_probs=22.8

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+.-|..++..||.++-
T Consensus        73 ~WiIDPIDGT~nF~~g~p~~~vsia   97 (242)
T cd01643          73 YWVIDPIDGTTNFARGIPIWAISIA   97 (242)
T ss_pred             EEEEeCccChHHHhcCCCceEEEEE
Confidence            4889999999999999999998873


No 42 
>cd01639 IMPase IMPase, inositol monophosphatase and related domains. A family of Mg++ dependent phosphatases, inhibited by lithium, many of which may act on inositol monophosphate substrate. They dephosphorylate inositol phosphate to generate inositol, which may be recycled into inositol lipids; in eukaryotes IMPase plays a vital role in intracellular signaling. IMPase is one of the proposed targets of Li+ therapy in manic-depressive illness. This family contains some bacterial members of the inositol monophosphatase family classified as SuhB-like. E. coli SuhB has been suggested to participate in posstranscriptional control of gene expression, and its inositol monophosphatase activity doesn't appear to be sufficient for its cellular function. It has been proposed, that SuhB plays a role in the biosynthesis of phosphatidylinositol in mycobacteria.
Probab=38.79  E-value=13  Score=27.83  Aligned_cols=25  Identities=12%  Similarity=0.187  Sum_probs=22.9

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+--|..++..||.+|-
T Consensus        77 ~WvIDPIDGT~nf~~g~p~~~vsia  101 (244)
T cd01639          77 TWIIDPLDGTTNFVHGFPHFAVSIA  101 (244)
T ss_pred             EEEEecccChhHHhcCCCcEEEEEE
Confidence            4889999999999999999998883


No 43 
>COG0483 SuhB Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism]
Probab=38.72  E-value=11  Score=28.97  Aligned_cols=25  Identities=16%  Similarity=0.198  Sum_probs=23.1

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .+.++|..|+.-|.+++.-||.++-
T Consensus        81 ~wVIDPIDGT~NFv~G~P~favSIa  105 (260)
T COG0483          81 VWVIDPIDGTTNFVRGIPFFAVSIA  105 (260)
T ss_pred             EEEEcCCCCcHHHHcCCCcceEEEE
Confidence            5889999999999999999998884


No 44 
>TIGR01331 bisphos_cysQ 3'(2'),5'-bisphosphate nucleotidase, bacterial. Sulfate is incorporated into 3-phosphoadenylylsulfate, PAPS, for utilization in pathways such as methionine biosynthesis. Transfer of sulfate from PAPS to an acceptor leaves adenosine 3'-5'-bisphosphate, APS. This model describes a form found in bacteria of the enzyme 3'(2'),5'-bisphosphate nucleotidase, which removes the 3'-phosphate from APS to regenerate AMP and help drive the cycle.
Probab=38.34  E-value=12  Score=28.27  Aligned_cols=25  Identities=12%  Similarity=0.264  Sum_probs=22.9

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+.-|..++..||.+|-
T Consensus        78 ~WvIDPIDGT~nF~~G~p~~~vsIa  102 (249)
T TIGR01331        78 FWLVDPLDGTKEFINRNGDFTVNIA  102 (249)
T ss_pred             EEEEcCCcChHHHhcCCCcEEEEEE
Confidence            4889999999999999999998883


No 45 
>cd01517 PAP_phosphatase PAP-phosphatase_like domains. PAP-phosphatase is a member of the inositol monophosphatase family, and catalyses the hydrolysis of 3'-phosphoadenosine-5'-phosphate (PAP) to AMP. In Saccharomyces cerevisiae, HAL2 (MET22) is involved in methionine biosynthesis and provides increased salt tolerance when over-expressed. Bacterial members of this domain family may differ in their substrate specificity and dephosphorylate different targets, as the substrate binding site does not appear to be conserved in that sub-set.
Probab=36.95  E-value=16  Score=27.94  Aligned_cols=24  Identities=25%  Similarity=0.379  Sum_probs=21.7

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+.-|..++ .||.+|-
T Consensus        74 ~WiIDPIDGT~nfv~g~-~~~vsIa   97 (274)
T cd01517          74 FWVLDPIDGTKGFLRGD-QFAVALA   97 (274)
T ss_pred             EEEEcCCcCchhhhcCC-ceEEEEE
Confidence            48899999999999999 9998873


No 46 
>COG1312 UxuA D-mannonate dehydratase [Carbohydrate transport and metabolism]
Probab=36.35  E-value=46  Score=27.71  Aligned_cols=31  Identities=16%  Similarity=0.219  Sum_probs=25.8

Q ss_pred             ccccee--eeHHHHHHHHHhhCCCCCHHHHHHhh
Q psy15097         30 TQYAMC--FTLHSFASLYAQTSPTLNTQEFARRL   61 (106)
Q Consensus        30 al~gw~--Ftl~sFA~~Y~~k~~~~~~~~l~k~L   61 (106)
                      |+-||.  +||.+|.++...-- +|+.++|.++|
T Consensus       158 glPG~~~~~tl~~~~~~~~~y~-~Id~~~L~~nL  190 (362)
T COG1312         158 GLPGWEEGYTLDQFRELLELYG-GIDEEKLWENL  190 (362)
T ss_pred             CCCCCcccccHHHHHHHHHHhc-CCCHHHHHHHH
Confidence            799976  99999999987643 79998877776


No 47 
>PRK12676 bifunctional inositol-1 monophosphatase/fructose-1,6-bisphosphatase; Reviewed
Probab=35.76  E-value=17  Score=27.73  Aligned_cols=25  Identities=12%  Similarity=0.064  Sum_probs=22.9

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      -|.++|..|+.-|..++..||-+|-
T Consensus        83 ~WvIDPiDGT~nfv~g~p~~~vsia  107 (263)
T PRK12676         83 TVVLDPLDGTYNAINGIPFYAISIA  107 (263)
T ss_pred             EEEEeccCCchHHhcCCCceEEEEE
Confidence            4889999999999999999998875


No 48 
>TIGR02067 his_9_proposed histidinol-phosphate phosphatase HisN, inositol monophosphatase family. This subfamily belongs to the inositol monophosphatase family (pfam00459). The members of this family consist of no more than one per species and are found only in species in which histidine is synthesized de novo but no histidinol phosphatase can be found in either of the two described families (TIGR01261, TIGR01856). In at least one species, the member of this family is found near known histidine biosynthesis genes.
Probab=35.21  E-value=16  Score=27.57  Aligned_cols=25  Identities=20%  Similarity=0.106  Sum_probs=22.7

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+.-|..++..||.+|-
T Consensus        76 ~WiiDPIDGT~nF~~g~p~~~vsia  100 (251)
T TIGR02067        76 VWVLDPIDGTKSFIRGVPVWGTLIA  100 (251)
T ss_pred             EEEEecCcChhHHhcCCCceEEEEE
Confidence            4889999999999999999998874


No 49 
>cd01515 Arch_FBPase_1 Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family (FBPase class IV). These are Mg++ dependent phosphatases. Members in this family may have both fructose-1,6-bisphosphatase and inositol-monophosphatase activity. In hyperthermophilic archaea, inositol monophosphatase is thought to play a role in the biosynthesis of di-myo-inositol-1,1'-phosphate, an osmolyte unique to hyperthermophiles.
Probab=33.42  E-value=18  Score=27.46  Aligned_cols=25  Identities=12%  Similarity=0.033  Sum_probs=22.8

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+--|..++..||-++-
T Consensus        78 ~WvIDPIDGT~nfv~g~p~~~isia  102 (257)
T cd01515          78 TVVLDPLDGTYNAINGIPFYSVSVA  102 (257)
T ss_pred             EEEEeCcCChhHHhcCCCceEEEEE
Confidence            5889999999999999999998873


No 50 
>cd01641 Bacterial_IMPase_like_1 Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases. These enzymes may dephosphorylate fructose-1,6-bisphosphate, inositol monophospate, 3'-phosphoadenosine-5'-phosphate,  or similar substrates.
Probab=32.94  E-value=20  Score=27.02  Aligned_cols=25  Identities=20%  Similarity=0.105  Sum_probs=22.8

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      -|.++|..|+-=|.-++..||.+|-
T Consensus        74 ~WviDPIDGT~nf~~g~p~~~vsia   98 (248)
T cd01641          74 VWVLDPIDGTKSFIRGLPVWGTLIA   98 (248)
T ss_pred             EEEEecCcCchhHhcCCCceEEEEE
Confidence            4889999999999999999998884


No 51 
>PF05240 APOBEC_C:  APOBEC-like C-terminal domain;  InterPro: IPR007904  This domain is found at the C terminus of the Apolipoprotein B mRNA editing enzyme. Apobec-1 catalyzes C to U editing of apolipoprotein B (apoB) mRNA in the mammalian intestine. C to U RNA editing of mammalian apolipoprotein B (apoB) RNA is a site-specific posttranscriptional modification in which a single cytidine is enzymatically deaminated to uridine, thereby generating a UAA stop codon in the edited mRNA. The function of this domain is currently unknown.; GO: 0008270 zinc ion binding, 0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines; PDB: 2NYT_D.
Probab=31.82  E-value=48  Score=20.32  Aligned_cols=21  Identities=19%  Similarity=0.528  Sum_probs=15.4

Q ss_pred             chHHHHHHHHHhhCCceeEEe
Q psy15097         83 PKMLDGLRKVNKSYPLLTLLQ  103 (106)
Q Consensus        83 pkl~e~L~~l~~~~~~~~~~~  103 (106)
                      |.-.|||++|+++--.|.+|.
T Consensus         2 ~~~qegLr~L~~aG~~v~iM~   22 (55)
T PF05240_consen    2 PDYQEGLRRLCQAGAQVSIMT   22 (55)
T ss_dssp             HHHHHHHHHHHHTT-EEEE--
T ss_pred             cHHHHHHHHHHHCCCeEEecC
Confidence            345789999999999998886


No 52 
>PLN02911 inositol-phosphate phosphatase
Probab=30.95  E-value=20  Score=28.11  Aligned_cols=25  Identities=20%  Similarity=0.186  Sum_probs=23.0

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+.=|.-++..||.+|-
T Consensus       111 ~WiIDPIDGT~NFv~G~p~favsIa  135 (296)
T PLN02911        111 VWVLDPIDGTKSFITGKPLFGTLIA  135 (296)
T ss_pred             EEEEeCCcChHHHhcCCCceEEEEE
Confidence            4889999999999999999999884


No 53 
>TIGR02753 sodN superoxide dismutase, Ni. This superoxide dismutase uses nickel, rather than iron, manganese, copper, or zinc. Its gene is always accompanied by a gene for a required protease.
Probab=30.22  E-value=34  Score=24.99  Aligned_cols=9  Identities=33%  Similarity=0.877  Sum_probs=7.1

Q ss_pred             HHhhhccce
Q psy15097         58 ARRLWGDMY   66 (106)
Q Consensus        58 ~k~LWGd~Y   66 (106)
                      ..-|||||+
T Consensus        83 i~vlWtDYF   91 (145)
T TIGR02753        83 ISVLWTDYF   91 (145)
T ss_pred             HHHHHHHhc
Confidence            456899987


No 54 
>cd01637 IMPase_like Inositol-monophosphatase-like domains. This family of phosphatases is dependent on bivalent metal ions such as Mg++, and many members are inhibited by Li+ (which is thought to displace a bivalent ion in the active site). Substrates include fructose-1,6-bisphosphate, inositol poly- and monophosphates, PAP and PAPS, sedoheptulose-1,7-bisphosphate and probably others.
Probab=29.98  E-value=20  Score=26.46  Aligned_cols=25  Identities=16%  Similarity=0.246  Sum_probs=22.5

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .+.++|..|+--|..++..||.++-
T Consensus        76 ~wviDPIDGT~nf~~g~p~~~vsia  100 (238)
T cd01637          76 VWVIDPIDGTTNFVAGLPNFAVSIA  100 (238)
T ss_pred             EEEEcceeChhhhhcCCCCEEEEEE
Confidence            4899999999999999999998873


No 55 
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease. Clp protease (caseinolytic protease; ClpP; Peptidase S14) is a highly conserved serine protease present throughout in bacteria and eukaryota, but seems to be absent in archaea, mollicutes and some fungi. Clp proteases are involved in a number of cellular processes such as degradation of misfolded proteins, regulation of short-lived proteins and housekeeping removal of dysfunctional proteins. Additionally, they are implicated in the control of cell growth, targeting DNA-binding protein from starved cells. ClpP has also been linked to the tight regulation of virulence genes in the pathogens Listeria monocytogenes and Salmonella typhimurium. This enzyme belong to the family of ATP-dependent proteases; the functional Clp protease is comprised of two components: a proteolytic component and one of several regulatory ATPase components, both of which are required for effective levels of proteas
Probab=29.80  E-value=48  Score=23.68  Aligned_cols=31  Identities=19%  Similarity=0.355  Sum_probs=25.2

Q ss_pred             HHHHHHHHhhCCCCCHHHHHHhhhccceecCC
Q psy15097         39 HSFASLYAQTSPTLNTQEFARRLWGDMYFNSK   70 (106)
Q Consensus        39 ~sFA~~Y~~k~~~~~~~~l~k~LWGd~Y~~~k   70 (106)
                      ..|.+.|+++. |.+.+++.+.+=++.|++++
T Consensus       121 ~~~~~~~a~~t-g~~~~~i~~~~~~~~~~sa~  151 (162)
T cd07013         121 GNLVSAYAHKT-GQSEEELHADLERDTWLSAR  151 (162)
T ss_pred             HHHHHHHHHHh-CcCHHHHHHHHcCCccccHH
Confidence            67888999988 88999988888777777653


No 56 
>PF00459 Inositol_P:  Inositol monophosphatase family;  InterPro: IPR000760 It has been shown that several proteins share two sequence motifs []. Two of these proteins, vertebrate and plant inositol monophosphatase (3.1.3.25 from EC), and vertebrate inositol polyphosphate 1-phosphatase (3.1.3.57 from EC), are enzymes of the inositol phosphate second messenger signalling pathway, and share similar enzyme activity. Both enzymes exhibit an absolute requirement for metal ions (Mg2+ is preferred), and their amino acid sequences contain a number of conserved motifs, which are also shared by several other proteins related to MPTASE (including products of fungal QaX and qutG, bacterial suhB and cysQ, and yeast hal2) []. The function of the other proteins is not yet clear, but it is suggested that they may act by enhancing the synthesis or degradation of phosphorylated messenger molecules []. Structural analysis of these proteins has revealed a common core of 155 residues, which includes residues essential for metal binding and catalysis. An interesting property of the enzymes of this family is their sensitivity to Li+. The targets and mechanism of action of Li+ are unknown, but overactive inositol phosphate signalling may account for symptoms of manic depression [].; GO: 0004437 inositol or phosphatidylinositol phosphatase activity; PDB: 1IMF_A 1IMA_A 1IMB_A 1IMD_A 1IMC_A 1IME_A 1AWB_A 2HHM_B 2QFL_A 1INP_A ....
Probab=29.46  E-value=10  Score=28.63  Aligned_cols=25  Identities=16%  Similarity=0.207  Sum_probs=22.0

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .+.++|..|+--|..++..||.+|-
T Consensus        86 ~wviDPIDGT~nf~~g~p~~~i~ia  110 (270)
T PF00459_consen   86 TWVIDPIDGTRNFVRGLPEFAISIA  110 (270)
T ss_dssp             EEEEEEEETHHHHHHTSSG-EEEEE
T ss_pred             EEEecccccchhhhhhhhHHHHHHH
Confidence            5889999999999999999998884


No 57 
>cd01638 CysQ CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family. It has been proposed that CysQ helps control intracellular levels of PAPS, which is an intermediate in cysteine biosynthesis (a principal route of sulfur assimilation).
Probab=29.09  E-value=19  Score=26.99  Aligned_cols=25  Identities=12%  Similarity=0.255  Sum_probs=22.6

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      -|.++|..|+--|..++..||.++-
T Consensus        76 ~WviDPIDGT~Nfv~g~p~~~isia  100 (242)
T cd01638          76 FWLVDPLDGTREFIKGNGEFAVNIA  100 (242)
T ss_pred             EEEEecccChHHHhcCCCCeEEEEE
Confidence            3789999999999999999998875


No 58 
>TIGR02378 nirD_assim_sml nitrite reductase [NAD(P)H], small subunit. This model describes NirD, the small subunit of nitrite reductase [NAD(P)H] (the assimilatory nitrite reductase), which associates with NirB, the large subunit (TIGR02374). In a few bacteria such as Klebsiella pneumoniae and in Fungi, the two regions are fused.
Probab=29.03  E-value=29  Score=22.63  Aligned_cols=17  Identities=24%  Similarity=0.286  Sum_probs=13.5

Q ss_pred             CceEeeecccceeeeHH
Q psy15097         23 GNVCFASTQYAMCFTLH   39 (106)
Q Consensus        23 GNV~FaSal~gw~Ftl~   39 (106)
                      |+-...+..|||.|+++
T Consensus        61 ~~~~i~Cp~Hg~~Fdl~   77 (105)
T TIGR02378        61 GELWVACPLHKRNFRLE   77 (105)
T ss_pred             CcEEEECCcCCCEEEcC
Confidence            34457888999999986


No 59 
>PRK09511 nirD nitrite reductase small subunit; Provisional
Probab=28.97  E-value=26  Score=23.45  Aligned_cols=17  Identities=24%  Similarity=0.204  Sum_probs=13.6

Q ss_pred             ceEeeecccceeeeHHH
Q psy15097         24 NVCFASTQYAMCFTLHS   40 (106)
Q Consensus        24 NV~FaSal~gw~Ftl~s   40 (106)
                      ...-.+-+|||.|.|++
T Consensus        65 ~~~V~CP~H~~~Fdl~T   81 (108)
T PRK09511         65 ELWVASPLKKQRFRLSD   81 (108)
T ss_pred             eEEEECCCCCCEEECCC
Confidence            34578889999999973


No 60 
>PF13413 HTH_25:  Helix-turn-helix domain; PDB: 2WUS_R 3FYM_A.
Probab=27.21  E-value=72  Score=19.42  Aligned_cols=19  Identities=21%  Similarity=0.361  Sum_probs=13.4

Q ss_pred             HHHHHHHHHhhCCCCCHHHH
Q psy15097         38 LHSFASLYAQTSPTLNTQEF   57 (106)
Q Consensus        38 l~sFA~~Y~~k~~~~~~~~l   57 (106)
                      ++.|.+.|++.+ |++++.+
T Consensus        44 ~rg~lr~Ya~~L-gld~~~l   62 (62)
T PF13413_consen   44 ARGYLRKYARFL-GLDPDEL   62 (62)
T ss_dssp             HHHHHHHHHHHT-T--HHHH
T ss_pred             HHHHHHHHHHHh-CcCcccC
Confidence            578888999988 8887754


No 61 
>KOG3806|consensus
Probab=25.73  E-value=1.3e+02  Score=22.71  Aligned_cols=50  Identities=18%  Similarity=0.377  Sum_probs=38.2

Q ss_pred             ecCCCceEeeecccceeeeH---HHHHHHHHhhC--CCCCHHHHHHhhhccceecCC
Q psy15097         19 SPILGNVCFASTQYAMCFTL---HSFASLYAQTS--PTLNTQEFARRLWGDMYFNSK   70 (106)
Q Consensus        19 sP~~GNV~FaSal~gw~Ftl---~sFA~~Y~~k~--~~~~~~~l~k~LWGd~Y~~~k   70 (106)
                      ++..+.++-=.+.+||-|-|   +.-|+++-.+-  ++|+=++|.+.|  .+||+.-
T Consensus        81 d~~~~~~I~Wtg~~g~EFkl~dp~eVArlWG~rK~kp~MNYdKLSRaL--RyyY~kn  135 (177)
T KOG3806|consen   81 DESNAHIIAWTGKDGLEFKLVDPDEVARLWGARKNKPNMNYDKLSRAL--RYYYDKN  135 (177)
T ss_pred             CcccCCeeEEeCCCCceEEecCHHHHHHHHhhhhCCCCCCHHHHHHHH--HHHHhcC
Confidence            56777887777779999988   77888887753  468888999988  6777544


No 62 
>PF11874 DUF3394:  Domain of unknown function (DUF3394);  InterPro: IPR021814  This domain is functionally uncharacterised. This domain is found in bacteria. This presumed domain is about 190 amino acids in length. This domain is found associated with PF06808 from PFAM. 
Probab=24.86  E-value=10  Score=28.53  Aligned_cols=19  Identities=16%  Similarity=0.267  Sum_probs=15.2

Q ss_pred             CCceEeeecccceeeeHHH
Q psy15097         22 LGNVCFASTQYAMCFTLHS   40 (106)
Q Consensus        22 ~GNV~FaSal~gw~Ftl~s   40 (106)
                      -|-++|+||.+||.+|=..
T Consensus        11 ~~~l~F~aatqg~f~~r~~   29 (183)
T PF11874_consen   11 IAMLAFAAATQGWFLTRNK   29 (183)
T ss_pred             HHHHHHHHHhcceeeecch
Confidence            4567899999999988643


No 63 
>PLN02737 inositol monophosphatase family protein
Probab=24.72  E-value=25  Score=28.75  Aligned_cols=25  Identities=16%  Similarity=0.262  Sum_probs=23.0

Q ss_pred             ceeeecCCCceEeeecccceeeeHH
Q psy15097         15 YKYLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        15 ~~~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .|.++|..|+.-|..++..||.+|-
T Consensus       153 ~WiIDPIDGT~NFv~G~P~faVsIA  177 (363)
T PLN02737        153 LWCIDPLDGTTNFAHGYPSFAVSVG  177 (363)
T ss_pred             EEEEecccCHHHHHhCCCCeEEEEE
Confidence            4889999999999999999999884


No 64 
>cd03528 Rieske_RO_ferredoxin Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO). The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The ferredoxin component contains either a plant-type or Rieske-type [2Fe-2S] cluster. The Rieske ferredoxin component in this family carries an electron from the RO reductase component to the terminal RO oxygenase component. BPDO degrades biphenyls and polychlorinated biphenyls. BPDO ferredoxin (BphF) has structural features consistent with a minimal and perhaps archetypical Rieske protein in that the in
Probab=24.35  E-value=33  Score=21.79  Aligned_cols=14  Identities=14%  Similarity=0.093  Sum_probs=12.1

Q ss_pred             EeeecccceeeeHH
Q psy15097         26 CFASTQYAMCFTLH   39 (106)
Q Consensus        26 ~FaSal~gw~Ftl~   39 (106)
                      .+.+..|||.|+++
T Consensus        57 ~i~Cp~Hg~~fd~~   70 (98)
T cd03528          57 VIECPLHGGRFDLR   70 (98)
T ss_pred             EEEeCCcCCEEECC
Confidence            57788999999984


No 65 
>PF13806 Rieske_2:  Rieske-like [2Fe-2S] domain; PDB: 2JO6_A 3C0D_A 3D89_A 2JZA_A.
Probab=24.11  E-value=66  Score=21.45  Aligned_cols=23  Identities=22%  Similarity=0.278  Sum_probs=19.4

Q ss_pred             eeecCCCceEeeecccceeeeHH
Q psy15097         17 YLSPILGNVCFASTQYAMCFTLH   39 (106)
Q Consensus        17 ~~sP~~GNV~FaSal~gw~Ftl~   39 (106)
                      .+....|+.+-+|-+|+|-|+|+
T Consensus        55 ~i~~~~g~~~V~CPlH~~~f~L~   77 (104)
T PF13806_consen   55 LIGDGNGEPCVACPLHKWRFDLR   77 (104)
T ss_dssp             EEEECTTEEEEEETTTTEEEETT
T ss_pred             EEccCCCCEEEECCCCCCeEECC
Confidence            34557888899999999999996


No 66 
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional
Probab=24.09  E-value=67  Score=24.29  Aligned_cols=26  Identities=19%  Similarity=0.392  Sum_probs=20.8

Q ss_pred             eee-eHHHHHHHHHhhCCCCCHHHHHHh
Q psy15097         34 MCF-TLHSFASLYAQTSPTLNTQEFARR   60 (106)
Q Consensus        34 w~F-tl~sFA~~Y~~k~~~~~~~~l~k~   60 (106)
                      |+| +...|++.|.+.+ |++|.+..++
T Consensus       274 ~GF~d~s~Fsr~Fkk~~-G~sP~~yR~~  300 (302)
T PRK09685        274 WGFSDSSHFSTAFKQRF-GVSPGEYRRK  300 (302)
T ss_pred             hCCCCHHHHHHHHHHHH-CcCHHHHHhh
Confidence            444 4789999999999 8999887653


No 67 
>PF15595 Imm31:  Immunity protein 31
Probab=23.89  E-value=57  Score=22.26  Aligned_cols=54  Identities=11%  Similarity=0.233  Sum_probs=36.3

Q ss_pred             cccceeeeHHHHHHHHHhhCCCCCHHHHHHhhhccceecCCCcccccC--CCCCCchHHHHHHH
Q psy15097         30 TQYAMCFTLHSFASLYAQTSPTLNTQEFARRLWGDMYFNSKTKIVEPV--NPSELPKMLDGLRK   91 (106)
Q Consensus        30 al~gw~Ftl~sFA~~Y~~k~~~~~~~~l~k~LWGd~Y~~~ktkk~~p~--~p~dlpkl~e~L~~   91 (106)
                      +..|=+++-.++|+.|.++. .       ..|+++.=|||+...|.--  +...++++.+.++.
T Consensus        34 g~egnGY~W~~l~~~~l~~~-~-------p~l~~~i~fDpEagmF~ays~~~eal~~l~~~i~~   89 (107)
T PF15595_consen   34 GFEGNGYDWEALARVYLREN-A-------PELLEKIDFDPEAGMFCAYSEDKEALKKLAEIIKE   89 (107)
T ss_pred             CCCCCCccHHHHHHHHHHHh-C-------hhHHHhcCcCCCCCEEEEecCCHHHHHHHHHHHHH
Confidence            35556778899999999876 1       3457888999999988743  33344444444443


No 68 
>cd03530 Rieske_NirD_small_Bacillus Small subunit of nitrite reductase (NirD) family, Rieske domain; composed of proteins similar to the Bacillus subtilis small subunit of assimilatory nitrite reductase containing a Rieske domain. The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium.
Probab=23.20  E-value=34  Score=21.89  Aligned_cols=14  Identities=7%  Similarity=0.019  Sum_probs=11.7

Q ss_pred             EeeecccceeeeHH
Q psy15097         26 CFASTQYAMCFTLH   39 (106)
Q Consensus        26 ~FaSal~gw~Ftl~   39 (106)
                      .+.+..|||.|+++
T Consensus        58 ~i~Cp~Hg~~Fdl~   71 (98)
T cd03530          58 YVTCPLHNWVIDLE   71 (98)
T ss_pred             EEECCCCCCEEECC
Confidence            45677999999996


No 69 
>PF08971 GlgS:  Glycogen synthesis protein;  InterPro: IPR015065 Members of this protein are involved in glycogen synthesis in Enterobacteria. The structure of the polypeptide chain comprises a bundle of two parallel amphipathic helices, alpha-1 and alpha-3, and a short hydrophobic helix alpha-2 sandwiched between them []. ; GO: 0005978 glycogen biosynthetic process; PDB: 1RRZ_A.
Probab=23.10  E-value=46  Score=21.27  Aligned_cols=28  Identities=21%  Similarity=0.316  Sum_probs=17.8

Q ss_pred             ceeeeHHHHHHHHHhhCCCCCHHHHHHhh
Q psy15097         33 AMCFTLHSFASLYAQTSPTLNTQEFARRL   61 (106)
Q Consensus        33 gw~Ftl~sFA~~Y~~k~~~~~~~~l~k~L   61 (106)
                      +..|--.|||+|.+++- .|+..++.-+|
T Consensus        10 nfDFlAsS~ArMe~qgr-~vd~~~I~gnM   37 (66)
T PF08971_consen   10 NFDFLASSFARMEAQGR-KVDVDAITGNM   37 (66)
T ss_dssp             HHHHHHHHHHHHHHHT-----HHHHHHH-
T ss_pred             cchHHHHHHHHHHHcCC-CCCHHHHhccC
Confidence            45577799999999987 67777665544


No 70 
>PF08027 Albumin_I:  Albumin I;  InterPro: IPR012512 The albumin I protein, a hormone-like peptide, stimulates kinase activity upon binding a membrane bound 43 kDa receptor. The structure of this region reveals a knottin like fold, comprise of three beta strands [].; GO: 0045735 nutrient reservoir activity, 0009405 pathogenesis; PDB: 1P8B_A 1JU8_A.
Probab=23.05  E-value=28  Score=24.73  Aligned_cols=18  Identities=33%  Similarity=0.613  Sum_probs=0.0

Q ss_pred             ccceeeeHHHHHHHHHhh
Q psy15097         31 QYAMCFTLHSFASLYAQT   48 (106)
Q Consensus        31 l~gw~Ftl~sFA~~Y~~k   48 (106)
                      .|||||+-.+=|+-+-.+
T Consensus        95 ~yGWCF~s~sea~~~F~~  112 (120)
T PF08027_consen   95 EYGWCFASNSEAEKYFKK  112 (120)
T ss_dssp             ------------------
T ss_pred             ceeeeeccccHHHHHHHH
Confidence            689999988877755544


No 71 
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi. TBP7, or TAT-binding protein homolog 7, is a yeast protein of unknown function that contains AAA-superfamily ATP-ase domains and a bromodomain. Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine.
Probab=22.78  E-value=39  Score=23.88  Aligned_cols=21  Identities=24%  Similarity=0.623  Sum_probs=17.5

Q ss_pred             CCCHHHHHHhhhccceecCCC
Q psy15097         51 TLNTQEFARRLWGDMYFNSKT   71 (106)
Q Consensus        51 ~~~~~~l~k~LWGd~Y~~~kt   71 (106)
                      +++-+.+.+|||.++|-.++.
T Consensus        64 ~MDL~tIe~RL~ng~Y~tp~~   84 (119)
T cd05491          64 NMDLDTIEERLWNGYYATPKD   84 (119)
T ss_pred             ccCHHHHHHHHhcCCCCCHHH
Confidence            689999999999988866554


No 72 
>PF05174 CDRN:  Cysteine-rich D. radiodurans N terminus;  InterPro: IPR007847 This domain is found individually and at the N terminus of a number of multi-domain proteins, including several found in the bacterium Deinococcus radiodurans which is capable of surviving ionizing irradiation and other DNA-damaging assaults at doses that are lethal to all other organisms.
Probab=22.69  E-value=75  Score=19.15  Aligned_cols=17  Identities=24%  Similarity=0.501  Sum_probs=14.3

Q ss_pred             ceeeeHHHHHHHHHhhC
Q psy15097         33 AMCFTLHSFASLYAQTS   49 (106)
Q Consensus        33 gw~Ftl~sFA~~Y~~k~   49 (106)
                      -|+|.|++|.++=..+-
T Consensus         2 ~~~~~leqfselrvrrn   18 (52)
T PF05174_consen    2 LFFFSLEQFSELRVRRN   18 (52)
T ss_pred             CccccHHHHHHHHHhhc
Confidence            47899999999988775


No 73 
>PF12368 DUF3650:  Protein of unknown function (DUF3650) ;  InterPro: IPR022111  This domain family is found in bacteria, and is approximately 30 amino acids in length. The family is found in association with PF00581 from PFAM. There is a single completely conserved residue N that may be functionally important. 
Probab=22.08  E-value=96  Score=16.60  Aligned_cols=18  Identities=33%  Similarity=0.527  Sum_probs=14.7

Q ss_pred             HHHHhhCCCCCHHHHHHhh
Q psy15097         43 SLYAQTSPTLNTQEFARRL   61 (106)
Q Consensus        43 ~~Y~~k~~~~~~~~l~k~L   61 (106)
                      ..|.+.. +++.++...+|
T Consensus         8 NrYV~eh-~ls~ee~~~RL   25 (28)
T PF12368_consen    8 NRYVKEH-GLSEEEVAERL   25 (28)
T ss_pred             hhhHHhc-CCCHHHHHHHH
Confidence            4688887 89999988887


No 74 
>cd03529 Rieske_NirD Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium. Members include bacterial and fungal proteins. The bacterial NirD contains a single Rieske domain while fungal proteins have a C-terminal Rieske domain in addition to several other domains. The fungal NirD is involved in nutrient acquisition, functioning at the soil/fungus interface to control nutrient exchange between the fungus and the host plant. The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. The Rieske [2Fe-2S] cluster is liganded to two histidine and two cysteine residues present in conserved sequences called Rieske motifs. In this family, only a few members contain these residues. Other members may have lost the ability to bind the Rieske [2Fe-2S] cluster.
Probab=20.85  E-value=42  Score=21.85  Aligned_cols=14  Identities=36%  Similarity=0.510  Sum_probs=11.8

Q ss_pred             EeeecccceeeeHH
Q psy15097         26 CFASTQYAMCFTLH   39 (106)
Q Consensus        26 ~FaSal~gw~Ftl~   39 (106)
                      ...+..|||.|+++
T Consensus        63 ~i~Cp~Hg~~Fdl~   76 (103)
T cd03529          63 VVASPLYKQHFSLK   76 (103)
T ss_pred             EEECCCCCCEEEcC
Confidence            56777999999985


No 75 
>cd03474 Rieske_T4moC Toluene-4-monooxygenase effector protein complex (T4mo), Rieske ferredoxin subunit; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. T4mo is a four-protein complex that catalyzes the NADH- and O2-dependent hydroxylation of toluene to form p-cresol. T4mo consists of an NADH oxidoreductase (T4moF), a diiron hydroxylase (T4moH), a catalytic effector protein (T4moD), and a Rieske ferredoxin (T4moC). T4moC contains a Rieske domain and functions as an obligate electron carrier between T4moF and T4moH. Rieske ferredoxins are found as subunits of membrane oxidase complexes, cis-dihydrodiol-forming aromatic dioxygenases, bacterial assimilatory nitrite reductases, and arsenite oxidase. Rieske ferredoxins are also found as soluble electron carriers in bacterial dioxygenase and monooxygenase complexes.
Probab=20.66  E-value=41  Score=21.91  Aligned_cols=19  Identities=16%  Similarity=0.188  Sum_probs=13.9

Q ss_pred             CCCceEeeecccceeeeHHH
Q psy15097         21 ILGNVCFASTQYAMCFTLHS   40 (106)
Q Consensus        21 ~~GNV~FaSal~gw~Ftl~s   40 (106)
                      ..|+. +.+..|||.|++++
T Consensus        54 ~~g~~-i~CP~Hg~~Fdl~~   72 (108)
T cd03474          54 FDGGV-LTCRAHLWQFDADT   72 (108)
T ss_pred             ccCCE-EEeCCcCCEEECCC
Confidence            34443 55779999999975


No 76 
>cd03478 Rieske_AIFL_N AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox). The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. AIFL shares 35% homology with human AIF (apoptosis-inducing factor), mainly in the Pyr_redox domain. AIFL is predominantly localized to the mitochondria. AIFL induces apoptosis in a caspase-dependent manner.
Probab=20.45  E-value=43  Score=21.29  Aligned_cols=14  Identities=21%  Similarity=0.403  Sum_probs=11.6

Q ss_pred             EeeecccceeeeHH
Q psy15097         26 CFASTQYAMCFTLH   39 (106)
Q Consensus        26 ~FaSal~gw~Ftl~   39 (106)
                      .+.+..|||.|+++
T Consensus        56 ~i~CP~Hg~~Fdl~   69 (95)
T cd03478          56 RIRCPWHGACFNLR   69 (95)
T ss_pred             EEEcCCCCCEEECC
Confidence            46678999999984


No 77 
>cd03548 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxygenase (RO) family, 2-Oxoquinoline 8-monooxygenase (OMO) and Carbazole 1,9a-dioxygenase (CARDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. OMO catalyzes the NADH-dependent oxidation of the N-heterocyclic aromatic compound 2-oxoquinoline to 8-hydroxy-2-oxoquinoline, the second step in the bacterial degradation of quinoline. OMO consists of a reductase component (OMR) and  an oxygenase component (OMO) that together function to shuttle electrons from the
Probab=20.37  E-value=42  Score=23.19  Aligned_cols=14  Identities=7%  Similarity=0.052  Sum_probs=12.3

Q ss_pred             EeeecccceeeeHH
Q psy15097         26 CFASTQYAMCFTLH   39 (106)
Q Consensus        26 ~FaSal~gw~Ftl~   39 (106)
                      .+.+..|||.|+++
T Consensus        73 ~i~Cp~Hgw~Fdl~   86 (136)
T cd03548          73 TITCWYHGWTYRLD   86 (136)
T ss_pred             EEEecCCccEEeCC
Confidence            68888999999984


No 78 
>KOG0066|consensus
Probab=20.32  E-value=2.2e+02  Score=25.35  Aligned_cols=52  Identities=21%  Similarity=0.190  Sum_probs=41.0

Q ss_pred             CCCHHHHHHhhhccceecCCCcccccCCCCCCchHHHHHHHHHhhCCceeEEe
Q psy15097         51 TLNTQEFARRLWGDMYFNSKTKIVEPVNPSELPKMLDGLRKVNKSYPLLTLLQ  103 (106)
Q Consensus        51 ~~~~~~l~k~LWGd~Y~~~ktkk~~p~~p~dlpkl~e~L~~l~~~~~~~~~~~  103 (106)
                      +++-++-.+.| |.+=.-+-...+..++.+-+++.+.+|-.|+-.-|.|.++|
T Consensus       678 Nlpyq~ARK~L-G~fGL~sHAHTikikdLSGGQKaRValaeLal~~PDvlILD  729 (807)
T KOG0066|consen  678 NLPYQEARKQL-GTFGLASHAHTIKIKDLSGGQKARVALAELALGGPDVLILD  729 (807)
T ss_pred             CCChHHHHHHh-hhhhhhhccceEeeeecCCcchHHHHHHHHhcCCCCEEEec
Confidence            55555544444 66666666777888899999999999999999999998886


No 79 
>PF15650 Tox-REase-9:  Restriction endonuclease fold toxin 9
Probab=20.32  E-value=93  Score=21.01  Aligned_cols=30  Identities=20%  Similarity=0.459  Sum_probs=23.3

Q ss_pred             eecCCCcccccCCCCCCchHHHHHHHHHhh
Q psy15097         66 YFNSKTKIVEPVNPSELPKMLDGLRKVNKS   95 (106)
Q Consensus        66 Y~~~ktkk~~p~~p~dlpkl~e~L~~l~~~   95 (106)
                      ++|++||.+.-..|..=.-+..|++||...
T Consensus        41 ~id~~~k~IyELKPnNPr~ik~G~kQl~~Y   70 (89)
T PF15650_consen   41 FIDFETKIIYELKPNNPRAIKRGLKQLENY   70 (89)
T ss_pred             cccCCcceEEEecCCCHHHHHHHHHHHHHH
Confidence            789999878766666666788899998753


No 80 
>PRK10219 DNA-binding transcriptional regulator SoxS; Provisional
Probab=20.16  E-value=97  Score=19.94  Aligned_cols=24  Identities=13%  Similarity=0.426  Sum_probs=19.5

Q ss_pred             eHHHHHHHHHhhCCCCCHHHHHHhh
Q psy15097         37 TLHSFASLYAQTSPTLNTQEFARRL   61 (106)
Q Consensus        37 tl~sFA~~Y~~k~~~~~~~~l~k~L   61 (106)
                      +...|.+.+.+.+ |+.|.++.+++
T Consensus        84 ~~s~f~~~Fk~~~-G~tP~~~r~~~  107 (107)
T PRK10219         84 SQQTFSRVFRRQF-DRTPSDYRHRL  107 (107)
T ss_pred             CHHHHHHHHHHHH-CcCHHHHHhcC
Confidence            4588999998888 89998887653


Done!