Diaphorina citri psyllid: psy15100


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MTTSASTGTTTMSSATSAKTPPVRRNRGRSPNTQTPSEDLVPESAFTYEQLVALENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNSPTVPTCPGGSHSGPAFPFHPALSGPGGHYSGTAHYPYAAAAAAYFHHLGAHHTHGGLTHT
cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHcccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccc
********************************************AFTYEQLVALENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKW************************************GGHYSGTAHYPYAAAAAAYFHHLGA**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTSASTGTTTMSSATSAKTPPVRRNRGRSPNTQTPSEDLVPESAFTYEQLVALENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNSPTVPTCPGGSHSGPAFPFHPALSGPGGHYSGTAHYPYAAAAAAYFHHLGAHHTHGGLTHT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein slou May play a role in specifying the identity of particular somatic muscles and neurons of the CNS.confidentP22807
Homeobox protein ceh-1 (Fragment) confidentP53547
Homeobox protein H40 (Fragment) confidentP15858

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042327 [BP]positive regulation of phosphorylationprobableGO:0042325, GO:0019220, GO:0009893, GO:0045937, GO:0010562, GO:0031323, GO:0050794, GO:0051174, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0031325, GO:0048522
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0000976 [MF]transcription regulatory region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0031490 [MF]chromatin DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003682, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0003002 [BP]regionalizationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0007423 [BP]sensory organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0045727 [BP]positive regulation of translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0030901 [BP]midbrain developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0000982 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0001708 [BP]cell fate specificationprobableGO:0032502, GO:0045165, GO:0048869, GO:0030154, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0016020 [CC]membraneprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A01, chain A
Confidence level:very confident
Coverage over the Query: 30-100
View the alignment between query and template
View the model in PyMOL