Diaphorina citri psyllid: psy1511


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MEMRKIKKVGIWPVGLVGGLKVEKPVVQDGKVIGFNSMWAPQRPYPIDMAGFAINLDLMKKNENVKFSFDVQKGYQESAILSKVLSSAQELEPLAENCTKVYVWHTRTTDPTFPYEVVLQKNKKPASDRGIEV
cccccEEEEcEEEccEEccCEEEccEECccEEEEEEcccccccccccccccEEEEEHHcccccccCEEccccccccHHHHHHHHHccccccccccccccEEEEEECccccccccHHHHHHHcccccccccccc
*EMRKIKKVGIWPVGLVGGLKVEKPVVQDGKVIGFNSMWAPQRPYPIDMAGFAINLDLMKKNENVKFSFDVQKGYQESAILSKVLSSAQELEPLAENCTKVYVWHTRTTDPTFPYEVVL**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMRKIKKVGIWPVGLVGGLKVEKPVVQDGKVIGFNSMWAPQRPYPIDMAGFAINLDLMKKNENVKFSFDVQKGYQESAILSKVLSSAQELEPLAENCTKVYVWHTRTTDPTFPYEVVLQKNKKPASDRGIEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable glucuronosyltransferase sqv-8 May be involved in the biosynthesis of the HNK-1 carbohydrate epitope on glycoproteins. Also involved in wild-type vulval invagination.confidentQ09363
Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase I Involved in the biosynthesis of L2/HNK-1 carbohydrate epitope on both glycolipids and glycoproteins. Shows strict specificity for Gal-beta-1,3-Gal-beta-1,4-Xyl, exhibiting negligible incorporation into other galactoside substrates.confidentO97422

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:1901576 [BP]organic substance biosynthetic processprobableGO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0050654 [BP]chondroitin sulfate proteoglycan metabolic processprobableGO:0044238, GO:0044710, GO:0030203, GO:0044260, GO:0006082, GO:0071704, GO:0019538, GO:1901135, GO:0009987, GO:0006807, GO:0044237, GO:0043170, GO:0008150, GO:0006022, GO:0006029, GO:0006790, GO:0044281, GO:0008152, GO:0043436, GO:1901564, GO:0009100
GO:0015020 [MF]glucuronosyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008194
GO:0005975 [BP]carbohydrate metabolic processprobableGO:0044238, GO:0008150, GO:0008152, GO:0071704

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CU0, chain A
Confidence level:very confident
Coverage over the Query: 2-133
View the alignment between query and template
View the model in PyMOL