Diaphorina citri psyllid: psy15152


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MNARFRLKGIARLKEKARKKKGRGFGTETSTRNEIREYESMETDVGDEEPGPQRSVEGWILFVTGVHEEAQEDDMHEKFSEYGEIKNLHLNLDRRTGFLKGYALVEYDSYKEASAARDALNGTTILGQTVTVDWCFVKGPKKVAGEQKVGPEGGVKVLFPVIMYSTETSMSTTLYNAPWIFKTMHITILCVI
cccHHHcccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccccccccEEEEEEccHHHHHHHHHHccccccccEEEEEEcCEEcccccccccccccccccccccccHHcccccHHHHHHHHccccccccccEEEEEEc
*******************************************************VEGWILFVTGVHEEAQEDDMHEKFSEYGEIKNLHLNLDRRTGFLKGYALVEYDSYKEASAARDALNGTTILGQTVTVDWCFVKG*****************VLFPVIMYSTETSMSTTLYNAPWIFKTMHITILCVI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNARFRLKGIARLKEKARKKKGRGFGTETSTRNEIREYESMETDVGDEEPGPQRSVEGWILFVTGVHEEAQEDDMHEKFSEYGEIKNLHLNLDRRTGFLKGYALVEYDSYKEASAARDALNGTTILGQTVTVDWCFVKGPKKVAGEQKVGPEGGVKVLFPVIMYSTETSMSTTLYNAPWIFKTMHITILCVI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA-binding protein 8A Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC, that remains bound to spliced mRNAs throughout all stages of mRNA metabolism, functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Remains associated with mRNAs in the cytoplasm until the mRNAs engage the translation machinery. Its removal from cytoplasmic mRNAs requires translation initiation from EJC-bearing spliced mRNAs. Associates preferentially with mRNAs produced by splicing. Does not interact with pre-mRNAs, introns, or mRNAs produced from intronless cDNAs. Associates with both nuclear mRNAs and newly exported cytoplasmic mRNAs.very confidentQ5D018
RNA-binding protein 8A Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC, that remains bound to spliced mRNAs throughout all stages of mRNA metabolism, functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Remains associated with mRNAs in the cytoplasm until the mRNAs engage the translation machinery. Its removal from cytoplasmic mRNAs requires translation initiation from EJC-bearing spliced mRNAs. Associates preferentially with mRNAs produced by splicing. Does not interact with pre-mRNAs, introns, or mRNAs produced from intronless cDNAs. Associates with both nuclear mRNAs and newly exported cytoplasmic mRNAs.very confidentQ28BZ1
RNA-binding protein 8A Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC, that remains bound to spliced mRNAs throughout all stages of mRNA metabolism, functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). The heterodimer MAGOH-RBM8A interacts with PYM that function to enhance the translation of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. Remains associated with mRNAs in the cytoplasm until the mRNAs engage the translation machinery. Its removal from cytoplasmic mRNAs requires translation initiation from EJC-bearing spliced mRNAs. Associates preferentially with mRNAs produced by splicing. Does not interact with pre-mRNAs, introns, or mRNAs produced from intronless cDNAs. Associates with both nuclear mRNAs and newly exported cytoplasmic mRNAs. Complex with MAGOH is a component of the nonsense mediated decay (NMD) pathway.confidentQ9Y5S9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partconfidentGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0035145 [CC]exon-exon junction complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0006417 [BP]regulation of translationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0006369 [BP]termination of RNA polymerase II transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0007312 [BP]oocyte nucleus migration involved in oocyte dorsal/ventral axis specificationprobableGO:0048610, GO:0009994, GO:0022412, GO:0048468, GO:0007569, GO:0007292, GO:0009798, GO:0007308, GO:0007309, GO:0051656, GO:0010259, GO:0007275, GO:0044699, GO:0007389, GO:0022414, GO:0000003, GO:0051649, GO:0040023, GO:0048869, GO:0030722, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0003006, GO:0051663, GO:0008150, GO:0003002, GO:0007310, GO:0051647, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0044767, GO:0044702, GO:0009953, GO:0044707, GO:0009950, GO:0048856, GO:0030154, GO:0044763, GO:0007097
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0046595 [BP]establishment of pole plasm mRNA localizationprobableGO:0022607, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0044702, GO:0009790, GO:0008358, GO:0048610, GO:0016043, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007350, GO:0000003, GO:0003006, GO:0070727, GO:0009948, GO:0007028, GO:0060811, GO:0060810, GO:0044085, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0007292, GO:0009880, GO:0032504, GO:0019094, GO:0019953, GO:0007281, GO:0007316, GO:0007315, GO:0007314, GO:0008150, GO:0003002, GO:0022412, GO:0051236, GO:0007351, GO:0051234, GO:0051179, GO:0051641, GO:0007276, GO:0006403, GO:0009952, GO:0044707, GO:0008595, GO:0048856, GO:0008298, GO:0044767, GO:0048869, GO:0044763, GO:0009987
GO:0031124 [BP]mRNA 3'-end processingprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:1901360, GO:0009987, GO:0006725, GO:0034641, GO:0031123, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:0044237, GO:0008152, GO:0046483, GO:0006396, GO:0006397
GO:0001703 [BP]gastrulation with mouth forming firstprobableGO:0048598, GO:0032502, GO:0048856, GO:0044707, GO:0007369, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0040022 [BP]feminization of hermaphroditic germ-lineprobableGO:0032502, GO:0022414, GO:0032501, GO:0040021, GO:0044707, GO:0018992, GO:0000003, GO:0003006, GO:0008150, GO:0007275, GO:0044699, GO:0007530
GO:0007173 [BP]epidermal growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0038127
GO:0007294 [BP]germarium-derived oocyte fate determinationprobableGO:0048610, GO:0009994, GO:0030154, GO:0019953, GO:0007292, GO:0007293, GO:0009653, GO:0044699, GO:0000003, GO:0048869, GO:0001709, GO:0030706, GO:0007276, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0044702, GO:0008150, GO:0022412, GO:0045165, GO:0003006, GO:0048856, GO:0030716, GO:0044763
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0000226 [BP]microtubule cytoskeleton organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0008380 [BP]RNA splicingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0045451 [BP]pole plasm oskar mRNA localizationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0022607, GO:0016043, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007276, GO:0000003, GO:0003006, GO:0070727, GO:0009948, GO:0007028, GO:0060811, GO:0060810, GO:0008298, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0019094, GO:0019953, GO:0007281, GO:0007316, GO:0007315, GO:0007314, GO:0008150, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0051179, GO:0051641, GO:0044767, GO:0006403, GO:0009952, GO:0044707, GO:0008595, GO:0044702, GO:0048856, GO:0044085, GO:0048869, GO:0044763, GO:0009987
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0000184 [BP]nuclear-transcribed mRNA catabolic process, nonsense-mediated decayprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0002009 [BP]morphogenesis of an epitheliumprobableGO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0006406 [BP]mRNA export from nucleusprobableGO:0015931, GO:0051169, GO:0051168, GO:0016482, GO:0051028, GO:0044699, GO:0071705, GO:0071702, GO:0033036, GO:0006405, GO:0009987, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0051236, GO:0051234, GO:0051179, GO:0051641, GO:0050658, GO:0006403, GO:0046907, GO:0050657, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EX7, chain B
Confidence level:very confident
Coverage over the Query: 50-143
View the alignment between query and template
View the model in PyMOL
Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 6-136
View the alignment between query and template
View the model in PyMOL