Diaphorina citri psyllid: psy15155


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MTIPEFIYSLISPPPRKEIKDKIVLITGAGSGLGRELALEFVKRGSQVLCADIQNEPNEETVRMLNEIRQGSAKAYHVDIGNEASVKELGKNVHRDFGKVDILINNAGILTQFKILQTDITDEQIQRLFNINITGHFRMVRAFLPDMVKRNQGHIVAISSMSSMTGVANASAYAASKWARYTYTA
ccHHHHHHHHccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEECcccccHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHcccccEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHccc
MTIPEFIYSLISPPPRKEIKDKIVLITGAGSGLGRELALEFVKRGSQVLCADIQNEPNEETVRMLNEIRQGSAKAYHVDIGNEASVKELGKNVHRDFGKVDILINNAGILTQFKILQTDITDEQIQRLFNINITGHFRMVRAFLPDMVKRNQGHIVAISSMSSMTGVANASAYAASKWARYTYTA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIPEFIYSLISPPPRKEIKDKIVLITGAGSGLGRELALEFVKRGSQVLCADIQNEPNEETVRMLNEIRQGSAKAYHVDIGNEASVKELGKNVHRDFGKVDILINNAGILTQFKILQTDITDEQIQRLFNINITGHFRMVRAFLPDMVKRNQGHIVAISSMSSMTGVANASAYAASKWARYTYTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized oxidoreductase MW2403 confidentQ8NUV9
Cyclopentanol dehydrogenase Reduces cyclopentanol to cyclopentanone. The enzyme also shows considerable activity towards cyclohexanol.confidentQ937L4
Uncharacterized oxidoreductase SAV2478 confidentQ99RF5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0005488 [MF]bindingprobableGO:0003674
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0044255 [BP]cellular lipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0016229 [MF]steroid dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016491
GO:0016616 [MF]oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptorprobableGO:0003824, GO:0003674, GO:0016614, GO:0016491
GO:1901575 [BP]organic substance catabolic processprobableGO:0008150, GO:0071704, GO:0009056, GO:0008152
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YB1, chain A
Confidence level:very confident
Coverage over the Query: 15-185
View the alignment between query and template
View the model in PyMOL