BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15162
(70 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2DAR|A Chain A, Solution Structure Of First Lim Domain Of Enigma-Like
Pdz And Lim Domains Protein
Length = 90
Score = 26.9 bits (58), Expect = 2.7, Method: Compositional matrix adjust.
Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 6/49 (12%)
Query: 11 QSTHIDFIHMTLLCTALDHCSKCVFGKEFYEIGAKWHPDLGEPFGVYHC 59
++ HI T +C HC++ + G +G WHP E F HC
Sbjct: 15 RAEHIPAGKRTPMCA---HCNQVIRGPFLVALGKSWHP---EEFNCAHC 57
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.332 0.144 0.540
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,323,383
Number of Sequences: 62578
Number of extensions: 73657
Number of successful extensions: 166
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 166
Number of HSP's gapped (non-prelim): 1
length of query: 70
length of database: 14,973,337
effective HSP length: 40
effective length of query: 30
effective length of database: 12,470,217
effective search space: 374106510
effective search space used: 374106510
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 45 (21.9 bits)