Query         psy15162
Match_columns 70
No_of_seqs    103 out of 112
Neff          3.1 
Searched_HMMs 46136
Date          Fri Aug 16 22:10:34 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15162.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15162hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00093 VWC:  von Willebrand f  98.2 7.7E-07 1.7E-11   51.8   2.5   27   33-67      1-27  (57)
  2 smart00214 VWC von Willebrand   97.8 1.4E-05   3E-10   46.6   2.1   28   33-68      1-28  (59)
  3 PF12714 TILa:  TILa domain      88.8    0.35 7.6E-06   28.3   1.9   18   32-49      1-19  (56)
  4 smart00215 VWC_out von Willebr  82.7    0.79 1.7E-05   28.2   1.3   26   33-67      1-26  (67)
  5 PF05825 PSP94:  Beta-microsemi  79.5     3.2   7E-05   27.1   3.5   33   27-67     12-45  (94)
  6 cd00061 FN1 Fibronectin type 1  78.1     2.8 6.1E-05   23.8   2.5   25   37-66      9-33  (43)
  7 PF00039 fn1:  Fibronectin type  75.6     3.9 8.4E-05   22.8   2.6   25   37-66      7-31  (39)
  8 smart00058 FN1 Fibronectin typ  73.3       7 0.00015   22.5   3.4   27   37-67      7-33  (45)
  9 PF15430 SVWC:  Single domain v  58.7      10 0.00022   21.3   2.1   26   33-65      1-26  (65)
 10 PF12191 stn_TNFRSF12A:  Tumour  41.3      11 0.00024   26.5   0.5   17   41-63     37-53  (129)
 11 KOG3408|consensus               38.9      13 0.00029   26.2   0.6   22   41-63     43-64  (129)
 12 PF10893 DUF2724:  Protein of u  33.5      15 0.00032   23.4   0.1   12   39-50     27-38  (68)
 13 COG5112 UFD2 U1-like Zn-finger  30.5      27 0.00058   24.5   1.0   17   46-63     46-62  (126)
 14 KOG0425|consensus               27.6      30 0.00065   25.4   0.9   17   42-60     75-91  (171)
 15 KOG2090|consensus               26.5      24 0.00051   30.7   0.2   16   35-50    392-407 (704)
 16 PF06473 FGF-BP1:  FGF binding   23.7      81  0.0018   23.4   2.6   27   12-38     59-85  (231)
 17 smart00132 LIM Zinc-binding do  23.6      35 0.00075   16.6   0.4   19   39-63     16-34  (39)
 18 KOG3430|consensus               22.3      43 0.00093   22.3   0.8   15   42-56     51-65  (90)
 19 PF06618 DUF1148:  Protein of u  22.0      14  0.0003   25.2  -1.6   13    1-13     80-92  (114)

No 1  
>PF00093 VWC:  von Willebrand factor type C domain;  InterPro: IPR001007 The vWF domain is found in various plasma proteins: complement factors B, C2, CR3 and CR4; the integrins (I-domains); collagen types VI, VII, XII and XIV; and other extracellular proteins [, , ]. Although the majority of VWA-containing proteins are extracellular, the most ancient ones present in all eukaryotes are all intracellular proteins involved in functions such as transcription, DNA repair, ribosomal and membrane transport and the proteasome. A common feature appears to be involvement in multiprotein complexes. Proteins that incorporate vWF domains participate in numerous biological events (e.g. cell adhesion, migration, homing, pattern formation, and signal transduction), involving interaction with a large array of ligands []. A number of human diseases arise from mutations in VWA domains. Secondary structure prediction from 75 aligned vWF sequences has revealed a largely alternating sequence of alpha-helices and beta-strands []. The domain is named after the von Willebrand factor (VWF) type C repeat which is found in multidomain protein/multifunctional proteins involved in maintaining homeostasis [, ]. For the von Willebrand factor the duplicated VWFC domain is thought to participate in oligomerization, but not in the initial dimerization step []. The presence of this region in a number of other complex-forming proteins points to the possible involvment of the VWFC domain in complex formation.; GO: 0005515 protein binding; PDB: 1U5M_A.
Probab=98.25  E-value=7.7e-07  Score=51.77  Aligned_cols=27  Identities=44%  Similarity=1.158  Sum_probs=20.3

Q ss_pred             cEECCEEecCCCEEeeccCCCcceEEeEEEEEecC
Q psy15162         33 CVFGKEFYEIGAKWHPDLGEPFGVYHCVTCECVQV   67 (70)
Q Consensus        33 C~Fgg~~Y~~Ge~WHP~Lg~PFG~M~CI~C~C~~~   67 (70)
                      |.|+|+.|++|++|+|+.        |..|+|.+.
T Consensus         1 C~~~g~~y~~g~~w~~~~--------C~~C~C~~G   27 (57)
T PF00093_consen    1 CSFNGRVYQNGESWHPDP--------CTTCTCQDG   27 (57)
T ss_dssp             EESSS-EE-SS-EE-S-S--------SEEEEEETT
T ss_pred             CeeCCEEeCCCCEECCCC--------CcEeEecCC
Confidence            789999999999999997        999999874


No 2  
>smart00214 VWC von Willebrand factor (vWF) type C domain.
Probab=97.80  E-value=1.4e-05  Score=46.64  Aligned_cols=28  Identities=39%  Similarity=1.024  Sum_probs=24.9

Q ss_pred             cEECCEEecCCCEEeeccCCCcceEEeEEEEEecCc
Q psy15162         33 CVFGKEFYEIGAKWHPDLGEPFGVYHCVTCECVQVS   68 (70)
Q Consensus        33 C~Fgg~~Y~~Ge~WHP~Lg~PFG~M~CI~C~C~~~~   68 (70)
                      |.|+|+.|.+|++|+|+-        |..|+|.+.+
T Consensus         1 C~~~g~~y~~G~~W~~~~--------C~~C~C~~g~   28 (59)
T smart00214        1 CVHNGEVYNDGETWKPDP--------CQICTCLDGE   28 (59)
T ss_pred             CccCCEEeCCCCEECCCC--------CeECCcCCCC
Confidence            789999999999999964        9999998764


No 3  
>PF12714 TILa:  TILa domain
Probab=88.76  E-value=0.35  Score=28.34  Aligned_cols=18  Identities=28%  Similarity=0.924  Sum_probs=16.4

Q ss_pred             CcE-ECCEEecCCCEEeec
Q psy15162         32 KCV-FGKEFYEIGAKWHPD   49 (70)
Q Consensus        32 gC~-Fgg~~Y~~Ge~WHP~   49 (70)
                      ||. ++|+.|++||+|-.+
T Consensus         1 GC~d~~G~yy~~Ge~~~~~   19 (56)
T PF12714_consen    1 GCTDYNGRYYPPGESWWTD   19 (56)
T ss_pred             CCcCcCCEEECCCCEEeCC
Confidence            688 999999999999876


No 4  
>smart00215 VWC_out von Willebrand factor (vWF) type C domain.
Probab=82.66  E-value=0.79  Score=28.20  Aligned_cols=26  Identities=35%  Similarity=0.925  Sum_probs=21.3

Q ss_pred             cEECCEEecCCCEEeeccCCCcceEEeEEEEEecC
Q psy15162         33 CVFGKEFYEIGAKWHPDLGEPFGVYHCVTCECVQV   67 (70)
Q Consensus        33 C~Fgg~~Y~~Ge~WHP~Lg~PFG~M~CI~C~C~~~   67 (70)
                      |..+|+.|+.|++|-         -.|-+|+|.+.
T Consensus         1 C~~~G~~y~~g~~w~---------d~Cn~CtC~~G   26 (67)
T smart00215        1 CYNNGSYYPPGAKWD---------DDCNRCTCLNG   26 (67)
T ss_pred             CeECCEEcCCCCccc---------cCCCCCEecCC
Confidence            788999999999995         33888998653


No 5  
>PF05825 PSP94:  Beta-microseminoprotein (PSP-94);  InterPro: IPR008735 This family consists of the mammalian specific protein beta-microseminoprotein. Prostatic secretory protein of 94 amino acids (PSP94), also called beta-microseminoprotein, is a small, nonglycosylated protein, rich in cysteine residues. It was first isolated as a major protein from Homo sapiens seminal plasma []. The exact function of this protein is unknown.; PDB: 2IZ4_A 1XHH_A 3IX0_C 2IZ3_A.
Probab=79.49  E-value=3.2  Score=27.13  Aligned_cols=33  Identities=21%  Similarity=0.578  Sum_probs=27.5

Q ss_pred             cCCCCCcE-ECCEEecCCCEEeeccCCCcceEEeEEEEEecC
Q psy15162         27 LDHCSKCV-FGKEFYEIGAKWHPDLGEPFGVYHCVTCECVQV   67 (70)
Q Consensus        27 ~~~~~gC~-Fgg~~Y~~Ge~WHP~Lg~PFG~M~CI~C~C~~~   67 (70)
                      .++..+|. ..|+.|+.|++|-=.=        |..|+|.+.
T Consensus        12 ~~~~~~C~D~dG~~h~l~S~W~T~~--------C~~C~C~~~   45 (94)
T PF05825_consen   12 GDSPNECKDWDGKKHPLNSTWKTDD--------CEECSCSED   45 (94)
T ss_dssp             TSSTTCEEETTTEEEETTEEEEETT--------SEEEEEESS
T ss_pred             CCCCCccEeCCCcEEeCCCeECCCC--------CcEEEecCC
Confidence            45678898 6799999999998664        999999863


No 6  
>cd00061 FN1 Fibronectin type 1 domain, approximately 40 residue long with two conserved disulfide bridges. FN1 is one of three types of internal repeats which combine to form larger domains within fibronectin. Fibronectin, a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin, usually exists as a dimer in plasma and as an insoluble multimer in extracellular matrices.  Dimers of nearly identical subunits are linked by a disulfide bond close to their C-terminus. FN1 domains also found in coagulation factor XII, HGF activator, and tissue-type plasminogen activator. In tissue plasminogen activator, FN1 domains may form functional fibrin-binding units with EGF-like domains C-terminal to FN1.
Probab=78.14  E-value=2.8  Score=23.82  Aligned_cols=25  Identities=32%  Similarity=0.824  Sum_probs=19.1

Q ss_pred             CEEecCCCEEeeccCCCcceEEeEEEEEec
Q psy15162         37 KEFYEIGAKWHPDLGEPFGVYHCVTCECVQ   66 (70)
Q Consensus        37 g~~Y~~Ge~WHP~Lg~PFG~M~CI~C~C~~   66 (70)
                      +++|..||+|+=.. +. .+|.   |+|.-
T Consensus         9 ~~~Y~ige~W~r~~-~~-~~~~---C~C~G   33 (43)
T cd00061           9 GVFYRVGETWERPS-EG-HVLQ---CTCLG   33 (43)
T ss_pred             ccEEeCCCEEEeec-CC-eEEE---EEEeC
Confidence            78999999999776 55 5554   67754


No 7  
>PF00039 fn1:  Fibronectin type I domain;  InterPro: IPR000083 Fibronectin type I repeats are one of the three repeats found in the fibronectin protein. Fibronectin is a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Type I domain (FN1) is approximately 40 residues in length. Four conserved cysteines are involved in disulphide bonds. The 3D structure of the FN1 domain has been determined [, , ]. It consists of two antiparallel beta-sheets, first a double-stranded one, that is linked by a disulphide bond to a triple-stranded beta-sheet. The second conserved disulphide bridge links the C-terminal adjacent strands of the domain.  In human tissue plasminogen activator chain A the FN1 domain together with the following epidermal growth factor (EGF)-like domain are involved in fibrin-binding []. It has been suggested that these two modules form a single structural and functional unit []. The two domains keep their specific tertiary structure, but interact intimately to bury a hydrophobic core; the inter-module linker makes up the third strand of the EGF-module's major beta-sheet.; GO: 0005576 extracellular region; PDB: 2RKY_A 1FBR_A 2RL0_D 3M7P_A 3MQL_A 3ZRZ_A 2RKZ_F 2CKU_A 2CG6_A 3CAL_C ....
Probab=75.59  E-value=3.9  Score=22.75  Aligned_cols=25  Identities=28%  Similarity=0.950  Sum_probs=18.6

Q ss_pred             CEEecCCCEEeeccCCCcceEEeEEEEEec
Q psy15162         37 KEFYEIGAKWHPDLGEPFGVYHCVTCECVQ   66 (70)
Q Consensus        37 g~~Y~~Ge~WHP~Lg~PFG~M~CI~C~C~~   66 (70)
                      +.+|..||+|.=.. .  |.+  +.|+|.-
T Consensus         7 ~~~Y~vge~W~R~~-~--g~~--~~CtC~G   31 (39)
T PF00039_consen    7 GQFYQVGETWERPY-Q--GHM--MQCTCLG   31 (39)
T ss_dssp             TEEEETTEEEEEEE-T--SSE--EEEEEEE
T ss_pred             ccEEeCCCEEEeec-C--CeE--EEeEECC
Confidence            78999999999665 4  554  3488853


No 8  
>smart00058 FN1 Fibronectin type 1 domain. One of three types of internal repeat within the plasma protein, fibronectin. Found also in coagulation factor XII, HGF activator and tissue-type plasminogen activator. In t-PA and fibronectin, this domain type  contributes to fibrin-binding.
Probab=73.27  E-value=7  Score=22.50  Aligned_cols=27  Identities=30%  Similarity=0.704  Sum_probs=19.6

Q ss_pred             CEEecCCCEEeeccCCCcceEEeEEEEEecC
Q psy15162         37 KEFYEIGAKWHPDLGEPFGVYHCVTCECVQV   67 (70)
Q Consensus        37 g~~Y~~Ge~WHP~Lg~PFG~M~CI~C~C~~~   67 (70)
                      ++.|..||+|+=.. +. |.|  ..|+|.-.
T Consensus         7 ~~~Y~ige~W~r~~-~~-g~~--~~C~C~G~   33 (45)
T smart00058        7 GTTYRIGDTWERPY-EG-GHV--LQCTCLGN   33 (45)
T ss_pred             ccEEecCCEEEeec-CC-CcE--EEeEEcCC
Confidence            68999999999775 54 444  45777654


No 9  
>PF15430 SVWC:  Single domain von Willebrand factor type C
Probab=58.67  E-value=10  Score=21.31  Aligned_cols=26  Identities=23%  Similarity=0.692  Sum_probs=20.1

Q ss_pred             cEECCEEecCCCEEeeccCCCcceEEeEEEEEe
Q psy15162         33 CVFGKEFYEIGAKWHPDLGEPFGVYHCVTCECV   65 (70)
Q Consensus        33 C~Fgg~~Y~~Ge~WHP~Lg~PFG~M~CI~C~C~   65 (70)
                      |.|+++...+|+++.+.-  |     |.+=+|.
T Consensus         1 C~y~~~~~~~g~~~~~~~--p-----C~~~~C~   26 (65)
T PF15430_consen    1 CYYNGRTIPSGESYNPEE--P-----CERWTCD   26 (65)
T ss_pred             CEECCEEcCCCcEecCCC--C-----CceEEEE
Confidence            889999999999999753  3     5555554


No 10 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=41.30  E-value=11  Score=26.52  Aligned_cols=17  Identities=35%  Similarity=1.019  Sum_probs=13.4

Q ss_pred             cCCCEEeeccCCCcceEEeEEEE
Q psy15162         41 EIGAKWHPDLGEPFGVYHCVTCE   63 (70)
Q Consensus        41 ~~Ge~WHP~Lg~PFG~M~CI~C~   63 (70)
                      ..|++|.|+|      -+|+.|.
T Consensus        37 p~G~sWs~dL------dkCm~Cs   53 (129)
T PF12191_consen   37 PRGSSWSADL------DKCMSCS   53 (129)
T ss_dssp             -SSEEEETTT------TEEEECC
T ss_pred             CCCCcCcccc------cccccCc
Confidence            5789999999      4788874


No 11 
>KOG3408|consensus
Probab=38.92  E-value=13  Score=26.19  Aligned_cols=22  Identities=27%  Similarity=0.652  Sum_probs=18.5

Q ss_pred             cCCCEEeeccCCCcceEEeEEEE
Q psy15162         41 EIGAKWHPDLGEPFGVYHCVTCE   63 (70)
Q Consensus        41 ~~Ge~WHP~Lg~PFG~M~CI~C~   63 (70)
                      ....+--|+| |-+|.-+||.|.
T Consensus        43 ll~~~~D~dl-PG~GqfyCi~Ca   64 (129)
T KOG3408|consen   43 LLNQEIDPDL-PGGGQFYCIECA   64 (129)
T ss_pred             hhcCcCCCCC-CCCceeehhhhh
Confidence            4566778999 999999999984


No 12 
>PF10893 DUF2724:  Protein of unknown function (DUF2724);  InterPro: IPR021221 This entry is represented by Bacteriophage 186, Fil. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=33.46  E-value=15  Score=23.40  Aligned_cols=12  Identities=33%  Similarity=0.642  Sum_probs=9.6

Q ss_pred             EecCCCEEeecc
Q psy15162         39 FYEIGAKWHPDL   50 (70)
Q Consensus        39 ~Y~~Ge~WHP~L   50 (70)
                      .-.+|..|||-.
T Consensus        27 ~l~~GkRWhP~~   38 (68)
T PF10893_consen   27 ELPDGKRWHPCR   38 (68)
T ss_pred             ECCCCCcCCCCc
Confidence            457899999964


No 13 
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=30.53  E-value=27  Score=24.50  Aligned_cols=17  Identities=29%  Similarity=0.890  Sum_probs=14.0

Q ss_pred             EeeccCCCcceEEeEEEE
Q psy15162         46 WHPDLGEPFGVYHCVTCE   63 (70)
Q Consensus        46 WHP~Lg~PFG~M~CI~C~   63 (70)
                      .-|+| |..|.-+||.|.
T Consensus        46 ~Dp~l-PGlGqhYCieCa   62 (126)
T COG5112          46 YDPEL-PGLGQHYCIECA   62 (126)
T ss_pred             CCCCC-CCCceeeeehhH
Confidence            45888 889999999873


No 14 
>KOG0425|consensus
Probab=27.55  E-value=30  Score=25.41  Aligned_cols=17  Identities=29%  Similarity=0.770  Sum_probs=13.6

Q ss_pred             CCCEEeeccCCCcceEEeE
Q psy15162         42 IGAKWHPDLGEPFGVYHCV   60 (70)
Q Consensus        42 ~Ge~WHP~Lg~PFG~M~CI   60 (70)
                      ..+-|||++ .+-|.+ ||
T Consensus        75 ~s~mwHPNv-y~~G~v-CI   91 (171)
T KOG0425|consen   75 TSKMWHPNV-YEDGDV-CI   91 (171)
T ss_pred             ehhhcCCCc-CCCCCE-EE
Confidence            457899999 888876 66


No 15 
>KOG2090|consensus
Probab=26.50  E-value=24  Score=30.75  Aligned_cols=16  Identities=38%  Similarity=0.694  Sum_probs=12.0

Q ss_pred             ECCEEecCCCEEeecc
Q psy15162         35 FGKEFYEIGAKWHPDL   50 (70)
Q Consensus        35 Fgg~~Y~~Ge~WHP~L   50 (70)
                      |-...-+.||.|||++
T Consensus       392 l~~~~l~pGE~WhpdV  407 (704)
T KOG2090|consen  392 LIPEPLAPGEVWHPDV  407 (704)
T ss_pred             eeccCCCCccccCchh
Confidence            3344567899999997


No 16 
>PF06473 FGF-BP1:  FGF binding protein 1 (FGF-BP1);  InterPro: IPR010510 This family consists of several mammalian FGF binding protein 1. Fibroblast growth factors (FGFs) play important roles during foetal and embryonic development []. Fibroblast growth factor-binding protein (FGF-BP) 1 is a secreted protein that can bind fibroblast growth factors (FGFs) 1 and 2 [].
Probab=23.72  E-value=81  Score=23.40  Aligned_cols=27  Identities=15%  Similarity=0.254  Sum_probs=23.7

Q ss_pred             cceeeeEEEEEEeeecCCCCCcEECCE
Q psy15162         12 STHIDFIHMTLLCTALDHCSKCVFGKE   38 (70)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~gC~Fgg~   38 (70)
                      ++.-|-+.+.+-|+..++.-.|.|.|+
T Consensus        59 ~~~~~~~~L~V~C~~~~~~~~C~y~G~   85 (231)
T PF06473_consen   59 TTGEDGVELRVECKNQGGSFWCEYTGK   85 (231)
T ss_pred             ccCCCceEEEEEEcCCCceEEeEecCC
Confidence            455688999999999999999999997


No 17 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=23.57  E-value=35  Score=16.59  Aligned_cols=19  Identities=32%  Similarity=1.113  Sum_probs=12.9

Q ss_pred             EecCCCEEeeccCCCcceEEeEEEE
Q psy15162         39 FYEIGAKWHPDLGEPFGVYHCVTCE   63 (70)
Q Consensus        39 ~Y~~Ge~WHP~Lg~PFG~M~CI~C~   63 (70)
                      ....|..|||.-      -+|..|.
T Consensus        16 ~~~~~~~~H~~C------f~C~~C~   34 (39)
T smart00132       16 LRALGKVWHPEC------FKCSKCG   34 (39)
T ss_pred             EEeCCccccccC------CCCcccC
Confidence            445788999986      4565553


No 18 
>KOG3430|consensus
Probab=22.28  E-value=43  Score=22.28  Aligned_cols=15  Identities=40%  Similarity=0.891  Sum_probs=13.3

Q ss_pred             CCCEEeeccCCCcce
Q psy15162         42 IGAKWHPDLGEPFGV   56 (70)
Q Consensus        42 ~Ge~WHP~Lg~PFG~   56 (70)
                      -|..||=.+|..||-
T Consensus        51 yG~~WhcivG~~FGs   65 (90)
T KOG3430|consen   51 YGPTWHCIVGRNFGS   65 (90)
T ss_pred             cCCccEEEEcCCcce
Confidence            488999999999995


No 19 
>PF06618 DUF1148:  Protein of unknown function (DUF1148);  InterPro: IPR009529 This family consists of several Maize streak virus proteins of unknown function.
Probab=22.05  E-value=14  Score=25.22  Aligned_cols=13  Identities=46%  Similarity=1.288  Sum_probs=9.8

Q ss_pred             CeEEEEEEEeecc
Q psy15162          1 MTWYIWYIRLQST   13 (70)
Q Consensus         1 ~~~~~~~~~~~~~   13 (70)
                      +||+-||||-.-.
T Consensus        80 ltwwcwyirdrva   92 (114)
T PF06618_consen   80 LTWWCWYIRDRVA   92 (114)
T ss_pred             hhhhhhhhhcccc
Confidence            4899999986543


Done!