Query         psy15163
Match_columns 176
No_of_seqs    174 out of 1208
Neff          8.9 
Searched_HMMs 46136
Date          Fri Aug 16 22:11:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15163.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15163hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1701|consensus               99.9 1.8E-23   4E-28  167.3  -0.3  112   52-175   320-438 (468)
  2 KOG1701|consensus               99.9 1.4E-23 3.1E-28  167.9  -3.0   97   73-176   276-372 (468)
  3 KOG2272|consensus               99.8 1.5E-22 3.1E-27  152.4  -1.5  115   50-176   178-292 (332)
  4 KOG2272|consensus               99.8 5.4E-22 1.2E-26  149.3  -3.9  101   70-176    11-111 (332)
  5 KOG4577|consensus               99.8 5.5E-21 1.2E-25  146.3  -5.6   99   70-175    32-131 (383)
  6 KOG1044|consensus               99.8 2.5E-19 5.4E-24  148.2   3.3  119   50-176   108-230 (670)
  7 KOG1703|consensus               99.7 2.5E-18 5.5E-23  144.9  -0.3  111   54-175   350-461 (479)
  8 KOG1703|consensus               99.6   8E-16 1.7E-20  129.8   3.5   98   72-176   304-401 (479)
  9 PF00412 LIM:  LIM domain;  Int  99.6 3.6E-15 7.7E-20   90.6   4.3   58   74-135     1-58  (58)
 10 KOG1044|consensus               99.2 7.1E-12 1.5E-16  104.5   4.2   86   72-175    17-102 (670)
 11 KOG1700|consensus               99.2 1.7E-12 3.6E-17   97.7  -0.4   99   71-175     7-146 (200)
 12 smart00132 LIM Zinc-binding do  99.0 3.6E-10 7.9E-15   62.6   2.5   38  139-176     1-39  (39)
 13 PF00412 LIM:  LIM domain;  Int  98.9   7E-10 1.5E-14   67.0   2.7   37  140-176     1-38  (58)
 14 KOG4577|consensus               98.7 1.7E-09 3.7E-14   83.6  -1.5   77   52-136    77-155 (383)
 15 smart00132 LIM Zinc-binding do  98.7 2.1E-08 4.6E-13   55.3   2.8   38   73-114     1-38  (39)
 16 KOG1700|consensus               98.0 1.3E-06 2.7E-11   66.0  -0.3   63   69-136   106-168 (200)
 17 KOG1702|consensus               97.6 3.9E-06 8.5E-11   62.3  -3.0   59   73-136     6-64  (264)
 18 KOG0490|consensus               97.5 7.6E-06 1.6E-10   62.8  -2.8   76   96-174    16-96  (235)
 19 PF14446 Prok-RING_1:  Prokaryo  91.3    0.14   3E-06   30.2   1.6   37  138-174     6-51  (54)
 20 PF14446 Prok-RING_1:  Prokaryo  90.9    0.16 3.4E-06   29.9   1.6   31   72-104     6-36  (54)
 21 PF08394 Arc_trans_TRASH:  Arch  89.0    0.17 3.7E-06   27.4   0.6   32  140-174     1-33  (37)
 22 PF10367 Vps39_2:  Vacuolar sor  85.6    0.58 1.3E-05   31.1   1.8   29   72-104    79-107 (109)
 23 PF09943 DUF2175:  Uncharacteri  85.5    0.31 6.7E-06   32.5   0.4   31   73-107     4-34  (101)
 24 PF09943 DUF2175:  Uncharacteri  85.2    0.25 5.3E-06   33.0  -0.1   28  139-166     4-32  (101)
 25 PF14835 zf-RING_6:  zf-RING of  80.1     1.6 3.5E-05   26.7   2.0   48  104-152     8-55  (65)
 26 PF10367 Vps39_2:  Vacuolar sor  79.9     1.1 2.4E-05   29.7   1.5   28  138-165    79-107 (109)
 27 smart00504 Ubox Modified RING   79.8     1.4 3.1E-05   26.2   1.8   48  104-153     2-51  (63)
 28 PF10235 Cript:  Microtubule-as  79.2     1.3 2.8E-05   29.0   1.5   43   98-149    39-81  (90)
 29 PF13240 zinc_ribbon_2:  zinc-r  77.0     1.4 3.1E-05   21.1   0.9    9  140-148     2-10  (23)
 30 PF13920 zf-C3HC4_3:  Zinc fing  76.7     3.1 6.7E-05   23.7   2.5   42  105-148     4-48  (50)
 31 PF10083 DUF2321:  Uncharacteri  75.7     1.4   3E-05   31.8   1.0   49  123-174    27-78  (158)
 32 KOG1813|consensus               74.7     1.7 3.6E-05   34.7   1.3   46  103-149   241-287 (313)
 33 KOG0320|consensus               74.0     1.3 2.8E-05   32.7   0.5   53  100-152   128-182 (187)
 34 PRK14890 putative Zn-ribbon RN  73.6     4.9 0.00011   24.1   2.8   14   72-85      8-21  (59)
 35 COG4847 Uncharacterized protei  71.2     1.4   3E-05   29.0   0.1   29  138-166     7-36  (103)
 36 COG5152 Uncharacterized conser  70.6     1.5 3.2E-05   33.0   0.1   49  101-150   194-243 (259)
 37 PF00645 zf-PARP:  Poly(ADP-rib  69.3     2.2 4.7E-05   27.1   0.7   17   72-88      8-24  (82)
 38 COG0068 HypF Hydrogenase matur  67.0       8 0.00017   34.7   3.9   85   68-174    98-183 (750)
 39 PLN03208 E3 ubiquitin-protein   67.0     8.2 0.00018   29.0   3.4   16  138-153    69-84  (193)
 40 PF11781 RRN7:  RNA polymerase   66.3     3.1 6.8E-05   22.3   0.8   23  105-131    10-32  (36)
 41 PF10886 DUF2685:  Protein of u  65.6     5.1 0.00011   23.5   1.7   25  138-162     2-26  (54)
 42 COG2191 Formylmethanofuran deh  65.6     2.4 5.1E-05   32.0   0.4   31  104-134   173-203 (206)
 43 PF06906 DUF1272:  Protein of u  64.3     9.2  0.0002   22.7   2.6   26  124-150    29-54  (57)
 44 KOG0978|consensus               62.9     1.8 3.8E-05   38.7  -0.9   16  138-153   679-694 (698)
 45 PF14634 zf-RING_5:  zinc-RING   62.5     8.1 0.00018   21.3   2.2   25  120-145    18-44  (44)
 46 COG4847 Uncharacterized protei  61.6     3.8 8.3E-05   27.0   0.7   36   73-112     8-43  (103)
 47 PF07754 DUF1610:  Domain of un  61.1     6.9 0.00015   19.0   1.4   12  140-151     1-12  (24)
 48 PF07191 zinc-ribbons_6:  zinc-  60.5     2.5 5.4E-05   26.3  -0.2   10  138-147    31-40  (70)
 49 cd00162 RING RING-finger (Real  59.1     5.9 0.00013   21.0   1.2   25  122-146    18-44  (45)
 50 PF00096 zf-C2H2:  Zinc finger,  58.3     5.3 0.00011   18.4   0.8   11  165-175     1-11  (23)
 51 PF01258 zf-dskA_traR:  Prokary  57.1     2.2 4.8E-05   22.6  -0.8   27  106-132     6-32  (36)
 52 PF14471 DUF4428:  Domain of un  55.4     9.5 0.00021   22.1   1.6   29  105-134     1-30  (51)
 53 COG4357 Zinc finger domain con  52.4     1.2 2.6E-05   29.4  -2.7   52   73-129    37-88  (105)
 54 PF11571 Med27:  Mediator compl  51.7     4.3 9.3E-05   26.5  -0.3   18  129-147    47-64  (90)
 55 COG2888 Predicted Zn-ribbon RN  50.5      20 0.00043   21.6   2.4   16   72-87     10-25  (61)
 56 KOG2932|consensus               49.8     8.6 0.00019   31.0   1.1   43  105-148    92-134 (389)
 57 PF02069 Metallothio_Pro:  Prok  49.4     9.9 0.00021   22.2   1.0   28  105-132     9-37  (52)
 58 PF13894 zf-C2H2_4:  C2H2-type   49.1     9.6 0.00021   17.2   0.9   11  165-175     1-11  (24)
 59 PF13923 zf-C3HC4_2:  Zinc fing  48.9       6 0.00013   21.2   0.1   27  107-133     2-28  (39)
 60 cd02336 ZZ_RSC8 Zinc finger, Z  46.4      20 0.00044   20.2   2.0   29  105-133     2-32  (45)
 61 PF06677 Auto_anti-p27:  Sjogre  46.2      10 0.00022   21.0   0.7    8  121-128    31-38  (41)
 62 COG1645 Uncharacterized Zn-fin  45.2     9.8 0.00021   26.7   0.7   20  106-130    31-50  (131)
 63 cd02249 ZZ Zinc finger, ZZ typ  44.8      19  0.0004   20.1   1.7    9  124-132    23-31  (46)
 64 KOG3002|consensus               44.7      16 0.00034   29.5   1.9   43  104-148    49-91  (299)
 65 PF12874 zf-met:  Zinc-finger o  44.1      12 0.00026   17.5   0.8   12  165-176     1-12  (25)
 66 PF13912 zf-C2H2_6:  C2H2-type   43.8      12 0.00026   17.9   0.8   11  165-175     2-12  (27)
 67 PF12171 zf-C2H2_jaz:  Zinc-fin  43.0      16 0.00035   17.7   1.2   12  165-176     2-13  (27)
 68 smart00291 ZnF_ZZ Zinc-binding  41.3      26 0.00056   19.3   2.0   10  124-133    27-36  (44)
 69 KOG0823|consensus               41.3      40 0.00087   26.0   3.5   52  102-154    46-101 (230)
 70 PF13248 zf-ribbon_3:  zinc-rib  41.0      21 0.00045   17.3   1.4    7   73-79     18-24  (26)
 71 PF12156 ATPase-cat_bd:  Putati  40.8      12 0.00026   24.2   0.6   30  139-171     2-33  (88)
 72 PRK00398 rpoP DNA-directed RNA  40.1      16 0.00036   20.3   1.0   10  138-147    22-31  (46)
 73 KOG3579|consensus               39.0      17 0.00037   29.0   1.2   51   69-129   266-316 (352)
 74 PF06827 zf-FPG_IleRS:  Zinc fi  38.6     7.6 0.00017   19.5  -0.5   11  138-148     2-12  (30)
 75 PF12674 Zn_ribbon_2:  Putative  38.0      15 0.00033   23.5   0.7   28  106-133     3-35  (81)
 76 COG4306 Uncharacterized protei  36.0      24 0.00051   24.6   1.4   46  126-174    30-78  (160)
 77 PRK00420 hypothetical protein;  35.8      16 0.00035   25.0   0.6   10   73-82     25-34  (112)
 78 KOG4739|consensus               35.5      27 0.00059   27.0   1.8   34  115-149    15-49  (233)
 79 PF14569 zf-UDP:  Zinc-binding   34.6      33 0.00071   21.8   1.8   23  124-146    36-60  (80)
 80 KOG3476|consensus               34.2     5.2 0.00011   25.9  -1.9   37  104-149    55-91  (100)
 81 PRK14873 primosome assembly pr  33.7      21 0.00045   32.1   1.1   36  107-146   396-431 (665)
 82 PHA02775 E6; Provisional        33.7      10 0.00023   27.6  -0.6   14   73-86     45-58  (160)
 83 PF12773 DZR:  Double zinc ribb  33.2      39 0.00084   18.9   1.9   10   73-82     14-23  (50)
 84 PF13465 zf-H2C2_2:  Zinc-finge  31.7      26 0.00056   16.9   0.8   11  165-175    15-25  (26)
 85 smart00249 PHD PHD zinc finger  31.5      37  0.0008   18.0   1.6   16  124-141    14-29  (47)
 86 cd02341 ZZ_ZZZ3 Zinc finger, Z  31.3      49  0.0011   18.8   2.0   10  124-133    26-35  (48)
 87 KOG4443|consensus               31.0      23 0.00051   31.5   0.9   18  157-174   108-125 (694)
 88 PRK14559 putative protein seri  30.8      30 0.00066   31.0   1.6   11   73-83      3-13  (645)
 89 PF00628 PHD:  PHD-finger;  Int  30.5      44 0.00095   18.6   1.8   29   74-105     2-30  (51)
 90 PF04570 DUF581:  Protein of un  30.3      35 0.00075   20.4   1.3   24  105-128    18-43  (58)
 91 PF14149 YhfH:  YhfH-like prote  30.0      17 0.00037   19.6  -0.0   18  131-148     7-24  (37)
 92 COG0266 Nei Formamidopyrimidin  30.0      29 0.00064   27.6   1.3   28  135-164   244-271 (273)
 93 PF05502 Dynactin_p62:  Dynacti  29.9      35 0.00076   29.4   1.8   41   69-115    24-64  (483)
 94 PF15135 UPF0515:  Uncharacteri  29.7      65  0.0014   25.3   3.0   75   55-153   112-190 (278)
 95 PF14255 Cys_rich_CPXG:  Cystei  29.0      15 0.00032   21.4  -0.4   11  157-167    20-30  (52)
 96 PHA02779 E6 protein; Provision  29.0      13 0.00029   26.7  -0.7   25  138-162   102-128 (150)
 97 COG3813 Uncharacterized protei  28.8      53  0.0011   20.6   2.0   27  124-151    29-55  (84)
 98 TIGR02420 dksA RNA polymerase-  28.6      11 0.00023   25.5  -1.2   10  139-148    82-91  (110)
 99 cd02335 ZZ_ADA2 Zinc finger, Z  28.4      60  0.0013   18.3   2.1    9  125-133    25-33  (49)
100 PF00569 ZZ:  Zinc finger, ZZ t  28.1      45 0.00097   18.6   1.5   10  124-133    28-37  (46)
101 PF04810 zf-Sec23_Sec24:  Sec23  27.5      44 0.00095   18.1   1.4   30  138-172     3-32  (40)
102 KOG2462|consensus               27.4      33 0.00071   27.2   1.1   38  138-176   188-227 (279)
103 PF05502 Dynactin_p62:  Dynacti  27.4      44 0.00096   28.8   2.0   12  163-174    51-62  (483)
104 smart00531 TFIIE Transcription  26.2      22 0.00048   25.3  -0.0   33  139-174   101-133 (147)
105 smart00355 ZnF_C2H2 zinc finge  25.5      33 0.00071   15.4   0.6   11  165-175     1-11  (26)
106 PF13834 DUF4193:  Domain of un  25.5      20 0.00044   23.8  -0.3   31  100-130    67-98  (99)
107 PRK01103 formamidopyrimidine/5  25.1      37 0.00081   26.8   1.1   29  134-164   243-271 (274)
108 PF04641 Rtf2:  Rtf2 RING-finge  24.8 1.1E+02  0.0023   24.0   3.6   55   99-154   109-167 (260)
109 PRK12495 hypothetical protein;  24.8      52  0.0011   25.3   1.7   11  104-114    43-53  (226)
110 cd02340 ZZ_NBR1_like Zinc fing  24.8      68  0.0015   17.7   1.8    7  126-132    25-31  (43)
111 PHA02610 uvsY.-2 hypothetical   24.5      57  0.0012   19.0   1.5   25  138-162     2-26  (53)
112 PRK14891 50S ribosomal protein  23.7      67  0.0015   22.5   2.0   20   72-91      5-24  (131)
113 TIGR00599 rad18 DNA repair pro  23.0      46   0.001   28.0   1.3   10  139-148    62-71  (397)
114 PHA02929 N1R/p28-like protein;  23.0      30 0.00066   26.9   0.2   25  122-147   200-226 (238)
115 PHA02768 hypothetical protein;  22.9      15 0.00033   21.7  -1.1   12  104-115     6-17  (55)
116 KOG3579|consensus               22.6      44 0.00096   26.8   1.0   53  104-168   269-321 (352)
117 COG1656 Uncharacterized conser  22.5      35 0.00075   25.0   0.4   36  138-173    98-139 (165)
118 KOG2114|consensus               22.0      36 0.00078   31.4   0.5   38  139-176   842-884 (933)
119 KOG2893|consensus               21.9      22 0.00049   27.7  -0.7   34   72-113    11-44  (341)
120 PF04564 U-box:  U-box domain;   21.6 1.3E+02  0.0029   18.3   3.0   50  102-153     3-55  (73)
121 PRK14810 formamidopyrimidine-D  21.4      50  0.0011   26.1   1.1   28  135-164   243-270 (272)
122 PRK10445 endonuclease VIII; Pr  21.2      48   0.001   26.0   1.0   29  134-164   233-261 (263)
123 PF07649 C1_3:  C1-like domain;  21.0      55  0.0012   16.2   0.9   11  105-115     2-12  (30)
124 PF11077 DUF2616:  Protein of u  21.0      48   0.001   24.5   0.9   18  118-135   154-171 (173)
125 PF01286 XPA_N:  XPA protein N-  20.7      43 0.00092   17.7   0.4   10   73-82      5-14  (34)
126 PRK14811 formamidopyrimidine-D  20.6      53  0.0011   25.9   1.1   11  138-148   236-246 (269)
127 PRK11595 DNA utilization prote  20.4      94   0.002   23.7   2.5   10   73-82      7-16  (227)
128 PF03854 zf-P11:  P-11 zinc fin  20.2   1E+02  0.0022   17.7   1.9   27  122-148    19-46  (50)

No 1  
>KOG1701|consensus
Probab=99.86  E-value=1.8e-23  Score=167.31  Aligned_cols=112  Identities=25%  Similarity=0.643  Sum_probs=94.8

Q ss_pred             CCCCcccCCCCCCccCCCCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceee-eCCcccCHhH
Q psy15163         52 SGNGVTHGPCGNKLTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFH-YKGNVYCLRD  130 (176)
Q Consensus        52 ~~~~~~~~~~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~-~~g~~yC~~~  130 (176)
                      .+..+||+.||..     +..+|..|++.|.  ++|+.|.    |+.||+.||+|..|++.|.+..|.+ .++++||-.|
T Consensus       320 v~~k~~CE~cyq~-----tlekC~~Cg~~I~--d~iLrA~----GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~d  388 (468)
T KOG1701|consen  320 VDGKPYCEGCYQD-----TLEKCNKCGEPIM--DRILRAL----GKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPD  388 (468)
T ss_pred             cCCcccchHHHHH-----HHHHHhhhhhHHH--HHHHHhc----ccccCCCceEEEEeccccCCccccccCCCceeeehh
Confidence            3444666666553     2348999999997  4566775    8899999999999999999988876 7889999999


Q ss_pred             HhhCCCcccccccccccccCc------eEEeCCCccccCCeecccCCcccC
Q psy15163        131 YATMLDIPRCHACDELIFVNE------YTLAENKTFHVKHFCCYECDKIIT  175 (176)
Q Consensus       131 y~~~~~~~~C~~C~~~I~~~~------~~~a~~~~~H~~CF~C~~C~~~l~  175 (176)
                      |+++|+ |+|+.|+++|+..+      .|.++++.||.+||+|..|+..|+
T Consensus       389 fh~kfA-PrCs~C~~PI~P~~G~~etvRvvamdr~fHv~CY~CEDCg~~LS  438 (468)
T KOG1701|consen  389 FHKKFA-PRCSVCGNPILPRDGKDETVRVVAMDRDFHVNCYKCEDCGLLLS  438 (468)
T ss_pred             hhhhcC-cchhhccCCccCCCCCcceEEEEEccccccccceehhhcCcccc
Confidence            999999 99999999998642      256999999999999999999987


No 2  
>KOG1701|consensus
Probab=99.85  E-value=1.4e-23  Score=167.94  Aligned_cols=97  Identities=31%  Similarity=0.658  Sum_probs=90.0

Q ss_pred             ccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhhCCCcccccccccccccCce
Q psy15163         73 TCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEY  152 (176)
Q Consensus        73 ~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~~~~~  152 (176)
                      +|.+|+|.|...+..+.|+    ++.||..||+|..|++.|.+..||..++++||+.||.+.+  .||..|+++|++ .|
T Consensus       276 iC~~C~K~V~g~~~ac~Am----~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tl--ekC~~Cg~~I~d-~i  348 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAVEAM----DQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTL--EKCNKCGEPIMD-RI  348 (468)
T ss_pred             hhhhcCCcccCcchHHHHh----hhhhcccceehHhhhhhhccccccccCCcccchHHHHHHH--HHHhhhhhHHHH-HH
Confidence            8999999999888878887    8899999999999999999999999999999999998775  599999999965 58


Q ss_pred             EEeCCCccccCCeecccCCcccCC
Q psy15163        153 TLAENKTFHVKHFCCYECDKIITQ  176 (176)
Q Consensus       153 ~~a~~~~~H~~CF~C~~C~~~l~~  176 (176)
                      ++|+|+.||+.||+|..|.+.|++
T Consensus       349 LrA~GkayHp~CF~Cv~C~r~ldg  372 (468)
T KOG1701|consen  349 LRALGKAYHPGCFTCVVCARCLDG  372 (468)
T ss_pred             HHhcccccCCCceEEEEeccccCC
Confidence            889999999999999999998864


No 3  
>KOG2272|consensus
Probab=99.84  E-value=1.5e-22  Score=152.43  Aligned_cols=115  Identities=26%  Similarity=0.614  Sum_probs=102.5

Q ss_pred             cCCCCCcccCCCCCCccCCCCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHh
Q psy15163         50 HGSGNGVTHGPCGNKLTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLR  129 (176)
Q Consensus        50 ~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~  129 (176)
                      +.-.+..||.+|.++++-+    +|+.|+++|.  +.++.++    |+.||.++|+|+.|.+|+-+...|++.|..||+.
T Consensus       178 Revk~eLyClrChD~mgip----iCgaC~rpIe--ervi~am----gKhWHveHFvCa~CekPFlGHrHYEkkGlaYCe~  247 (332)
T KOG2272|consen  178 REVKGELYCLRCHDKMGIP----ICGACRRPIE--ERVIFAM----GKHWHVEHFVCAKCEKPFLGHRHYEKKGLAYCET  247 (332)
T ss_pred             hhhccceeccccccccCCc----ccccccCchH--HHHHHHh----ccccchhheeehhcCCcccchhhhhhcCchhHHH
Confidence            3345568999999998877    9999999997  4555665    8899999999999999998889999999999999


Q ss_pred             HHhhCCCcccccccccccccCceEEeCCCccccCCeecccCCcccCC
Q psy15163        130 DYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIITQ  176 (176)
Q Consensus       130 ~y~~~~~~~~C~~C~~~I~~~~~~~a~~~~~H~~CF~C~~C~~~l~~  176 (176)
                      +|.++|+ ..|..|+..| ++++++|+++.|-++||.|+.|++.|.+
T Consensus       248 h~~qLfG-~~CF~C~~~i-~G~vv~al~KawCv~cf~Cs~Cdkkl~~  292 (332)
T KOG2272|consen  248 HYHQLFG-NLCFICNRVI-GGDVVSALNKAWCVECFSCSTCDKKLTQ  292 (332)
T ss_pred             HHHHHhh-hhheecCCcc-CccHHHHhhhhhcccccccccccccccc
Confidence            9999999 9999999999 5567789999999999999999998863


No 4  
>KOG2272|consensus
Probab=99.81  E-value=5.4e-22  Score=149.35  Aligned_cols=101  Identities=29%  Similarity=0.733  Sum_probs=93.0

Q ss_pred             CCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhhCCCccccccccccccc
Q psy15163         70 SGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFV  149 (176)
Q Consensus        70 ~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~~  149 (176)
                      ....|.+|...+.+.|.++...    +..||..||.|.+|-+|+.+..||..+|+.||+.+|..+|+ |.|..|++.|.+
T Consensus        11 ~~~~C~RC~~gF~~~e~~vns~----ge~wH~~CFvCAQCf~pf~~g~~~efEgRkYCEhDF~~Lfa-PcC~kC~EFiiG   85 (332)
T KOG2272|consen   11 ANMVCERCRDGFEPAEKIVNSN----GELWHEQCFVCAQCFRPFPDGIFYEFEGRKYCEHDFHVLFA-PCCGKCGEFIIG   85 (332)
T ss_pred             HHHHHHHHhccCCchhhhhccC----chhhHHHHHHHHHhcCcCCCceeEEecCcccccccchhhhc-hhhcccccchhh
Confidence            3458999999999899888776    88999999999999999999999999999999999999999 999999999987


Q ss_pred             CceEEeCCCccccCCeecccCCcccCC
Q psy15163        150 NEYTLAENKTFHVKHFCCYECDKIITQ  176 (176)
Q Consensus       150 ~~~~~a~~~~~H~~CF~C~~C~~~l~~  176 (176)
                      + +|.|++.+|||.||+|..|.+.|.+
T Consensus        86 r-VikamnnSwHp~CF~Cd~Cn~~Lad  111 (332)
T KOG2272|consen   86 R-VIKAMNNSWHPACFRCDLCNKHLAD  111 (332)
T ss_pred             H-HHHhhccccCcccchhHHHHHHHhh
Confidence            6 5669999999999999999998864


No 5  
>KOG4577|consensus
Probab=99.76  E-value=5.5e-21  Score=146.31  Aligned_cols=99  Identities=27%  Similarity=0.680  Sum_probs=88.7

Q ss_pred             CCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhhCCCccccccccccccc
Q psy15163         70 SGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFV  149 (176)
Q Consensus        70 ~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~~  149 (176)
                      +.+.|+.|++.|. ..+|..+.    ++.||..|++|+.|+.+|.. .+|.+++.+||+.+|.++|+ .||..|...|.+
T Consensus        32 eip~CagC~q~Il-DrFilKvl----~R~wHs~CLkCs~C~~qL~d-rCFsR~~s~yCkedFfKrfG-TKCsaC~~GIpP  104 (383)
T KOG4577|consen   32 EIPICAGCDQHIL-DRFILKVL----DRHWHSSCLKCSDCHDQLAD-RCFSREGSVYCKEDFFKRFG-TKCSACQEGIPP  104 (383)
T ss_pred             ccccccchHHHHH-HHHHHHHH----hhhhhhhhcchhhhhhHHHH-HHhhcCCceeehHHHHHHhC-CcchhhcCCCCh
Confidence            4459999999998 45665665    88999999999999999987 68899999999999999999 999999999987


Q ss_pred             CceE-EeCCCccccCCeecccCCcccC
Q psy15163        150 NEYT-LAENKTFHVKHFCCYECDKIIT  175 (176)
Q Consensus       150 ~~~~-~a~~~~~H~~CF~C~~C~~~l~  175 (176)
                      ..++ .|.+.+||.+||.|..|+.+|.
T Consensus       105 tqVVRkAqd~VYHl~CF~C~iC~R~L~  131 (383)
T KOG4577|consen  105 TQVVRKAQDFVYHLHCFACFICKRQLA  131 (383)
T ss_pred             HHHHHHhhcceeehhhhhhHhhhcccc
Confidence            6665 5999999999999999999885


No 6  
>KOG1044|consensus
Probab=99.76  E-value=2.5e-19  Score=148.21  Aligned_cols=119  Identities=26%  Similarity=0.625  Sum_probs=99.5

Q ss_pred             cCCCCCcccCCCCCCccCC----CCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcc
Q psy15163         50 HGSGNGVTHGPCGNKLTQP----RSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNV  125 (176)
Q Consensus        50 ~~~~~~~~~~~~~~~~~~~----~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~  125 (176)
                      +..+..+.|..|...+...    .+...|++|++.|..++.++++     ++.||..||+|..|...|.+ .|..++|.+
T Consensus       108 t~~gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk~gq~llal-----d~qwhv~cfkc~~c~~vL~g-ey~skdg~p  181 (670)
T KOG1044|consen  108 TFSGKECLCQTCSQPMPVSPAESYGPSTCAGCGEELKNGQALLAL-----DKQWHVSCFKCKSCSAVLNG-EYMSKDGVP  181 (670)
T ss_pred             eecchhhhhhhhcCcccCCcccccCCccccchhhhhhccceeeee-----ccceeeeeeehhhhcccccc-eeeccCCCc
Confidence            3344445666665433221    2456899999999999888777     88999999999999999977 689999999


Q ss_pred             cCHhHHhhCCCcccccccccccccCceEEeCCCccccCCeecccCCcccCC
Q psy15163        126 YCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIITQ  176 (176)
Q Consensus       126 yC~~~y~~~~~~~~C~~C~~~I~~~~~~~a~~~~~H~~CF~C~~C~~~l~~  176 (176)
                      ||+.||.+.|+ -+|..|.+.|.+ .+++|.++.|||.|-+|+.|+.+|++
T Consensus       182 yce~dy~~~fg-vkc~~c~~fisg-kvLqag~kh~HPtCARCsRCgqmF~e  230 (670)
T KOG1044|consen  182 YCEKDYQAKFG-VKCEECEKFISG-KVLQAGDKHFHPTCARCSRCGQMFGE  230 (670)
T ss_pred             chhhhhhhhcC-eehHHhhhhhhh-hhhhccCcccCcchhhhhhhcccccc
Confidence            99999999999 899999999965 46779999999999999999998863


No 7  
>KOG1703|consensus
Probab=99.69  E-value=2.5e-18  Score=144.87  Aligned_cols=111  Identities=27%  Similarity=0.639  Sum_probs=95.1

Q ss_pred             CCcccCCCCCCccCCCCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhh
Q psy15163         54 NGVTHGPCGNKLTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYAT  133 (176)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~  133 (176)
                      +..+|..|+.+...+    .|.+|+++|. ++.+ .+.    +..||++||.|..|.++|.+..|+..++.+||+.||.+
T Consensus       350 g~~~c~~~~~~~~~p----~C~~C~~~i~-~~~v-~a~----~~~wH~~cf~C~~C~~~~~~~~~~~~~~~pyce~~~~~  419 (479)
T KOG1703|consen  350 GKILCHECFHAPFRP----NCKRCLLPIL-EEGV-CAL----GRLWHPECFVCADCGKPLKNSSFFESDGEPYCEDHYKK  419 (479)
T ss_pred             CCccHHHHHHHhhCc----cccccCCchH-HhHh-hhc----cCeechhceeeecccCCCCCCcccccCCccchhhhHhh
Confidence            334566666666555    9999999998 4555 554    88999999999999999999999999999999999999


Q ss_pred             CCCccccccccccccc-CceEEeCCCccccCCeecccCCcccC
Q psy15163        134 MLDIPRCHACDELIFV-NEYTLAENKTFHVKHFCCYECDKIIT  175 (176)
Q Consensus       134 ~~~~~~C~~C~~~I~~-~~~~~a~~~~~H~~CF~C~~C~~~l~  175 (176)
                      ++. ++|..|.++|+. ...+.+++..||.+||+|+.|.+.|.
T Consensus       420 ~~~-~~~~~~~~p~~~~~~~ie~~~~~~h~~~F~c~~c~~~l~  461 (479)
T KOG1703|consen  420 LFT-TKCDYCKKPVEFGSRQIEADGSPFHGDCFRCANCMKKLT  461 (479)
T ss_pred             hcc-ccchhccchhHhhhhHhhccCccccccceehhhhhcccc
Confidence            999 999999999863 34577999999999999999998876


No 8  
>KOG1703|consensus
Probab=99.58  E-value=8e-16  Score=129.79  Aligned_cols=98  Identities=26%  Similarity=0.560  Sum_probs=87.0

Q ss_pred             cccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhhCCCcccccccccccccCc
Q psy15163         72 KTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNE  151 (176)
Q Consensus        72 ~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~~~~  151 (176)
                      +.|..|++.|.....+ .++    ++.||+.+|.|..|...+....+...+|++||..||...+. +.|.+|+.+|.+ .
T Consensus       304 p~c~~c~~~i~~~~~i-~~~----~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~-p~C~~C~~~i~~-~  376 (479)
T KOG1703|consen  304 PLCLSCNQKIRSVKVI-VAL----GKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFR-PNCKRCLLPILE-E  376 (479)
T ss_pred             ccccccccCcccceeE-eec----cccccccceeeccccccccCCCccccCCCccHHHHHHHhhC-ccccccCCchHH-h
Confidence            6999999999843444 554    88999999999999999988888889999999999999999 999999999976 4


Q ss_pred             eEEeCCCccccCCeecccCCcccCC
Q psy15163        152 YTLAENKTFHVKHFCCYECDKIITQ  176 (176)
Q Consensus       152 ~~~a~~~~~H~~CF~C~~C~~~l~~  176 (176)
                      +|.|+++.||++||+|..|+++|.+
T Consensus       377 ~v~a~~~~wH~~cf~C~~C~~~~~~  401 (479)
T KOG1703|consen  377 GVCALGRLWHPECFVCADCGKPLKN  401 (479)
T ss_pred             HhhhccCeechhceeeecccCCCCC
Confidence            6668899999999999999988764


No 9  
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.56  E-value=3.6e-15  Score=90.61  Aligned_cols=58  Identities=29%  Similarity=0.820  Sum_probs=52.8

Q ss_pred             cccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhhCC
Q psy15163         74 CKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATML  135 (176)
Q Consensus        74 C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~  135 (176)
                      |.+|+++|.+++.++.+.    ++.||++||+|..|+++|.+..++..++++||+.||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~----~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAM----GKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEET----TEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeC----CcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            789999999888776676    8899999999999999998888999999999999998865


No 10 
>KOG1044|consensus
Probab=99.23  E-value=7.1e-12  Score=104.50  Aligned_cols=86  Identities=23%  Similarity=0.542  Sum_probs=72.6

Q ss_pred             cccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhhCCCcccccccccccccCc
Q psy15163         72 KTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNE  151 (176)
Q Consensus        72 ~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~~~~  151 (176)
                      ..|..|.+.-. ++++...     ++.||..||.|..|+..|....||.+++.        ++++ +  ..|.+.|.+ +
T Consensus        17 i~c~~c~~kc~-gevlrv~-----d~~fhi~cf~c~~cg~~la~~gff~k~~~--------~~yg-t--~~c~~~~~g-e   78 (670)
T KOG1044|consen   17 IKCDKCRKKCS-GEVLRVN-----DNHFHINCFQCKKCGRNLAEGGFFTKPEN--------RLYG-T--DDCRAFVEG-E   78 (670)
T ss_pred             eehhhhCCccc-cceeEee-----ccccceeeeeccccCCCcccccceecccc--------eeec-c--cchhhhccc-e
Confidence            48999999988 7766555     88999999999999999999899987665        4444 4  678888854 5


Q ss_pred             eEEeCCCccccCCeecccCCcccC
Q psy15163        152 YTLAENKTFHVKHFCCYECDKIIT  175 (176)
Q Consensus       152 ~~~a~~~~~H~~CF~C~~C~~~l~  175 (176)
                      ++.++++.||++||.|+.|+.++.
T Consensus        79 vvsa~gktyh~~cf~cs~ck~pf~  102 (670)
T KOG1044|consen   79 VVSTLGKTYHPKCFSCSTCKSPFK  102 (670)
T ss_pred             eEecccceeccccceecccCCCCC
Confidence            778999999999999999999874


No 11 
>KOG1700|consensus
Probab=99.21  E-value=1.7e-12  Score=97.74  Aligned_cols=99  Identities=24%  Similarity=0.551  Sum_probs=83.4

Q ss_pred             CcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhhCC---------------
Q psy15163         71 GKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATML---------------  135 (176)
Q Consensus        71 ~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~---------------  135 (176)
                      ...|..|++.++..+.+. .+    +..||+.||.|..|...|....+..+++.+||+.+|...+               
T Consensus         7 ~~kc~~c~k~vy~~e~~~-~~----g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~   81 (200)
T KOG1700|consen    7 TDKCNACGKTVYFVEKVQ-KD----GVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAG   81 (200)
T ss_pred             cchhhhccCcchHHHHHh-cc----CcchhhhHHhccccccccccccccccccccccccchHhhhCcccccccccccccC
Confidence            348999999999877765 43    8899999999999999999888999999999999654443               


Q ss_pred             --------------------------CcccccccccccccCceEEeCCCccccCCeecccCCcccC
Q psy15163        136 --------------------------DIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIIT  175 (176)
Q Consensus       136 --------------------------~~~~C~~C~~~I~~~~~~~a~~~~~H~~CF~C~~C~~~l~  175 (176)
                                                . ..|..|++.+.+-+-+...+..||..||+|..|+..|+
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~g~~-~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls  146 (200)
T KOG1700|consen   82 GLGKDGKSLNESKPNQSAKFQVFAGEK-EKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLS  146 (200)
T ss_pred             CCCcccccccccccccchhHHhhhccc-cccccccceeeehHHHhhhhhhhhhhheeecccccccC
Confidence                                      3 47888888887655556789999999999999999886


No 12 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.97  E-value=3.6e-10  Score=62.55  Aligned_cols=38  Identities=26%  Similarity=0.472  Sum_probs=33.6

Q ss_pred             cccccccccccC-ceEEeCCCccccCCeecccCCcccCC
Q psy15163        139 RCHACDELIFVN-EYTLAENKTFHVKHFCCYECDKIITQ  176 (176)
Q Consensus       139 ~C~~C~~~I~~~-~~~~a~~~~~H~~CF~C~~C~~~l~~  176 (176)
                      +|..|+++|.+. .++.+.++.||++||+|..|+.+|.+
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~   39 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLGG   39 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCcc
Confidence            589999999876 56678999999999999999999864


No 13 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=98.92  E-value=7e-10  Score=67.05  Aligned_cols=37  Identities=30%  Similarity=0.618  Sum_probs=33.3

Q ss_pred             ccccccccccCceE-EeCCCccccCCeecccCCcccCC
Q psy15163        140 CHACDELIFVNEYT-LAENKTFHVKHFCCYECDKIITQ  176 (176)
Q Consensus       140 C~~C~~~I~~~~~~-~a~~~~~H~~CF~C~~C~~~l~~  176 (176)
                      |..|+++|.+++++ .++++.||++||+|..|+++|.+
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~   38 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLND   38 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCC
Confidence            78999999877765 69999999999999999999864


No 14 
>KOG4577|consensus
Probab=98.68  E-value=1.7e-09  Score=83.60  Aligned_cols=77  Identities=18%  Similarity=0.380  Sum_probs=62.9

Q ss_pred             CCCCcccCCCCCCccCCCCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCcccc-CCCceee-eCCcccCHh
Q psy15163         52 SGNGVTHGPCGNKLTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELL-VDLMYFH-YKGNVYCLR  129 (176)
Q Consensus        52 ~~~~~~~~~~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l-~~~~~~~-~~g~~yC~~  129 (176)
                      .++++||...+-+-+..    +|..|...|.+.+.|..|.    +..||..||.|..|+++| .+..||. .++++.|+.
T Consensus        77 R~~s~yCkedFfKrfGT----KCsaC~~GIpPtqVVRkAq----d~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~  148 (383)
T KOG4577|consen   77 REGSVYCKEDFFKRFGT----KCSACQEGIPPTQVVRKAQ----DFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKD  148 (383)
T ss_pred             cCCceeehHHHHHHhCC----cchhhcCCCChHHHHHHhh----cceeehhhhhhHhhhcccccCCeeEEeccceeehhh
Confidence            45668887776655554    9999999999988887776    889999999999999999 4456765 788999999


Q ss_pred             HHhhCCC
Q psy15163        130 DYATMLD  136 (176)
Q Consensus       130 ~y~~~~~  136 (176)
                      +|++.-.
T Consensus       149 DYE~Ak~  155 (383)
T KOG4577|consen  149 DYETAKQ  155 (383)
T ss_pred             hHHHHHh
Confidence            9986433


No 15 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.66  E-value=2.1e-08  Score=55.28  Aligned_cols=38  Identities=39%  Similarity=1.044  Sum_probs=31.7

Q ss_pred             ccccccccccCCCeEEEEeccCCCcccCccCcccccCccccC
Q psy15163         73 TCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLV  114 (176)
Q Consensus        73 ~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~  114 (176)
                      +|..|+++|.+.+.++.+.    ++.||++||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~----~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRAL----GKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeC----CccccccCCCCcccCCcCc
Confidence            4889999998664555554    8899999999999999885


No 16 
>KOG1700|consensus
Probab=97.98  E-value=1.3e-06  Score=65.95  Aligned_cols=63  Identities=22%  Similarity=0.566  Sum_probs=55.3

Q ss_pred             CCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhhCCC
Q psy15163         69 RSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLD  136 (176)
Q Consensus        69 ~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~  136 (176)
                      .+...|..|.+.+++.+.+...     +..||..||+|..|+..|....+...++.+||..++.+++-
T Consensus       106 g~~~~c~~c~k~vy~~Ek~~~~-----~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~~~~~~  168 (200)
T KOG1700|consen  106 GEKEKCARCQKTVYPLEKVTGN-----GLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHFAQLFK  168 (200)
T ss_pred             ccccccccccceeeehHHHhhh-----hhhhhhhheeecccccccCCcchhhcCCccccchhhheeec
Confidence            4556899999999988887655     88999999999999999999999999999999988877654


No 17 
>KOG1702|consensus
Probab=97.58  E-value=3.9e-06  Score=62.33  Aligned_cols=59  Identities=27%  Similarity=0.585  Sum_probs=51.3

Q ss_pred             ccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhhCCC
Q psy15163         73 TCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLD  136 (176)
Q Consensus        73 ~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~  136 (176)
                      .|..|++.+++.|.+...     ++.||..||+|..|+.+|.-.++-..+.++||..+|....+
T Consensus         6 n~~~cgk~vYPvE~v~cl-----dk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq~a   64 (264)
T KOG1702|consen    6 NREDCGKTVYPVEEVKCL-----DKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQVA   64 (264)
T ss_pred             hhhhhccccccHHHHhhH-----HHHHHHHhheeeeccCChhhhhccccccCCCcCccccccee
Confidence            688899999988887666     88999999999999999987777778999999999976554


No 18 
>KOG0490|consensus
Probab=97.49  E-value=7.6e-06  Score=62.78  Aligned_cols=76  Identities=33%  Similarity=0.750  Sum_probs=63.0

Q ss_pred             CcccCccCcccccCccccC--CCceeeeCCcccCHhHHhh--CCCcccccccccccccCc-eEEeCCCccccCCeecccC
Q psy15163         96 QVLWHPQCFVCSTCDELLV--DLMYFHYKGNVYCLRDYAT--MLDIPRCHACDELIFVNE-YTLAENKTFHVKHFCCYEC  170 (176)
Q Consensus        96 ~~~~H~~Cf~C~~C~~~l~--~~~~~~~~g~~yC~~~y~~--~~~~~~C~~C~~~I~~~~-~~~a~~~~~H~~CF~C~~C  170 (176)
                      +..||..|..|..|...|.  ...|.. +|..||..+|..  .+. .+|.+|...|..-+ +..+..++ |.-||.|.+|
T Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~~d~~~~~~~~-~rr~rt~~~~~ql~~ler~f~~~-h~Pd~~~r~~   92 (235)
T KOG0490|consen   16 DRYWHASCLKCAECDNPLGVGDTCFSK-DGSIYCKRDYQREFKFS-KRCARCKFTISQLDELERAFEKV-HLPCFACREC   92 (235)
T ss_pred             cHHHHHHHHhhhhhcchhccCCCcccC-CCcccccccchhhhhcc-ccccCCCCCcCHHHHHHHhhcCC-CcCccchHHH
Confidence            6789999999999999997  444445 999999999998  777 89999999996544 44577777 9999999998


Q ss_pred             Cccc
Q psy15163        171 DKII  174 (176)
Q Consensus       171 ~~~l  174 (176)
                      ...+
T Consensus        93 la~~   96 (235)
T KOG0490|consen   93 LALL   96 (235)
T ss_pred             Hhhc
Confidence            7654


No 19 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=91.34  E-value=0.14  Score=30.16  Aligned_cols=37  Identities=14%  Similarity=0.434  Sum_probs=27.1

Q ss_pred             ccccccccccc-cCceEE--eCCCccccCCe----eccc--CCccc
Q psy15163        138 PRCHACDELIF-VNEYTL--AENKTFHVKHF----CCYE--CDKII  174 (176)
Q Consensus       138 ~~C~~C~~~I~-~~~~~~--a~~~~~H~~CF----~C~~--C~~~l  174 (176)
                      .+|..|++.|. +++++.  .=+..||.+|+    .|..  |+..+
T Consensus         6 ~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~~~~g~C~~~~c~~~~   51 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDDIVVCPECGAPYHRDCWEKAGGCINYSCGTGF   51 (54)
T ss_pred             ccChhhCCcccCCCCEEECCCCCCcccHHHHhhCCceEeccCCCCc
Confidence            78999999996 345553  56888999998    4766  66554


No 20 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=90.93  E-value=0.16  Score=29.94  Aligned_cols=31  Identities=26%  Similarity=0.649  Sum_probs=20.7

Q ss_pred             cccccccccccCCCeEEEEeccCCCcccCccCc
Q psy15163         72 KTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCF  104 (176)
Q Consensus        72 ~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf  104 (176)
                      .+|..|+++|.+++-++.--..  +..||++|.
T Consensus         6 ~~C~~Cg~~~~~~dDiVvCp~C--gapyHR~C~   36 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDDIVVCPEC--GAPYHRDCW   36 (54)
T ss_pred             ccChhhCCcccCCCCEEECCCC--CCcccHHHH
Confidence            4899999999633334333334  458888887


No 21 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=89.03  E-value=0.17  Score=27.41  Aligned_cols=32  Identities=28%  Similarity=0.580  Sum_probs=23.1

Q ss_pred             ccccccccccCceE-EeCCCccccCCeecccCCccc
Q psy15163        140 CHACDELIFVNEYT-LAENKTFHVKHFCCYECDKII  174 (176)
Q Consensus       140 C~~C~~~I~~~~~~-~a~~~~~H~~CF~C~~C~~~l  174 (176)
                      |..|++.|.+++++ ...++.||   |.|..|...|
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~---fCC~tC~~~f   33 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYY---FCCPTCLSQF   33 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEE---EECHHHHHHH
Confidence            77899999887764 57888887   5555555443


No 22 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=85.59  E-value=0.58  Score=31.09  Aligned_cols=29  Identities=21%  Similarity=0.553  Sum_probs=21.1

Q ss_pred             cccccccccccCCCeEEEEeccCCCcccCccCc
Q psy15163         72 KTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCF  104 (176)
Q Consensus        72 ~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf  104 (176)
                      ..|..|+++|....+++...    |..+|..|+
T Consensus        79 ~~C~vC~k~l~~~~f~~~p~----~~v~H~~C~  107 (109)
T PF10367_consen   79 TKCSVCGKPLGNSVFVVFPC----GHVVHYSCI  107 (109)
T ss_pred             CCccCcCCcCCCceEEEeCC----CeEEecccc
Confidence            47999999998665555543    666787775


No 23 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=85.54  E-value=0.31  Score=32.53  Aligned_cols=31  Identities=29%  Similarity=0.621  Sum_probs=23.8

Q ss_pred             ccccccccccCCCeEEEEeccCCCcccCccCcccc
Q psy15163         73 TCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCS  107 (176)
Q Consensus        73 ~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~  107 (176)
                      .|..|+++|+.++......    +..-|.+||+=.
T Consensus         4 kC~iCg~~I~~gqlFTF~~----kG~VH~~C~~~~   34 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTK----KGPVHYECFREK   34 (101)
T ss_pred             EEEecCCeeeecceEEEec----CCcEeHHHHHHH
Confidence            7999999999888764443    557899998744


No 24 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=85.23  E-value=0.25  Score=33.00  Aligned_cols=28  Identities=18%  Similarity=0.502  Sum_probs=22.0

Q ss_pred             cccccccccccCceE-EeCCCccccCCee
Q psy15163        139 RCHACDELIFVNEYT-LAENKTFHVKHFC  166 (176)
Q Consensus       139 ~C~~C~~~I~~~~~~-~a~~~~~H~~CF~  166 (176)
                      +|..|+++|..++.. ...+..-|-+||+
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~   32 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFR   32 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHH
Confidence            799999999877654 3556788888885


No 25 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=80.09  E-value=1.6  Score=26.69  Aligned_cols=48  Identities=15%  Similarity=0.472  Sum_probs=21.0

Q ss_pred             cccccCccccCCCceeeeCCcccCHhHHhhCCCcccccccccccccCce
Q psy15163        104 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEY  152 (176)
Q Consensus       104 f~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~~~~~  152 (176)
                      ++|+.|..-|...-....=+..||..|-.+.++ ..|..|+.|--..++
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~-~~CPvC~~Paw~qD~   55 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIG-SECPVCHTPAWIQDI   55 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTT-TB-SSS--B-S-SS-
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcC-CCCCCcCChHHHHHH
Confidence            456666666544222334456778888877888 789999987754443


No 26 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=79.91  E-value=1.1  Score=29.66  Aligned_cols=28  Identities=11%  Similarity=0.348  Sum_probs=14.9

Q ss_pred             ccccccccccccCceEE-eCCCccccCCe
Q psy15163        138 PRCHACDELIFVNEYTL-AENKTFHVKHF  165 (176)
Q Consensus       138 ~~C~~C~~~I~~~~~~~-a~~~~~H~~CF  165 (176)
                      ..|..|+++|....++. -.+..+|-.|+
T Consensus        79 ~~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   79 TKCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CCccCcCCcCCCceEEEeCCCeEEecccc
Confidence            46677777764443332 33455565554


No 27 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=79.84  E-value=1.4  Score=26.16  Aligned_cols=48  Identities=17%  Similarity=0.222  Sum_probs=34.1

Q ss_pred             cccccCccccCCCceeeeCCcccCHhHHhhCC--CcccccccccccccCceE
Q psy15163        104 FVCSTCDELLVDLMYFHYKGNVYCLRDYATML--DIPRCHACDELIFVNEYT  153 (176)
Q Consensus       104 f~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~--~~~~C~~C~~~I~~~~~~  153 (176)
                      |.|..|...+.. ......|..||+.+..+.+  . ..|..|++++....++
T Consensus         2 ~~Cpi~~~~~~~-Pv~~~~G~v~~~~~i~~~~~~~-~~cP~~~~~~~~~~l~   51 (63)
T smart00504        2 FLCPISLEVMKD-PVILPSGQTYERRAIEKWLLSH-GTDPVTGQPLTHEDLI   51 (63)
T ss_pred             cCCcCCCCcCCC-CEECCCCCEEeHHHHHHHHHHC-CCCCCCcCCCChhhce
Confidence            567888887765 4556778999988876433  3 5799999888554444


No 28 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=79.18  E-value=1.3  Score=29.04  Aligned_cols=43  Identities=21%  Similarity=0.438  Sum_probs=29.6

Q ss_pred             ccCccCcccccCccccCCCceeeeCCcccCHhHHhhCCCccccccccccccc
Q psy15163         98 LWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFV  149 (176)
Q Consensus        98 ~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~~  149 (176)
                      .|-+.--.|..|...+..      .|.-||..|..+.   -+|+-|++.|.+
T Consensus        39 Py~~~~~~C~~CK~~v~q------~g~~YCq~CAYkk---GiCamCGKki~d   81 (90)
T PF10235_consen   39 PYAPYSSKCKICKTKVHQ------PGAKYCQTCAYKK---GICAMCGKKILD   81 (90)
T ss_pred             cccccCcccccccccccc------CCCccChhhhccc---CcccccCCeecc
Confidence            344433467777766543      3567899997664   589999999964


No 29 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=77.02  E-value=1.4  Score=21.09  Aligned_cols=9  Identities=33%  Similarity=0.704  Sum_probs=5.1

Q ss_pred             ccccccccc
Q psy15163        140 CHACDELIF  148 (176)
Q Consensus       140 C~~C~~~I~  148 (176)
                      |..|+..|.
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            555666653


No 30 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=76.72  E-value=3.1  Score=23.67  Aligned_cols=42  Identities=21%  Similarity=0.428  Sum_probs=26.3

Q ss_pred             ccccCccccCCCceeeeCCcc-cCHhHHhhC--CCcccccccccccc
Q psy15163        105 VCSTCDELLVDLMYFHYKGNV-YCLRDYATM--LDIPRCHACDELIF  148 (176)
Q Consensus       105 ~C~~C~~~l~~~~~~~~~g~~-yC~~~y~~~--~~~~~C~~C~~~I~  148 (176)
                      .|..|...... ..+..=|.. +|..|+.+.  .. .+|..|+++|.
T Consensus         4 ~C~iC~~~~~~-~~~~pCgH~~~C~~C~~~~~~~~-~~CP~Cr~~i~   48 (50)
T PF13920_consen    4 ECPICFENPRD-VVLLPCGHLCFCEECAERLLKRK-KKCPICRQPIE   48 (50)
T ss_dssp             B-TTTSSSBSS-EEEETTCEEEEEHHHHHHHHHTT-SBBTTTTBB-S
T ss_pred             CCccCCccCCc-eEEeCCCChHHHHHHhHHhcccC-CCCCcCChhhc
Confidence            45555555443 334455666 888888765  34 79999999984


No 31 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=75.68  E-value=1.4  Score=31.79  Aligned_cols=49  Identities=16%  Similarity=0.354  Sum_probs=34.5

Q ss_pred             CcccCHhHHhhCCCcccccccccccccCceE---EeCCCccccCCeecccCCccc
Q psy15163        123 GNVYCLRDYATMLDIPRCHACDELIFVNEYT---LAENKTFHVKHFCCYECDKII  174 (176)
Q Consensus       123 g~~yC~~~y~~~~~~~~C~~C~~~I~~~~~~---~a~~~~~H~~CF~C~~C~~~l  174 (176)
                      .+-||..|-.+...  .|..|+-+|.+.-++   ...+..|++-= -|..|++++
T Consensus        27 ~~~fC~kCG~~tI~--~Cp~C~~~IrG~y~v~gv~~~g~~~~~Ps-YC~~CGkpy   78 (158)
T PF10083_consen   27 REKFCSKCGAKTIT--SCPNCSTPIRGDYHVEGVFGLGGHYEAPS-YCHNCGKPY   78 (158)
T ss_pred             HHHHHHHhhHHHHH--HCcCCCCCCCCceecCCeeeeCCCCCCCh-hHHhCCCCC
Confidence            35689999887764  999999999765322   34567777433 378888875


No 32 
>KOG1813|consensus
Probab=74.65  E-value=1.7  Score=34.68  Aligned_cols=46  Identities=15%  Similarity=0.311  Sum_probs=36.6

Q ss_pred             CcccccCccccCCCceeeeCCcccCHhHHhhCCCc-cccccccccccc
Q psy15163        103 CFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDI-PRCHACDELIFV  149 (176)
Q Consensus       103 Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~-~~C~~C~~~I~~  149 (176)
                      =|.|..|.+.+.. .....-+..+|+.|....|.. ++|..|++.+.+
T Consensus       241 Pf~c~icr~~f~~-pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g  287 (313)
T KOG1813|consen  241 PFKCFICRKYFYR-PVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHG  287 (313)
T ss_pred             Ccccccccccccc-chhhcCCceeehhhhccccccCCcceeccccccc
Confidence            3788899888855 455567788999999887754 799999999965


No 33 
>KOG0320|consensus
Probab=73.99  E-value=1.3  Score=32.73  Aligned_cols=53  Identities=17%  Similarity=0.439  Sum_probs=38.3

Q ss_pred             CccCcccccCccccCCCc-eeeeCCcccCHhHHhhCCCc-ccccccccccccCce
Q psy15163        100 HPQCFVCSTCDELLVDLM-YFHYKGNVYCLRDYATMLDI-PRCHACDELIFVNEY  152 (176)
Q Consensus       100 H~~Cf~C~~C~~~l~~~~-~~~~~g~~yC~~~y~~~~~~-~~C~~C~~~I~~~~~  152 (176)
                      -..+|+|-.|-....... +..+=|.+||+.|-.+.... .+|..|++.|....+
T Consensus       128 ~~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~k~~  182 (187)
T KOG0320|consen  128 KEGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITHKQF  182 (187)
T ss_pred             cccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccchhhh
Confidence            446788888877775543 45688999999998764321 699999998854433


No 34 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=73.56  E-value=4.9  Score=24.10  Aligned_cols=14  Identities=29%  Similarity=0.850  Sum_probs=10.4

Q ss_pred             cccccccccccCCC
Q psy15163         72 KTCKQCGQEVRSGD   85 (176)
Q Consensus        72 ~~C~~C~~~i~~~~   85 (176)
                      ..|..|+..|.+.+
T Consensus         8 ~~CtSCg~~i~~~~   21 (59)
T PRK14890          8 PKCTSCGIEIAPRE   21 (59)
T ss_pred             ccccCCCCcccCCC
Confidence            37888888887554


No 35 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=71.23  E-value=1.4  Score=28.97  Aligned_cols=29  Identities=17%  Similarity=0.399  Sum_probs=21.0

Q ss_pred             ccccccccccccCce-EEeCCCccccCCee
Q psy15163        138 PRCHACDELIFVNEY-TLAENKTFHVKHFC  166 (176)
Q Consensus       138 ~~C~~C~~~I~~~~~-~~a~~~~~H~~CF~  166 (176)
                      -+|..|+++|..++. +-.....-|-+||.
T Consensus         7 wkC~VCg~~iieGqkFTF~~kGsVH~eCl~   36 (103)
T COG4847           7 WKCYVCGGTIIEGQKFTFTKKGSVHYECLA   36 (103)
T ss_pred             eeEeeeCCEeeeccEEEEeeCCcchHHHHH
Confidence            479999998876654 33557778888875


No 36 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=70.59  E-value=1.5  Score=33.01  Aligned_cols=49  Identities=14%  Similarity=0.316  Sum_probs=37.5

Q ss_pred             ccCcccccCccccCCCceeeeCCcccCHhHHhhCCCc-ccccccccccccC
Q psy15163        101 PQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDI-PRCHACDELIFVN  150 (176)
Q Consensus       101 ~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~-~~C~~C~~~I~~~  150 (176)
                      ..=|.|..|.+-... .....-|..||..|+.+.+.. +.|..|++...+.
T Consensus       194 ~IPF~C~iCKkdy~s-pvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G~  243 (259)
T COG5152         194 KIPFLCGICKKDYES-PVVTECGHSFCSLCAIRKYQKGDECGVCGKATYGR  243 (259)
T ss_pred             CCceeehhchhhccc-hhhhhcchhHHHHHHHHHhccCCcceecchhhccc
Confidence            345899999887755 455567888999999877633 8999999887654


No 37 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=69.28  E-value=2.2  Score=27.10  Aligned_cols=17  Identities=29%  Similarity=0.880  Sum_probs=12.8

Q ss_pred             cccccccccccCCCeEE
Q psy15163         72 KTCKQCGQEVRSGDLAV   88 (176)
Q Consensus        72 ~~C~~C~~~i~~~~~~~   88 (176)
                      ..|..|++.|..++.-+
T Consensus         8 a~Ck~C~~~I~kg~lRi   24 (82)
T PF00645_consen    8 AKCKGCKKKIAKGELRI   24 (82)
T ss_dssp             EBETTTSCBE-TTSEEE
T ss_pred             ccCcccCCcCCCCCEEE
Confidence            48999999998777643


No 38 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=67.00  E-value=8  Score=34.70  Aligned_cols=85  Identities=22%  Similarity=0.503  Sum_probs=55.6

Q ss_pred             CCCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHh-hCCCcccccccccc
Q psy15163         68 PRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYA-TMLDIPRCHACDEL  146 (176)
Q Consensus        68 ~~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~-~~~~~~~C~~C~~~  146 (176)
                      ++....|..|.+.|.+..          ++.||--=-.|+.|+..+     -+.+.-||=..... ..|  +-|..|.+ 
T Consensus        98 ~pD~a~C~~Cl~Ei~dp~----------~rrY~YPF~~CT~CGPRf-----TIi~alPYDR~nTsM~~F--~lC~~C~~-  159 (750)
T COG0068          98 PPDAATCEDCLEEIFDPN----------SRRYLYPFINCTNCGPRF-----TIIEALPYDRENTSMADF--PLCPFCDK-  159 (750)
T ss_pred             CCchhhhHHHHHHhcCCC----------CcceeccccccCCCCcce-----eeeccCCCCcccCccccC--cCCHHHHH-
Confidence            456679999999997421          445665556788887654     34444454332221 222  67888875 


Q ss_pred             cccCceEEeCCCccccCCeecccCCccc
Q psy15163        147 IFVNEYTLAENKTFHVKHFCCYECDKII  174 (176)
Q Consensus       147 I~~~~~~~a~~~~~H~~CF~C~~C~~~l  174 (176)
                          +|....++.||.+=..|..|+-.+
T Consensus       160 ----EY~dP~nRRfHAQp~aCp~CGP~~  183 (750)
T COG0068         160 ----EYKDPLNRRFHAQPIACPKCGPHL  183 (750)
T ss_pred             ----HhcCccccccccccccCcccCCCe
Confidence                234457999999999999998754


No 39 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=66.99  E-value=8.2  Score=28.98  Aligned_cols=16  Identities=19%  Similarity=0.563  Sum_probs=12.6

Q ss_pred             ccccccccccccCceE
Q psy15163        138 PRCHACDELIFVNEYT  153 (176)
Q Consensus       138 ~~C~~C~~~I~~~~~~  153 (176)
                      ++|..|...|....++
T Consensus        69 ~~CPvCR~~Is~~~Lv   84 (193)
T PLN03208         69 PKCPVCKSDVSEATLV   84 (193)
T ss_pred             CcCCCCCCcCChhcEE
Confidence            6899999999765554


No 40 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=66.25  E-value=3.1  Score=22.28  Aligned_cols=23  Identities=26%  Similarity=0.603  Sum_probs=15.4

Q ss_pred             ccccCccccCCCceeeeCCcccCHhHH
Q psy15163        105 VCSTCDELLVDLMYFHYKGNVYCLRDY  131 (176)
Q Consensus       105 ~C~~C~~~l~~~~~~~~~g~~yC~~~y  131 (176)
                      .|..|+..    .|...+|..||..|-
T Consensus        10 ~C~~C~~~----~~~~~dG~~yC~~cG   32 (36)
T PF11781_consen   10 PCPVCGSR----WFYSDDGFYYCDRCG   32 (36)
T ss_pred             cCCCCCCe----EeEccCCEEEhhhCc
Confidence            46666553    466788888886664


No 41 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=65.63  E-value=5.1  Score=23.54  Aligned_cols=25  Identities=20%  Similarity=0.216  Sum_probs=17.4

Q ss_pred             ccccccccccccCceEEeCCCcccc
Q psy15163        138 PRCHACDELIFVNEYTLAENKTFHV  162 (176)
Q Consensus       138 ~~C~~C~~~I~~~~~~~a~~~~~H~  162 (176)
                      .+|..|.++|.....+...+..-|+
T Consensus         2 ~~CvVCKqpi~~a~~v~T~~G~VH~   26 (54)
T PF10886_consen    2 EICVVCKQPIDDALVVETESGPVHP   26 (54)
T ss_pred             CeeeeeCCccCcceEEEcCCCccCc
Confidence            4799999999765445455556665


No 42 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=65.61  E-value=2.4  Score=32.00  Aligned_cols=31  Identities=23%  Similarity=0.393  Sum_probs=25.2

Q ss_pred             cccccCccccCCCceeeeCCcccCHhHHhhC
Q psy15163        104 FVCSTCDELLVDLMYFHYKGNVYCLRDYATM  134 (176)
Q Consensus       104 f~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~  134 (176)
                      -+|..|+..+....-...+|++.|..||.+.
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            5788888888776667789999999998754


No 43 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=64.25  E-value=9.2  Score=22.65  Aligned_cols=26  Identities=23%  Similarity=0.470  Sum_probs=19.7

Q ss_pred             cccCHhHHhhCCCcccccccccccccC
Q psy15163        124 NVYCLRDYATMLDIPRCHACDELIFVN  150 (176)
Q Consensus       124 ~~yC~~~y~~~~~~~~C~~C~~~I~~~  150 (176)
                      =-||..|....+. ..|..|++.+..+
T Consensus        29 CTFC~~C~e~~l~-~~CPNCgGelv~R   54 (57)
T PF06906_consen   29 CTFCADCAETMLN-GVCPNCGGELVRR   54 (57)
T ss_pred             CcccHHHHHHHhc-CcCcCCCCccccC
Confidence            3468888888877 7999998876544


No 44 
>KOG0978|consensus
Probab=62.93  E-value=1.8  Score=38.68  Aligned_cols=16  Identities=19%  Similarity=0.528  Sum_probs=12.5

Q ss_pred             ccccccccccccCceE
Q psy15163        138 PRCHACDELIFVNEYT  153 (176)
Q Consensus       138 ~~C~~C~~~I~~~~~~  153 (176)
                      .+|..|+.+..++++.
T Consensus       679 RKCP~Cn~aFganDv~  694 (698)
T KOG0978|consen  679 RKCPKCNAAFGANDVH  694 (698)
T ss_pred             CCCCCCCCCCCccccc
Confidence            5899999988766653


No 45 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=62.54  E-value=8.1  Score=21.30  Aligned_cols=25  Identities=16%  Similarity=0.574  Sum_probs=16.0

Q ss_pred             eeCCcccCHhHHhhCC--Cccccccccc
Q psy15163        120 HYKGNVYCLRDYATML--DIPRCHACDE  145 (176)
Q Consensus       120 ~~~g~~yC~~~y~~~~--~~~~C~~C~~  145 (176)
                      ..=|..+|..|..+..  . ..|..|++
T Consensus        18 ~~CgH~~C~~C~~~~~~~~-~~CP~C~k   44 (44)
T PF14634_consen   18 TSCGHIFCEKCLKKLKGKS-VKCPICRK   44 (44)
T ss_pred             cccCCHHHHHHHHhhcCCC-CCCcCCCC
Confidence            3456677777777665  3 56776653


No 46 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=61.64  E-value=3.8  Score=26.96  Aligned_cols=36  Identities=22%  Similarity=0.427  Sum_probs=25.8

Q ss_pred             ccccccccccCCCeEEEEeccCCCcccCccCcccccCccc
Q psy15163         73 TCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDEL  112 (176)
Q Consensus        73 ~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~  112 (176)
                      .|..|+++|..+++.....    ....|-+||.-+.-+++
T Consensus         8 kC~VCg~~iieGqkFTF~~----kGsVH~eCl~~s~~~k~   43 (103)
T COG4847           8 KCYVCGGTIIEGQKFTFTK----KGSVHYECLAESKRKKP   43 (103)
T ss_pred             eEeeeCCEeeeccEEEEee----CCcchHHHHHHHHhcCc
Confidence            7999999998888764432    34679899876654443


No 47 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=61.13  E-value=6.9  Score=19.00  Aligned_cols=12  Identities=33%  Similarity=0.717  Sum_probs=7.2

Q ss_pred             ccccccccccCc
Q psy15163        140 CHACDELIFVNE  151 (176)
Q Consensus       140 C~~C~~~I~~~~  151 (176)
                      |..|+..|.+++
T Consensus         1 C~sC~~~i~~r~   12 (24)
T PF07754_consen    1 CTSCGRPIAPRE   12 (24)
T ss_pred             CccCCCcccCcc
Confidence            556776775543


No 48 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=60.51  E-value=2.5  Score=26.29  Aligned_cols=10  Identities=20%  Similarity=0.700  Sum_probs=4.1

Q ss_pred             cccccccccc
Q psy15163        138 PRCHACDELI  147 (176)
Q Consensus       138 ~~C~~C~~~I  147 (176)
                      +.|..|++++
T Consensus        31 a~CPdC~~~L   40 (70)
T PF07191_consen   31 AFCPDCGQPL   40 (70)
T ss_dssp             EE-TTT-SB-
T ss_pred             ccCCCcccHH
Confidence            4566666655


No 49 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=59.08  E-value=5.9  Score=21.01  Aligned_cols=25  Identities=24%  Similarity=0.491  Sum_probs=10.7

Q ss_pred             CCcccCHhHHhhCCC--cccccccccc
Q psy15163        122 KGNVYCLRDYATMLD--IPRCHACDEL  146 (176)
Q Consensus       122 ~g~~yC~~~y~~~~~--~~~C~~C~~~  146 (176)
                      =+..||..|..+.+.  ..+|..|+..
T Consensus        18 C~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162          18 CGHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CCChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            344455555432221  0356555543


No 50 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=58.31  E-value=5.3  Score=18.41  Aligned_cols=11  Identities=27%  Similarity=0.712  Sum_probs=8.0

Q ss_pred             eecccCCcccC
Q psy15163        165 FCCYECDKIIT  175 (176)
Q Consensus       165 F~C~~C~~~l~  175 (176)
                      |.|..|++.+.
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            67888887764


No 51 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=57.10  E-value=2.2  Score=22.65  Aligned_cols=27  Identities=19%  Similarity=0.452  Sum_probs=12.9

Q ss_pred             cccCccccCCCceeeeCCcccCHhHHh
Q psy15163        106 CSTCDELLVDLMYFHYKGNVYCLRDYA  132 (176)
Q Consensus       106 C~~C~~~l~~~~~~~~~g~~yC~~~y~  132 (176)
                      |..|+.++.........+..+|..|..
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~C~~   32 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVECQE   32 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HHHHH
T ss_pred             ccccCChHHHHHHHhCCCcEECHHHhC
Confidence            555555554444444455556655543


No 52 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=55.36  E-value=9.5  Score=22.09  Aligned_cols=29  Identities=14%  Similarity=0.327  Sum_probs=18.6

Q ss_pred             ccccCccccCCCc-eeeeCCcccCHhHHhhC
Q psy15163        105 VCSTCDELLVDLM-YFHYKGNVYCLRDYATM  134 (176)
Q Consensus       105 ~C~~C~~~l~~~~-~~~~~g~~yC~~~y~~~  134 (176)
                      .|..|+..++-.. +-..|| ..|..|+.+.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            3677777775533 445666 5788888654


No 53 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=52.35  E-value=1.2  Score=29.36  Aligned_cols=52  Identities=21%  Similarity=0.545  Sum_probs=31.7

Q ss_pred             ccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHh
Q psy15163         73 TCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLR  129 (176)
Q Consensus        73 ~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~  129 (176)
                      .|..|+..+..--+.-+.     -..+++.+..|-.|...|.-..|.....=+||..
T Consensus        37 aCy~CHdel~~Hpf~p~~-----~~~~~~~~iiCGvC~~~LT~~EY~~~~~Cp~C~s   88 (105)
T COG4357          37 ACYHCHDELEDHPFEPWG-----LQEFNPKAIICGVCRKLLTRAEYGMCGSCPYCQS   88 (105)
T ss_pred             hHHHHHhHHhcCCCccCC-----hhhcCCccEEhhhhhhhhhHHHHhhcCCCCCcCC
Confidence            577787777643332222     2356778888888888886655555555455543


No 54 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=51.65  E-value=4.3  Score=26.48  Aligned_cols=18  Identities=22%  Similarity=0.811  Sum_probs=15.0

Q ss_pred             hHHhhCCCccccccccccc
Q psy15163        129 RDYATMLDIPRCHACDELI  147 (176)
Q Consensus       129 ~~y~~~~~~~~C~~C~~~I  147 (176)
                      .-|...|. .+|..|++.+
T Consensus        47 ~sY~~lfs-~pC~~C~klL   64 (90)
T PF11571_consen   47 SSYRNLFS-TPCKKCGKLL   64 (90)
T ss_pred             HHHhhhcc-chhhHHHhHh
Confidence            44677888 8999999988


No 55 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=50.53  E-value=20  Score=21.55  Aligned_cols=16  Identities=38%  Similarity=0.993  Sum_probs=11.2

Q ss_pred             cccccccccccCCCeE
Q psy15163         72 KTCKQCGQEVRSGDLA   87 (176)
Q Consensus        72 ~~C~~C~~~i~~~~~~   87 (176)
                      ..|..|+..|.+++..
T Consensus        10 ~~CtSCg~~i~p~e~~   25 (61)
T COG2888          10 PVCTSCGREIAPGETA   25 (61)
T ss_pred             ceeccCCCEeccCCce
Confidence            3788888888656543


No 56 
>KOG2932|consensus
Probab=49.77  E-value=8.6  Score=31.05  Aligned_cols=43  Identities=23%  Similarity=0.406  Sum_probs=29.1

Q ss_pred             ccccCccccCCCceeeeCCcccCHhHHhhCCCcccccccccccc
Q psy15163        105 VCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIF  148 (176)
Q Consensus       105 ~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~  148 (176)
                      .|..|..+|.-....+.=...||.+|....-. +.|..|...|.
T Consensus        92 fCd~Cd~PI~IYGRmIPCkHvFCl~CAr~~~d-K~Cp~C~d~Vq  134 (389)
T KOG2932|consen   92 FCDRCDFPIAIYGRMIPCKHVFCLECARSDSD-KICPLCDDRVQ  134 (389)
T ss_pred             eecccCCcceeeecccccchhhhhhhhhcCcc-ccCcCcccHHH
Confidence            46777777755444445556778788755545 68999998874


No 57 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=49.39  E-value=9.9  Score=22.21  Aligned_cols=28  Identities=18%  Similarity=0.460  Sum_probs=15.0

Q ss_pred             ccccCccccCCCceeeeCCcccCH-hHHh
Q psy15163        105 VCSTCDELLVDLMYFHYKGNVYCL-RDYA  132 (176)
Q Consensus       105 ~C~~C~~~l~~~~~~~~~g~~yC~-~~y~  132 (176)
                      .|..|...+....-+.++|+.||. .|..
T Consensus         9 aC~~C~C~V~~~~Ai~~dGk~YCS~aCA~   37 (52)
T PF02069_consen    9 ACPSCSCVVSEEEAIQKDGKYYCSEACAN   37 (52)
T ss_dssp             SSTT----B-TTTSEESSS-EESSHHHHH
T ss_pred             cCCCCEeEECchHhHHhCCEeeecHHHhc
Confidence            356677777655677889999984 5543


No 58 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=49.10  E-value=9.6  Score=17.21  Aligned_cols=11  Identities=36%  Similarity=0.730  Sum_probs=6.1

Q ss_pred             eecccCCcccC
Q psy15163        165 FCCYECDKIIT  175 (176)
Q Consensus       165 F~C~~C~~~l~  175 (176)
                      |.|..|+..+.
T Consensus         1 ~~C~~C~~~~~   11 (24)
T PF13894_consen    1 FQCPICGKSFR   11 (24)
T ss_dssp             EE-SSTS-EES
T ss_pred             CCCcCCCCcCC
Confidence            56777777654


No 59 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=48.87  E-value=6  Score=21.15  Aligned_cols=27  Identities=19%  Similarity=0.296  Sum_probs=12.6

Q ss_pred             ccCccccCCCceeeeCCcccCHhHHhh
Q psy15163        107 STCDELLVDLMYFHYKGNVYCLRDYAT  133 (176)
Q Consensus       107 ~~C~~~l~~~~~~~~~g~~yC~~~y~~  133 (176)
                      ..|...+.+......=|..||..|..+
T Consensus         2 ~iC~~~~~~~~~~~~CGH~fC~~C~~~   28 (39)
T PF13923_consen    2 PICLDELRDPVVVTPCGHSFCKECIEK   28 (39)
T ss_dssp             TTTTSB-SSEEEECTTSEEEEHHHHHH
T ss_pred             CCCCCcccCcCEECCCCCchhHHHHHH
Confidence            344444443223345556666666543


No 60 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=46.38  E-value=20  Score=20.17  Aligned_cols=29  Identities=24%  Similarity=0.390  Sum_probs=16.1

Q ss_pred             ccccCccccCCCceee--eCCcccCHhHHhh
Q psy15163        105 VCSTCDELLVDLMYFH--YKGNVYCLRDYAT  133 (176)
Q Consensus       105 ~C~~C~~~l~~~~~~~--~~g~~yC~~~y~~  133 (176)
                      .|..|+..+....|.-  ..+..+|..||.+
T Consensus         2 ~C~~Cg~D~t~vryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCTRVRYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccCceEEEecCCCccccChHHHhC
Confidence            3555666655322221  2245679999875


No 61 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=46.18  E-value=10  Score=20.99  Aligned_cols=8  Identities=38%  Similarity=1.248  Sum_probs=3.9

Q ss_pred             eCCcccCH
Q psy15163        121 YKGNVYCL  128 (176)
Q Consensus       121 ~~g~~yC~  128 (176)
                      ++++.||.
T Consensus        31 k~g~~~Cv   38 (41)
T PF06677_consen   31 KDGKIYCV   38 (41)
T ss_pred             cCCCEECC
Confidence            44555553


No 62 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=45.18  E-value=9.8  Score=26.72  Aligned_cols=20  Identities=35%  Similarity=0.853  Sum_probs=11.4

Q ss_pred             cccCccccCCCceeeeCCcccCHhH
Q psy15163        106 CSTCDELLVDLMYFHYKGNVYCLRD  130 (176)
Q Consensus       106 C~~C~~~l~~~~~~~~~g~~yC~~~  130 (176)
                      |..|+.||     |.++|.+||..|
T Consensus        31 Cp~Cg~PL-----F~KdG~v~CPvC   50 (131)
T COG1645          31 CPKCGTPL-----FRKDGEVFCPVC   50 (131)
T ss_pred             CcccCCcc-----eeeCCeEECCCC
Confidence            55565555     336677766444


No 63 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=44.82  E-value=19  Score=20.12  Aligned_cols=9  Identities=33%  Similarity=0.379  Sum_probs=4.9

Q ss_pred             cccCHhHHh
Q psy15163        124 NVYCLRDYA  132 (176)
Q Consensus       124 ~~yC~~~y~  132 (176)
                      .-+|..||.
T Consensus        23 ~dLC~~Cf~   31 (46)
T cd02249          23 FDLCSSCYA   31 (46)
T ss_pred             CcCHHHHHC
Confidence            335666664


No 64 
>KOG3002|consensus
Probab=44.65  E-value=16  Score=29.50  Aligned_cols=43  Identities=19%  Similarity=0.372  Sum_probs=27.8

Q ss_pred             cccccCccccCCCceeeeCCcccCHhHHhhCCCcccccccccccc
Q psy15163        104 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIF  148 (176)
Q Consensus       104 f~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~  148 (176)
                      +.|..|-..|..-.+.-.+|.+.|..|-.++.  .+|..|..+|.
T Consensus        49 leCPvC~~~l~~Pi~QC~nGHlaCssC~~~~~--~~CP~Cr~~~g   91 (299)
T KOG3002|consen   49 LDCPVCFNPLSPPIFQCDNGHLACSSCRTKVS--NKCPTCRLPIG   91 (299)
T ss_pred             ccCchhhccCcccceecCCCcEehhhhhhhhc--ccCCccccccc
Confidence            44555556665545555677777877765444  48888888874


No 65 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=44.08  E-value=12  Score=17.52  Aligned_cols=12  Identities=33%  Similarity=0.841  Sum_probs=8.3

Q ss_pred             eecccCCcccCC
Q psy15163        165 FCCYECDKIITQ  176 (176)
Q Consensus       165 F~C~~C~~~l~~  176 (176)
                      |.|..|++.+.+
T Consensus         1 ~~C~~C~~~f~s   12 (25)
T PF12874_consen    1 FYCDICNKSFSS   12 (25)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCCCCCCcCC
Confidence            678888776653


No 66 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=43.81  E-value=12  Score=17.91  Aligned_cols=11  Identities=45%  Similarity=0.999  Sum_probs=7.4

Q ss_pred             eecccCCcccC
Q psy15163        165 FCCYECDKIIT  175 (176)
Q Consensus       165 F~C~~C~~~l~  175 (176)
                      |.|..|++.+.
T Consensus         2 ~~C~~C~~~F~   12 (27)
T PF13912_consen    2 FECDECGKTFS   12 (27)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCccCCccC
Confidence            56777777654


No 67 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=43.01  E-value=16  Score=17.66  Aligned_cols=12  Identities=42%  Similarity=1.016  Sum_probs=7.9

Q ss_pred             eecccCCcccCC
Q psy15163        165 FCCYECDKIITQ  176 (176)
Q Consensus       165 F~C~~C~~~l~~  176 (176)
                      |.|..|++.|.+
T Consensus         2 ~~C~~C~k~f~~   13 (27)
T PF12171_consen    2 FYCDACDKYFSS   13 (27)
T ss_dssp             CBBTTTTBBBSS
T ss_pred             CCcccCCCCcCC
Confidence            567777776653


No 68 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=41.31  E-value=26  Score=19.34  Aligned_cols=10  Identities=20%  Similarity=0.328  Sum_probs=6.5

Q ss_pred             cccCHhHHhh
Q psy15163        124 NVYCLRDYAT  133 (176)
Q Consensus       124 ~~yC~~~y~~  133 (176)
                      .-+|..||.+
T Consensus        27 ~dlC~~Cf~~   36 (44)
T smart00291       27 YDLCQSCFAK   36 (44)
T ss_pred             ccchHHHHhC
Confidence            3458888764


No 69 
>KOG0823|consensus
Probab=41.31  E-value=40  Score=26.03  Aligned_cols=52  Identities=19%  Similarity=0.436  Sum_probs=35.8

Q ss_pred             cCcccccCccccCCCceeeeCCcccCHhHHhhCC----CcccccccccccccCceEE
Q psy15163        102 QCFVCSTCDELLVDLMYFHYKGNVYCLRDYATML----DIPRCHACDELIFVNEYTL  154 (176)
Q Consensus       102 ~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~----~~~~C~~C~~~I~~~~~~~  154 (176)
                      ..|.|..|=....+ .....=|.+||..|.++-+    +...|.+|+..|....+|-
T Consensus        46 ~~FdCNICLd~akd-PVvTlCGHLFCWpClyqWl~~~~~~~~cPVCK~~Vs~~~vvP  101 (230)
T KOG0823|consen   46 GFFDCNICLDLAKD-PVVTLCGHLFCWPCLYQWLQTRPNSKECPVCKAEVSIDTVVP  101 (230)
T ss_pred             CceeeeeeccccCC-CEEeecccceehHHHHHHHhhcCCCeeCCccccccccceEEe
Confidence            44777777554433 5667788999999986532    2157899999997766653


No 70 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=40.98  E-value=21  Score=17.33  Aligned_cols=7  Identities=43%  Similarity=1.298  Sum_probs=3.2

Q ss_pred             ccccccc
Q psy15163         73 TCKQCGQ   79 (176)
Q Consensus        73 ~C~~C~~   79 (176)
                      .|..|+.
T Consensus        18 fC~~CG~   24 (26)
T PF13248_consen   18 FCPNCGA   24 (26)
T ss_pred             cChhhCC
Confidence            4444444


No 71 
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=40.84  E-value=12  Score=24.23  Aligned_cols=30  Identities=23%  Similarity=0.638  Sum_probs=14.9

Q ss_pred             cccccccccccC-ceE-EeCCCccccCCeecccCC
Q psy15163        139 RCHACDELIFVN-EYT-LAENKTFHVKHFCCYECD  171 (176)
Q Consensus       139 ~C~~C~~~I~~~-~~~-~a~~~~~H~~CF~C~~C~  171 (176)
                      .|..|+.+|..+ .++ ...+.   ..=|.|..|.
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~---~~~FCC~GC~   33 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGE---ERPFCCPGCQ   33 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCC---ccccccHHHH
Confidence            477777777432 222 22332   2446666664


No 72 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=40.14  E-value=16  Score=20.32  Aligned_cols=10  Identities=40%  Similarity=0.727  Sum_probs=6.0

Q ss_pred             cccccccccc
Q psy15163        138 PRCHACDELI  147 (176)
Q Consensus       138 ~~C~~C~~~I  147 (176)
                      .+|..|+..+
T Consensus        22 ~~Cp~CG~~~   31 (46)
T PRK00398         22 VRCPYCGYRI   31 (46)
T ss_pred             eECCCCCCeE
Confidence            4666666655


No 73 
>KOG3579|consensus
Probab=39.05  E-value=17  Score=29.02  Aligned_cols=51  Identities=25%  Similarity=0.512  Sum_probs=34.7

Q ss_pred             CCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHh
Q psy15163         69 RSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLR  129 (176)
Q Consensus        69 ~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~  129 (176)
                      .....|.-|++.+.+..+|-..     ...-|+-||-|+.  ..|..+   -.-+.+||..
T Consensus       266 ~apLcCTLC~ERLEDTHFVQCP-----SVp~HKFCFPCSR--esIK~Q---g~sgevYCPS  316 (352)
T KOG3579|consen  266 SAPLCCTLCHERLEDTHFVQCP-----SVPSHKFCFPCSR--ESIKQQ---GASGEVYCPS  316 (352)
T ss_pred             CCceeehhhhhhhccCceeecC-----CCcccceecccCH--HHHHhh---cCCCceeCCC
Confidence            3446899999999988777655     6678999999874  222221   1345778853


No 74 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=38.57  E-value=7.6  Score=19.53  Aligned_cols=11  Identities=27%  Similarity=0.585  Sum_probs=6.1

Q ss_pred             ccccccccccc
Q psy15163        138 PRCHACDELIF  148 (176)
Q Consensus       138 ~~C~~C~~~I~  148 (176)
                      .+|..|...|.
T Consensus         2 ~~C~rC~~~~~   12 (30)
T PF06827_consen    2 EKCPRCWNYIE   12 (30)
T ss_dssp             SB-TTT--BBE
T ss_pred             CcCccCCCcce
Confidence            57888988884


No 75 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=37.99  E-value=15  Score=23.46  Aligned_cols=28  Identities=29%  Similarity=0.486  Sum_probs=15.8

Q ss_pred             cccCccccCCCceee-----eCCcccCHhHHhh
Q psy15163        106 CSTCDELLVDLMYFH-----YKGNVYCLRDYAT  133 (176)
Q Consensus       106 C~~C~~~l~~~~~~~-----~~g~~yC~~~y~~  133 (176)
                      |..|+.||.....+-     ..+.-||.-||..
T Consensus         3 CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    3 CQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             CCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            666777765443211     2334588888854


No 76 
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.03  E-value=24  Score=24.65  Aligned_cols=46  Identities=20%  Similarity=0.509  Sum_probs=24.9

Q ss_pred             cCHhHHhhCCCcccccccccccccCceE---EeCCCccccCCeecccCCccc
Q psy15163        126 YCLRDYATMLDIPRCHACDELIFVNEYT---LAENKTFHVKHFCCYECDKII  174 (176)
Q Consensus       126 yC~~~y~~~~~~~~C~~C~~~I~~~~~~---~a~~~~~H~~CF~C~~C~~~l  174 (176)
                      ||..|-....  ..|..|+.+|.+..++   -.+|..|-+-=| |..|++++
T Consensus        30 fcskcgeati--~qcp~csasirgd~~vegvlglg~dye~psf-chncgs~f   78 (160)
T COG4306          30 FCSKCGEATI--TQCPICSASIRGDYYVEGVLGLGGDYEPPSF-CHNCGSRF   78 (160)
T ss_pred             HHhhhchHHH--hcCCccCCcccccceeeeeeccCCCCCCcch-hhcCCCCC
Confidence            4555554433  3677777777655433   244555555433 56666654


No 77 
>PRK00420 hypothetical protein; Validated
Probab=35.77  E-value=16  Score=24.96  Aligned_cols=10  Identities=30%  Similarity=0.790  Sum_probs=5.7

Q ss_pred             cccccccccc
Q psy15163         73 TCKQCGQEVR   82 (176)
Q Consensus        73 ~C~~C~~~i~   82 (176)
                      .|..|+.++.
T Consensus        25 ~CP~Cg~pLf   34 (112)
T PRK00420         25 HCPVCGLPLF   34 (112)
T ss_pred             CCCCCCCcce
Confidence            5666655543


No 78 
>KOG4739|consensus
Probab=35.52  E-value=27  Score=27.05  Aligned_cols=34  Identities=18%  Similarity=0.300  Sum_probs=25.2

Q ss_pred             CCceee-eCCcccCHhHHhhCCCccccccccccccc
Q psy15163        115 DLMYFH-YKGNVYCLRDYATMLDIPRCHACDELIFV  149 (176)
Q Consensus       115 ~~~~~~-~~g~~yC~~~y~~~~~~~~C~~C~~~I~~  149 (176)
                      ...||+ -=..++|..|...-.+ +.|..|++.|..
T Consensus        15 ~~~f~LTaC~HvfC~~C~k~~~~-~~C~lCkk~ir~   49 (233)
T KOG4739|consen   15 QDPFFLTACRHVFCEPCLKASSP-DVCPLCKKSIRI   49 (233)
T ss_pred             CCceeeeechhhhhhhhcccCCc-cccccccceeee
Confidence            445554 4567889999877776 799999999854


No 79 
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=34.56  E-value=33  Score=21.81  Aligned_cols=23  Identities=17%  Similarity=0.257  Sum_probs=9.7

Q ss_pred             cccCHhHHh--hCCCcccccccccc
Q psy15163        124 NVYCLRDYA--TMLDIPRCHACDEL  146 (176)
Q Consensus       124 ~~yC~~~y~--~~~~~~~C~~C~~~  146 (176)
                      .|.|+.||.  ++-+...|.+|+-+
T Consensus        36 fPvCr~CyEYErkeg~q~CpqCkt~   60 (80)
T PF14569_consen   36 FPVCRPCYEYERKEGNQVCPQCKTR   60 (80)
T ss_dssp             ----HHHHHHHHHTS-SB-TTT--B
T ss_pred             CccchhHHHHHhhcCcccccccCCC
Confidence            356888884  33443678888744


No 80 
>KOG3476|consensus
Probab=34.23  E-value=5.2  Score=25.88  Aligned_cols=37  Identities=24%  Similarity=0.533  Sum_probs=26.8

Q ss_pred             cccccCccccCCCceeeeCCcccCHhHHhhCCCccccccccccccc
Q psy15163        104 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFV  149 (176)
Q Consensus       104 f~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~~  149 (176)
                      -+|-.|...+.+      .|--||..|..+.   ..|+-|++.|..
T Consensus        55 ~kC~iCk~~vHQ------~GshYC~tCAY~K---giCAMCGKki~n   91 (100)
T KOG3476|consen   55 AKCRICKQLVHQ------PGSHYCQTCAYKK---GICAMCGKKILN   91 (100)
T ss_pred             chhHHHHHHhcC------CcchhHhHhhhhh---hHHHHhhhHhhc
Confidence            456666655432      4567899998765   699999999964


No 81 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=33.75  E-value=21  Score=32.11  Aligned_cols=36  Identities=22%  Similarity=0.225  Sum_probs=24.2

Q ss_pred             ccCccccCCCceeeeCCcccCHhHHhhCCCcccccccccc
Q psy15163        107 STCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDEL  146 (176)
Q Consensus       107 ~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~  146 (176)
                      ..|+.+|   .|+...+.+.|..|-..... ..|..|+..
T Consensus       396 ~~C~~~L---~~h~~~~~l~Ch~CG~~~~p-~~Cp~Cgs~  431 (665)
T PRK14873        396 RHCTGPL---GLPSAGGTPRCRWCGRAAPD-WRCPRCGSD  431 (665)
T ss_pred             CCCCCce---eEecCCCeeECCCCcCCCcC-ccCCCCcCC
Confidence            3444444   34445667889888766555 799999875


No 82 
>PHA02775 E6; Provisional
Probab=33.66  E-value=10  Score=27.58  Aligned_cols=14  Identities=21%  Similarity=0.510  Sum_probs=10.1

Q ss_pred             ccccccccccCCCe
Q psy15163         73 TCKQCGQEVRSGDL   86 (176)
Q Consensus        73 ~C~~C~~~i~~~~~   86 (176)
                      .|..|++.+...|.
T Consensus        45 ~CvFCk~~Lt~~E~   58 (160)
T PHA02775         45 CCHYCKKCLSLLDI   58 (160)
T ss_pred             EeeccCCcCCHHHH
Confidence            68899988854443


No 83 
>PF12773 DZR:  Double zinc ribbon
Probab=33.19  E-value=39  Score=18.91  Aligned_cols=10  Identities=30%  Similarity=0.946  Sum_probs=5.4

Q ss_pred             cccccccccc
Q psy15163         73 TCKQCGQEVR   82 (176)
Q Consensus        73 ~C~~C~~~i~   82 (176)
                      .|..|+..+.
T Consensus        14 fC~~CG~~l~   23 (50)
T PF12773_consen   14 FCPHCGTPLP   23 (50)
T ss_pred             CChhhcCChh
Confidence            5555555554


No 84 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=31.69  E-value=26  Score=16.89  Aligned_cols=11  Identities=27%  Similarity=0.712  Sum_probs=6.7

Q ss_pred             eecccCCcccC
Q psy15163        165 FCCYECDKIIT  175 (176)
Q Consensus       165 F~C~~C~~~l~  175 (176)
                      |.|..|++.+.
T Consensus        15 ~~C~~C~k~F~   25 (26)
T PF13465_consen   15 YKCPYCGKSFS   25 (26)
T ss_dssp             EEESSSSEEES
T ss_pred             CCCCCCcCeeC
Confidence            56666666553


No 85 
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=31.28  E-value=49  Score=18.84  Aligned_cols=10  Identities=10%  Similarity=-0.014  Sum_probs=6.4

Q ss_pred             cccCHhHHhh
Q psy15163        124 NVYCLRDYAT  133 (176)
Q Consensus       124 ~~yC~~~y~~  133 (176)
                      .-+|..||..
T Consensus        26 ~DlC~~C~~~   35 (48)
T cd02341          26 FDLCQDCVVK   35 (48)
T ss_pred             CccCHHHHhC
Confidence            3457777764


No 87 
>KOG4443|consensus
Probab=31.01  E-value=23  Score=31.48  Aligned_cols=18  Identities=22%  Similarity=0.421  Sum_probs=8.9

Q ss_pred             CCccccCCeecccCCccc
Q psy15163        157 NKTFHVKHFCCYECDKII  174 (176)
Q Consensus       157 ~~~~H~~CF~C~~C~~~l  174 (176)
                      +..+-++||.|..|+..|
T Consensus       108 g~~~ckk~~~c~qc~~~l  125 (694)
T KOG4443|consen  108 GPWLCKKCTRCRQCDSTL  125 (694)
T ss_pred             cccccHHHHhhhhccccc
Confidence            344445555555555443


No 88 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=30.80  E-value=30  Score=30.98  Aligned_cols=11  Identities=36%  Similarity=0.676  Sum_probs=8.2

Q ss_pred             ccccccccccC
Q psy15163         73 TCKQCGQEVRS   83 (176)
Q Consensus        73 ~C~~C~~~i~~   83 (176)
                      +|..|+..+..
T Consensus         3 ~Cp~Cg~~n~~   13 (645)
T PRK14559          3 ICPQCQFENPN   13 (645)
T ss_pred             cCCCCCCcCCC
Confidence            68888887753


No 89 
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=30.48  E-value=44  Score=18.64  Aligned_cols=29  Identities=21%  Similarity=0.493  Sum_probs=16.3

Q ss_pred             cccccccccCCCeEEEEeccCCCcccCccCcc
Q psy15163         74 CKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFV  105 (176)
Q Consensus        74 C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~  105 (176)
                      |..|++.-. .+.++.-+..  +..||..|..
T Consensus         2 C~vC~~~~~-~~~~i~C~~C--~~~~H~~C~~   30 (51)
T PF00628_consen    2 CPVCGQSDD-DGDMIQCDSC--NRWYHQECVG   30 (51)
T ss_dssp             BTTTTSSCT-TSSEEEBSTT--SCEEETTTST
T ss_pred             CcCCCCcCC-CCCeEEcCCC--ChhhCcccCC
Confidence            556666443 3334444444  4478888864


No 90 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=30.28  E-value=35  Score=20.40  Aligned_cols=24  Identities=17%  Similarity=0.423  Sum_probs=14.0

Q ss_pred             ccccCccccC-CCcee-eeCCcccCH
Q psy15163        105 VCSTCDELLV-DLMYF-HYKGNVYCL  128 (176)
Q Consensus       105 ~C~~C~~~l~-~~~~~-~~~g~~yC~  128 (176)
                      .|..|++.|. +...| .+..+.+|.
T Consensus        18 ~C~~C~k~L~~~~DiymYrGd~aFCS   43 (58)
T PF04570_consen   18 FCYLCKKKLDPGKDIYMYRGDKAFCS   43 (58)
T ss_pred             HHHccCCCCCCCCCeeeecccccccc
Confidence            4556777775 33334 355677774


No 91 
>PF14149 YhfH:  YhfH-like protein
Probab=30.04  E-value=17  Score=19.63  Aligned_cols=18  Identities=22%  Similarity=0.455  Sum_probs=13.2

Q ss_pred             HhhCCCcccccccccccc
Q psy15163        131 YATMLDIPRCHACDELIF  148 (176)
Q Consensus       131 y~~~~~~~~C~~C~~~I~  148 (176)
                      |.+.+....|..||+.|.
T Consensus         7 FfrnLp~K~C~~CG~~i~   24 (37)
T PF14149_consen    7 FFRNLPPKKCTECGKEIE   24 (37)
T ss_pred             HHHhCCCcccHHHHHHHH
Confidence            445554479999999994


No 92 
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=29.97  E-value=29  Score=27.55  Aligned_cols=28  Identities=11%  Similarity=0.059  Sum_probs=17.4

Q ss_pred             CCcccccccccccccCceEEeCCCccccCC
Q psy15163        135 LDIPRCHACDELIFVNEYTLAENKTFHVKH  164 (176)
Q Consensus       135 ~~~~~C~~C~~~I~~~~~~~a~~~~~H~~C  164 (176)
                      -+ ..|..|+.+|.. ..+.-++..|.|.|
T Consensus       244 ~G-epC~~CGt~I~k-~~~~gR~t~~CP~C  271 (273)
T COG0266         244 AG-EPCRRCGTPIEK-IKLGGRSTFYCPVC  271 (273)
T ss_pred             CC-CCCCccCCEeEE-EEEcCCcCEeCCCC
Confidence            35 799999999943 23334455555554


No 93 
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=29.86  E-value=35  Score=29.43  Aligned_cols=41  Identities=27%  Similarity=0.431  Sum_probs=28.4

Q ss_pred             CCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCC
Q psy15163         69 RSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVD  115 (176)
Q Consensus        69 ~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~  115 (176)
                      .....|..|-..+...+..  ++    +....+.||.|-.|..+|..
T Consensus        24 i~~~yCp~CL~~~p~~e~~--~~----~nrC~r~Cf~CP~C~~~L~~   64 (483)
T PF05502_consen   24 IDSYYCPNCLFEVPSSEAR--SE----KNRCSRNCFDCPICFSPLSV   64 (483)
T ss_pred             cceeECccccccCChhhhe--ec----cceeccccccCCCCCCccee
Confidence            4556888888877644422  21    34556799999999999854


No 94 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=29.71  E-value=65  Score=25.31  Aligned_cols=75  Identities=13%  Similarity=0.464  Sum_probs=47.9

Q ss_pred             CcccCCCCC----CccCCCCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhH
Q psy15163         55 GVTHGPCGN----KLTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRD  130 (176)
Q Consensus        55 ~~~~~~~~~----~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~  130 (176)
                      .+.|..|..    .+....+-.+|.+|.+.-.+   |- .     ++.|-..=|.|..|+..+.+  |...         
T Consensus       112 qFaC~~Cd~~WwRrvp~rKeVSRCr~C~~rYDP---VP-~-----dkmwG~aef~C~~C~h~F~G--~~qm---------  171 (278)
T PF15135_consen  112 QFACSSCDHMWWRRVPQRKEVSRCRKCRKRYDP---VP-C-----DKMWGIAEFHCPKCRHNFRG--FAQM---------  171 (278)
T ss_pred             eeeccccchHHHhccCcccccccccccccccCC---Cc-c-----ccccceeeeecccccccchh--hhhc---------
Confidence            356777743    23334556689999887642   22 1     55676667999999998876  2111         


Q ss_pred             HhhCCCcccccccccccccCceE
Q psy15163        131 YATMLDIPRCHACDELIFVNEYT  153 (176)
Q Consensus       131 y~~~~~~~~C~~C~~~I~~~~~~  153 (176)
                         ... ..|..|+.++.+..++
T Consensus       172 ---~v~-sPCy~C~~~v~P~~Il  190 (278)
T PF15135_consen  172 ---GVP-SPCYGCGNPVYPSRIL  190 (278)
T ss_pred             ---CCC-CCccCCCCccCccccc
Confidence               112 5888999988765443


No 95 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=29.04  E-value=15  Score=21.44  Aligned_cols=11  Identities=9%  Similarity=0.386  Sum_probs=4.8

Q ss_pred             CCccccCCeec
Q psy15163        157 NKTFHVKHFCC  167 (176)
Q Consensus       157 ~~~~H~~CF~C  167 (176)
                      ++.|-.+|-.|
T Consensus        20 ~Q~yiEDC~vC   30 (52)
T PF14255_consen   20 DQEYIEDCQVC   30 (52)
T ss_pred             CeeEEeehhhc
Confidence            44444444443


No 96 
>PHA02779 E6 protein; Provisional
Probab=28.96  E-value=13  Score=26.72  Aligned_cols=25  Identities=20%  Similarity=0.352  Sum_probs=15.4

Q ss_pred             ccccccccccccCce--EEeCCCcccc
Q psy15163        138 PRCHACDELIFVNEY--TLAENKTFHV  162 (176)
Q Consensus       138 ~~C~~C~~~I~~~~~--~~a~~~~~H~  162 (176)
                      -+|..|.+++...|-  ....++.||.
T Consensus       102 IRC~~C~k~L~~~EK~~~~~~~~~F~~  128 (150)
T PHA02779        102 IRCYLCHKPLCPVEKVNHILKKARFIK  128 (150)
T ss_pred             EEHhHcCCcCCHHHHHHHHHcCCCEEE
Confidence            488899988865431  2245555554


No 97 
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.76  E-value=53  Score=20.58  Aligned_cols=27  Identities=15%  Similarity=0.349  Sum_probs=20.4

Q ss_pred             cccCHhHHhhCCCcccccccccccccCc
Q psy15163        124 NVYCLRDYATMLDIPRCHACDELIFVNE  151 (176)
Q Consensus       124 ~~yC~~~y~~~~~~~~C~~C~~~I~~~~  151 (176)
                      --||..|...+++ ..|..|++.+..++
T Consensus        29 cTFCadCae~~l~-g~CPnCGGelv~RP   55 (84)
T COG3813          29 CTFCADCAENRLH-GLCPNCGGELVARP   55 (84)
T ss_pred             eehhHhHHHHhhc-CcCCCCCchhhcCc
Confidence            3468888888888 89999998765544


No 98 
>TIGR02420 dksA RNA polymerase-binding protein DksA. The model that is the basis for this family describes a small, pleiotropic protein, DksA (DnaK suppressor A), originally named as a multicopy suppressor of temperature sensitivity of dnaKJ mutants. DksA mutants are defective in quorum sensing, virulence, etc. DksA is now understood to bind RNA polymerase directly and modulate its response to small molecules to control the level of transcription of rRNA. Nearly all members of this family are in the Proteobacteria. Whether the closest homologs outside the Proteobacteria function equivalently is unknown. The low value set for the noise cutoff allows identification of possible DksA proteins from outside the proteobacteria. TIGR02419 describes a closely related family of short sequences usually found in prophage regions of proteobacterial genomes or in known phage.
Probab=28.61  E-value=11  Score=25.49  Aligned_cols=10  Identities=40%  Similarity=0.710  Sum_probs=7.2

Q ss_pred             cccccccccc
Q psy15163        139 RCHACDELIF  148 (176)
Q Consensus       139 ~C~~C~~~I~  148 (176)
                      .|..|+++|.
T Consensus        82 ~C~~Cge~I~   91 (110)
T TIGR02420        82 YCEECGEEIG   91 (110)
T ss_pred             chhccCCccc
Confidence            7777777773


No 99 
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=28.42  E-value=60  Score=18.32  Aligned_cols=9  Identities=22%  Similarity=0.615  Sum_probs=5.4

Q ss_pred             ccCHhHHhh
Q psy15163        125 VYCLRDYAT  133 (176)
Q Consensus       125 ~yC~~~y~~  133 (176)
                      -+|..||..
T Consensus        25 dLC~~Cf~~   33 (49)
T cd02335          25 DLCLECFSA   33 (49)
T ss_pred             chhHHhhhC
Confidence            357777653


No 100
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=28.07  E-value=45  Score=18.59  Aligned_cols=10  Identities=10%  Similarity=0.242  Sum_probs=6.6

Q ss_pred             cccCHhHHhh
Q psy15163        124 NVYCLRDYAT  133 (176)
Q Consensus       124 ~~yC~~~y~~  133 (176)
                      .-+|..||.+
T Consensus        28 ~dLC~~C~~~   37 (46)
T PF00569_consen   28 YDLCEDCFSK   37 (46)
T ss_dssp             -EEEHHHHHH
T ss_pred             CchhhHHHhC
Confidence            4468888865


No 101
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=27.47  E-value=44  Score=18.05  Aligned_cols=30  Identities=23%  Similarity=0.389  Sum_probs=12.9

Q ss_pred             ccccccccccccCceEEeCCCccccCCeecccCCc
Q psy15163        138 PRCHACDELIFVNEYTLAENKTFHVKHFCCYECDK  172 (176)
Q Consensus       138 ~~C~~C~~~I~~~~~~~a~~~~~H~~CF~C~~C~~  172 (176)
                      .+|..|+..|-.-..+...++.     ++|..|+.
T Consensus         3 ~rC~~C~aylNp~~~~~~~~~~-----w~C~~C~~   32 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDDGGKT-----WICNFCGT   32 (40)
T ss_dssp             -B-TTT--BS-TTSEEETTTTE-----EEETTT--
T ss_pred             cccCCCCCEECCcceEcCCCCE-----EECcCCCC
Confidence            5888999888443223333333     56776654


No 102
>KOG2462|consensus
Probab=27.41  E-value=33  Score=27.24  Aligned_cols=38  Identities=24%  Similarity=0.536  Sum_probs=22.2

Q ss_pred             ccccccccccccCceEEeCCCcccc--CCeecccCCcccCC
Q psy15163        138 PRCHACDELIFVNEYTLAENKTFHV--KHFCCYECDKIITQ  176 (176)
Q Consensus       138 ~~C~~C~~~I~~~~~~~a~~~~~H~--~CF~C~~C~~~l~~  176 (176)
                      -+|..|++.. .+.++--.--..|-  +=|.|..|++.|.|
T Consensus       188 c~C~iCGKaF-SRPWLLQGHiRTHTGEKPF~C~hC~kAFAD  227 (279)
T KOG2462|consen  188 CECGICGKAF-SRPWLLQGHIRTHTGEKPFSCPHCGKAFAD  227 (279)
T ss_pred             cccccccccc-cchHHhhcccccccCCCCccCCcccchhcc
Confidence            4788888877 44543101111222  44888899888764


No 103
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=27.39  E-value=44  Score=28.85  Aligned_cols=12  Identities=25%  Similarity=0.453  Sum_probs=7.1

Q ss_pred             CCeecccCCccc
Q psy15163        163 KHFCCYECDKII  174 (176)
Q Consensus       163 ~CF~C~~C~~~l  174 (176)
                      +||.|..|..+|
T Consensus        51 ~Cf~CP~C~~~L   62 (483)
T PF05502_consen   51 NCFDCPICFSPL   62 (483)
T ss_pred             ccccCCCCCCcc
Confidence            566666665554


No 104
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=26.21  E-value=22  Score=25.29  Aligned_cols=33  Identities=18%  Similarity=0.390  Sum_probs=17.8

Q ss_pred             cccccccccccCceEEeCCCccccCCeecccCCccc
Q psy15163        139 RCHACDELIFVNEYTLAENKTFHVKHFCCYECDKII  174 (176)
Q Consensus       139 ~C~~C~~~I~~~~~~~a~~~~~H~~CF~C~~C~~~l  174 (176)
                      .|..|+..+...+.+...+.   ..=|.|..|+..|
T Consensus       101 ~Cp~C~~~y~~~ea~~~~d~---~~~f~Cp~Cg~~l  133 (147)
T smart00531      101 KCPNCQSKYTFLEANQLLDM---DGTFTCPRCGEEL  133 (147)
T ss_pred             ECcCCCCEeeHHHHHHhcCC---CCcEECCCCCCEE
Confidence            56667666644333222221   2337788887766


No 105
>smart00355 ZnF_C2H2 zinc finger.
Probab=25.49  E-value=33  Score=15.40  Aligned_cols=11  Identities=36%  Similarity=1.026  Sum_probs=5.8

Q ss_pred             eecccCCcccC
Q psy15163        165 FCCYECDKIIT  175 (176)
Q Consensus       165 F~C~~C~~~l~  175 (176)
                      |.|..|+..+.
T Consensus         1 ~~C~~C~~~f~   11 (26)
T smart00355        1 YRCPECGKVFK   11 (26)
T ss_pred             CCCCCCcchhC
Confidence            34566665543


No 106
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=25.49  E-value=20  Score=23.82  Aligned_cols=31  Identities=19%  Similarity=0.304  Sum_probs=17.6

Q ss_pred             CccCcccccCccccCCC-ceeeeCCcccCHhH
Q psy15163        100 HPQCFVCSTCDELLVDL-MYFHYKGNVYCLRD  130 (176)
Q Consensus       100 H~~Cf~C~~C~~~l~~~-~~~~~~g~~yC~~~  130 (176)
                      -..=|+|+.|-.--.-. .-...+|+++|..|
T Consensus        67 q~DEFTCssCFLV~HRSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   67 QADEFTCSSCFLVHHRSQLAREKDGQPICRDC   98 (99)
T ss_pred             CCCceeeeeeeeEechhhhccccCCCEecccc
Confidence            33457887774433111 12246788888776


No 107
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=25.10  E-value=37  Score=26.80  Aligned_cols=29  Identities=14%  Similarity=0.107  Sum_probs=16.5

Q ss_pred             CCCcccccccccccccCceEEeCCCccccCC
Q psy15163        134 MLDIPRCHACDELIFVNEYTLAENKTFHVKH  164 (176)
Q Consensus       134 ~~~~~~C~~C~~~I~~~~~~~a~~~~~H~~C  164 (176)
                      +.+ ..|..|+.+|.. ..+..+...|.|.|
T Consensus       243 R~g-~pC~~Cg~~I~~-~~~~gR~t~~CP~C  271 (274)
T PRK01103        243 REG-EPCRRCGTPIEK-IKQGGRSTFFCPRC  271 (274)
T ss_pred             CCC-CCCCCCCCeeEE-EEECCCCcEECcCC
Confidence            345 689999999942 23323344444443


No 108
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=24.82  E-value=1.1e+02  Score=24.04  Aligned_cols=55  Identities=11%  Similarity=0.271  Sum_probs=41.0

Q ss_pred             cCccCcccccCccccCCC-ce--eeeCCcccCHhHHhhCC-CcccccccccccccCceEE
Q psy15163         99 WHPQCFVCSTCDELLVDL-MY--FHYKGNVYCLRDYATML-DIPRCHACDELIFVNEYTL  154 (176)
Q Consensus        99 ~H~~Cf~C~~C~~~l~~~-~~--~~~~g~~yC~~~y~~~~-~~~~C~~C~~~I~~~~~~~  154 (176)
                      ....-|.|......|.+. .|  ...-|.+|++....+.- . ..|..|+++....++|.
T Consensus       109 ~~~~~~~CPvt~~~~~~~~~fv~l~~cG~V~s~~alke~k~~-~~Cp~c~~~f~~~DiI~  167 (260)
T PF04641_consen  109 NSEGRFICPVTGKEFNGKHKFVYLRPCGCVFSEKALKELKKS-KKCPVCGKPFTEEDIIP  167 (260)
T ss_pred             cCCceeECCCCCcccCCceeEEEEcCCCCEeeHHHHHhhccc-ccccccCCccccCCEEE
Confidence            346678888888888653 22  23678899999987775 4 68999999998767764


No 109
>PRK12495 hypothetical protein; Provisional
Probab=24.80  E-value=52  Score=25.30  Aligned_cols=11  Identities=18%  Similarity=0.682  Sum_probs=6.2

Q ss_pred             cccccCccccC
Q psy15163        104 FVCSTCDELLV  114 (176)
Q Consensus       104 f~C~~C~~~l~  114 (176)
                      +.|..|+.+|.
T Consensus        43 ~hC~~CG~PIp   53 (226)
T PRK12495         43 AHCDECGDPIF   53 (226)
T ss_pred             hhcccccCccc
Confidence            45566666553


No 110
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=24.80  E-value=68  Score=17.67  Aligned_cols=7  Identities=29%  Similarity=0.240  Sum_probs=3.7

Q ss_pred             cCHhHHh
Q psy15163        126 YCLRDYA  132 (176)
Q Consensus       126 yC~~~y~  132 (176)
                      +|..||.
T Consensus        25 LC~~C~~   31 (43)
T cd02340          25 LCESCEA   31 (43)
T ss_pred             chHHhhC
Confidence            4555553


No 111
>PHA02610 uvsY.-2 hypothetical protein; Provisional
Probab=24.54  E-value=57  Score=18.96  Aligned_cols=25  Identities=20%  Similarity=0.238  Sum_probs=15.0

Q ss_pred             ccccccccccccCceEEeCCCcccc
Q psy15163        138 PRCHACDELIFVNEYTLAENKTFHV  162 (176)
Q Consensus       138 ~~C~~C~~~I~~~~~~~a~~~~~H~  162 (176)
                      .+|-.|.+||...-.+......-|+
T Consensus         2 ~iCvvCK~Pi~~al~v~T~~Gpvh~   26 (53)
T PHA02610          2 KICVVCKQPIEKALVVETEKGPVHP   26 (53)
T ss_pred             ceeeeeCCchhhceEEecCCCCCCC
Confidence            4788888888543334444555554


No 112
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=23.68  E-value=67  Score=22.48  Aligned_cols=20  Identities=25%  Similarity=0.679  Sum_probs=15.4

Q ss_pred             cccccccccccCCCeEEEEe
Q psy15163         72 KTCKQCGQEVRSGDLAVYTE   91 (176)
Q Consensus        72 ~~C~~C~~~i~~~~~~~~~~   91 (176)
                      ..|..|+..|+++.-++..+
T Consensus         5 e~CsFcG~kIyPG~G~~fVR   24 (131)
T PRK14891          5 RTCDYTGEEIEPGTGTMFVR   24 (131)
T ss_pred             eeecCcCCcccCCCCcEEEe
Confidence            37999999998887665554


No 113
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.05  E-value=46  Score=27.98  Aligned_cols=10  Identities=20%  Similarity=0.464  Sum_probs=6.2

Q ss_pred             cccccccccc
Q psy15163        139 RCHACDELIF  148 (176)
Q Consensus       139 ~C~~C~~~I~  148 (176)
                      .|..|...+.
T Consensus        62 ~CP~Cr~~~~   71 (397)
T TIGR00599        62 KCPLCRAEDQ   71 (397)
T ss_pred             CCCCCCCccc
Confidence            5666666653


No 114
>PHA02929 N1R/p28-like protein; Provisional
Probab=23.05  E-value=30  Score=26.90  Aligned_cols=25  Identities=16%  Similarity=0.442  Sum_probs=13.3

Q ss_pred             CCcccCHhHHhhC--CCccccccccccc
Q psy15163        122 KGNVYCLRDYATM--LDIPRCHACDELI  147 (176)
Q Consensus       122 ~g~~yC~~~y~~~--~~~~~C~~C~~~I  147 (176)
                      =+..||..|..+-  .. ..|..|+..+
T Consensus       200 C~H~FC~~CI~~Wl~~~-~tCPlCR~~~  226 (238)
T PHA02929        200 CNHVFCIECIDIWKKEK-NTCPVCRTPF  226 (238)
T ss_pred             CCCcccHHHHHHHHhcC-CCCCCCCCEe
Confidence            3556666665321  12 4666666665


No 115
>PHA02768 hypothetical protein; Provisional
Probab=22.89  E-value=15  Score=21.66  Aligned_cols=12  Identities=25%  Similarity=1.002  Sum_probs=8.5

Q ss_pred             cccccCccccCC
Q psy15163        104 FVCSTCDELLVD  115 (176)
Q Consensus       104 f~C~~C~~~l~~  115 (176)
                      |.|..|++.+..
T Consensus         6 y~C~~CGK~Fs~   17 (55)
T PHA02768          6 YECPICGEIYIK   17 (55)
T ss_pred             cCcchhCCeecc
Confidence            677788777654


No 116
>KOG3579|consensus
Probab=22.63  E-value=44  Score=26.75  Aligned_cols=53  Identities=17%  Similarity=0.308  Sum_probs=27.5

Q ss_pred             cccccCccccCCCceeeeCCcccCHhHHhhCCCcccccccccccccCceEEeCCCccccCCeecc
Q psy15163        104 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCY  168 (176)
Q Consensus       104 f~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~~~~~~~a~~~~~H~~CF~C~  168 (176)
                      +.|..|+..|.++-|..--..+.         + ..|.-|+..-+-.  -.+.+..|.|.-=+|.
T Consensus       269 LcCTLC~ERLEDTHFVQCPSVp~---------H-KFCFPCSResIK~--Qg~sgevYCPSGdkCP  321 (352)
T KOG3579|consen  269 LCCTLCHERLEDTHFVQCPSVPS---------H-KFCFPCSRESIKQ--QGASGEVYCPSGDKCP  321 (352)
T ss_pred             eeehhhhhhhccCceeecCCCcc---------c-ceecccCHHHHHh--hcCCCceeCCCCCcCc
Confidence            67888888887754443222111         1 4555565432111  1245666776655554


No 117
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=22.54  E-value=35  Score=24.99  Aligned_cols=36  Identities=22%  Similarity=0.413  Sum_probs=22.8

Q ss_pred             cccccccccccc---CceE-EeC--CCccccCCeecccCCcc
Q psy15163        138 PRCHACDELIFV---NEYT-LAE--NKTFHVKHFCCYECDKI  173 (176)
Q Consensus       138 ~~C~~C~~~I~~---~~~~-~a~--~~~~H~~CF~C~~C~~~  173 (176)
                      .+|..|+..+..   +++. ..-  -...|-+.++|..|++.
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~Cgki  139 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKI  139 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCccc
Confidence            589999988853   1111 011  22457788999999874


No 118
>KOG2114|consensus
Probab=22.01  E-value=36  Score=31.37  Aligned_cols=38  Identities=16%  Similarity=0.405  Sum_probs=0.0

Q ss_pred             cccccccccccCceEEeCCCccccCCee-----cccCCcccCC
Q psy15163        139 RCHACDELIFVNEYTLAENKTFHVKHFC-----CYECDKIITQ  176 (176)
Q Consensus       139 ~C~~C~~~I~~~~~~~a~~~~~H~~CF~-----C~~C~~~l~~  176 (176)
                      +|..|+..+.--.+----+..||..||.     |..|...+++
T Consensus       842 kCs~C~~~LdlP~VhF~CgHsyHqhC~e~~~~~CP~C~~e~~~  884 (933)
T KOG2114|consen  842 KCSACEGTLDLPFVHFLCGHSYHQHCLEDKEDKCPKCLPELRG  884 (933)
T ss_pred             eecccCCccccceeeeecccHHHHHhhccCcccCCccchhhhh


No 119
>KOG2893|consensus
Probab=21.87  E-value=22  Score=27.65  Aligned_cols=34  Identities=21%  Similarity=0.467  Sum_probs=24.2

Q ss_pred             cccccccccccCCCeEEEEeccCCCcccCccCcccccCcccc
Q psy15163         72 KTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELL  113 (176)
Q Consensus        72 ~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l  113 (176)
                      .-|--|+..+. +|+++..       .-...+|+|..|++.|
T Consensus        11 pwcwycnrefd-dekiliq-------hqkakhfkchichkkl   44 (341)
T KOG2893|consen   11 PWCWYCNREFD-DEKILIQ-------HQKAKHFKCHICHKKL   44 (341)
T ss_pred             ceeeecccccc-hhhhhhh-------hhhhccceeeeehhhh
Confidence            37999999987 4555322       2234679999999988


No 120
>PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=21.60  E-value=1.3e+02  Score=18.33  Aligned_cols=50  Identities=14%  Similarity=0.134  Sum_probs=29.7

Q ss_pred             cCcccccCccccCCCceeeeCCcccCHhHHh---hCCCcccccccccccccCceE
Q psy15163        102 QCFVCSTCDELLVDLMYFHYKGNVYCLRDYA---TMLDIPRCHACDELIFVNEYT  153 (176)
Q Consensus       102 ~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~---~~~~~~~C~~C~~~I~~~~~~  153 (176)
                      +-|.|..++..+.+ ......|..|.+..-.   +..+ ..|..++++|....++
T Consensus         3 ~~f~CpIt~~lM~d-PVi~~~G~tyer~~I~~~l~~~~-~~~P~t~~~l~~~~l~   55 (73)
T PF04564_consen    3 DEFLCPITGELMRD-PVILPSGHTYERSAIERWLEQNG-GTDPFTRQPLSESDLI   55 (73)
T ss_dssp             GGGB-TTTSSB-SS-EEEETTSEEEEHHHHHHHHCTTS-SB-TTT-SB-SGGGSE
T ss_pred             cccCCcCcCcHhhC-ceeCCcCCEEcHHHHHHHHHcCC-CCCCCCCCcCCcccce
Confidence            44777777776655 5566778888876554   3334 6898999888665544


No 121
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=21.38  E-value=50  Score=26.12  Aligned_cols=28  Identities=11%  Similarity=0.166  Sum_probs=16.7

Q ss_pred             CCcccccccccccccCceEEeCCCccccCC
Q psy15163        135 LDIPRCHACDELIFVNEYTLAENKTFHVKH  164 (176)
Q Consensus       135 ~~~~~C~~C~~~I~~~~~~~a~~~~~H~~C  164 (176)
                      -+ ..|..|+.+|.. ..+..+...|.|.|
T Consensus       243 ~g-~pCprCG~~I~~-~~~~gR~t~~CP~C  270 (272)
T PRK14810        243 TG-EPCLNCKTPIRR-VVVAGRSSHYCPHC  270 (272)
T ss_pred             CC-CcCCCCCCeeEE-EEECCCccEECcCC
Confidence            35 689999999942 23333444454444


No 122
>PRK10445 endonuclease VIII; Provisional
Probab=21.24  E-value=48  Score=26.05  Aligned_cols=29  Identities=10%  Similarity=0.056  Sum_probs=16.8

Q ss_pred             CCCcccccccccccccCceEEeCCCccccCC
Q psy15163        134 MLDIPRCHACDELIFVNEYTLAENKTFHVKH  164 (176)
Q Consensus       134 ~~~~~~C~~C~~~I~~~~~~~a~~~~~H~~C  164 (176)
                      +.+ ..|..|+.+|.. ..+..+...|.|.|
T Consensus       233 r~g-~~Cp~Cg~~I~~-~~~~gR~t~~CP~C  261 (263)
T PRK10445        233 RDG-EACERCGGIIEK-TTLSSRPFYWCPGC  261 (263)
T ss_pred             CCC-CCCCCCCCEeEE-EEECCCCcEECCCC
Confidence            345 789999999942 22323344444444


No 123
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=21.04  E-value=55  Score=16.25  Aligned_cols=11  Identities=18%  Similarity=0.640  Sum_probs=2.5

Q ss_pred             ccccCccccCC
Q psy15163        105 VCSTCDELLVD  115 (176)
Q Consensus       105 ~C~~C~~~l~~  115 (176)
                      .|..|++++.+
T Consensus         2 ~C~~C~~~~~~   12 (30)
T PF07649_consen    2 RCDACGKPIDG   12 (30)
T ss_dssp             --TTTS----S
T ss_pred             cCCcCCCcCCC
Confidence            44555555443


No 124
>PF11077 DUF2616:  Protein of unknown function (DUF2616);  InterPro: IPR020201 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf52; it is a family of uncharacterised viral proteins.
Probab=21.01  E-value=48  Score=24.51  Aligned_cols=18  Identities=11%  Similarity=0.393  Sum_probs=13.0

Q ss_pred             eeeeCCcccCHhHHhhCC
Q psy15163        118 YFHYKGNVYCLRDYATML  135 (176)
Q Consensus       118 ~~~~~g~~yC~~~y~~~~  135 (176)
                      ++-.+..++|..|+.-+|
T Consensus       154 ~~~F~~~lFC~~ClFPLF  171 (173)
T PF11077_consen  154 FTYFNFNLFCKNCLFPLF  171 (173)
T ss_pred             EEecChhhcccccCcccc
Confidence            555677888888877665


No 125
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=20.65  E-value=43  Score=17.70  Aligned_cols=10  Identities=30%  Similarity=1.042  Sum_probs=3.8

Q ss_pred             cccccccccc
Q psy15163         73 TCKQCGQEVR   82 (176)
Q Consensus        73 ~C~~C~~~i~   82 (176)
                      .|..|++++.
T Consensus         5 ~C~eC~~~f~   14 (34)
T PF01286_consen    5 KCDECGKPFM   14 (34)
T ss_dssp             E-TTT--EES
T ss_pred             hHhHhCCHHH
Confidence            5555555554


No 126
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=20.63  E-value=53  Score=25.93  Aligned_cols=11  Identities=27%  Similarity=0.546  Sum_probs=9.6

Q ss_pred             ccccccccccc
Q psy15163        138 PRCHACDELIF  148 (176)
Q Consensus       138 ~~C~~C~~~I~  148 (176)
                      ..|..|+.+|.
T Consensus       236 ~pC~~Cg~~I~  246 (269)
T PRK14811        236 QPCPRCGTPIE  246 (269)
T ss_pred             CCCCcCCCeeE
Confidence            68999999994


No 127
>PRK11595 DNA utilization protein GntX; Provisional
Probab=20.38  E-value=94  Score=23.69  Aligned_cols=10  Identities=20%  Similarity=0.511  Sum_probs=6.0

Q ss_pred             cccccccccc
Q psy15163         73 TCKQCGQEVR   82 (176)
Q Consensus        73 ~C~~C~~~i~   82 (176)
                      .|..|++.+.
T Consensus         7 ~C~~C~~~~~   16 (227)
T PRK11595          7 LCWLCRMPLA   16 (227)
T ss_pred             cCccCCCccC
Confidence            5666666553


No 128
>PF03854 zf-P11:  P-11 zinc finger;  InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [, , ]. There are two different variants, the C3HC4-type and a C3H2C3-type, which is clearly related despite the different cysteine/histidine pattern. The latter type is sometimes referred to as 'RING-H2 finger'. The RING domain is a protein interaction domain which has been implicated in a range of diverse biological processes. Several 3D-structures for RING-fingers are known [, ]. The 3D structure of the zinc ligation system is unique to the RING domain and is referred to as the 'cross-brace' motif. The spacing of the cysteines in such a domain is:  C-x(2)-C-x(9 to 39)-C-x(1 to 3)-H-x(2 to 3)-C-x(2)-C-x(4 to 48)-C-x(2)-C  Metal ligand pairs one and three co-ordinate to bind one zinc ion, whilst pairs two and four bind the second. This entry represents RING finger protein Z, a small polypeptide found in some negative-strand RNA viruses including Lassa fever virus, which plays a crucial role in virion assembly and budding. RING finger Z has been shown to interact with several host proteins, including promyelocytic leukemia protein and the eukaryotic translation initiation factor 4E [, ]. It is sufficient in the absence of any other viral proteins to release virus-like particles from the infected cell []. This protein is also responsible for arenavirus superinfection exclusion; expression of this protein in a host cell strongly and specifically inhibits areanavirus transcription and replication []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003723 RNA binding, 0008270 zinc ion binding; PDB: 2KO5_A.
Probab=20.15  E-value=1e+02  Score=17.67  Aligned_cols=27  Identities=26%  Similarity=0.515  Sum_probs=15.9

Q ss_pred             CCcccCHhHHhhCCCc-ccccccccccc
Q psy15163        122 KGNVYCLRDYATMLDI-PRCHACDELIF  148 (176)
Q Consensus       122 ~g~~yC~~~y~~~~~~-~~C~~C~~~I~  148 (176)
                      .+..+|..|-..++.. +.|..|++++.
T Consensus        19 ~dHYLCl~CLt~ml~~s~~C~iC~~~LP   46 (50)
T PF03854_consen   19 SDHYLCLNCLTLMLSRSDRCPICGKPLP   46 (50)
T ss_dssp             SS-EEEHHHHHHT-SSSSEETTTTEE--
T ss_pred             cchhHHHHHHHHHhccccCCCcccCcCc
Confidence            4455677776655543 78999988873


Done!