Query         psy15166
Match_columns 90
No_of_seqs    109 out of 134
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 22:15:33 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15166.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15166hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06297 PET:  PET Domain;  Int 100.0 5.8E-31 1.3E-35  181.7   7.0   71   17-87     22-92  (106)
  2 PF06297 PET:  PET Domain;  Int  94.0   0.014 3.1E-07   40.5  -0.1   26    1-26     37-62  (106)
  3 cd06536 CIDE_N_ICAD CIDE_N dom  78.1    0.59 1.3E-05   31.2  -0.3   24   28-51     56-79  (80)
  4 cd06535 CIDE_N_CAD CIDE_N doma  78.1    0.58 1.2E-05   31.1  -0.4   42    8-51     35-76  (77)
  5 cd06539 CIDE_N_A CIDE_N domain  75.3    0.77 1.7E-05   30.6  -0.4   43    8-51     35-77  (78)
  6 cd06538 CIDE_N_FSP27 CIDE_N do  73.2    0.93   2E-05   30.2  -0.4   24   29-52     54-77  (79)
  7 cd06537 CIDE_N_B CIDE_N domain  73.2    0.96 2.1E-05   30.4  -0.3   24   29-52     54-77  (81)
  8 smart00266 CAD Domains present  72.0     1.1 2.5E-05   29.5  -0.2   23   28-50     52-74  (74)
  9 cd01615 CIDE_N CIDE_N domain,   71.2     1.1 2.4E-05   29.7  -0.3   23   29-51     55-77  (78)
 10 PF11304 DUF3106:  Protein of u  56.1     9.5 0.00021   25.9   2.0   26   55-81     73-104 (107)
 11 PF04353 Rsd_AlgQ:  Regulator o  51.4      14 0.00031   27.1   2.4   14   74-87     48-61  (153)
 12 PF02017 CIDE-N:  CIDE-N domain  46.7     1.7 3.7E-05   28.7  -2.7   23   29-51     55-77  (78)
 13 PF06394 Pepsin-I3:  Pepsin inh  39.4      19 0.00041   23.8   1.3   21   67-87     35-55  (76)
 14 PF08599 Nbs1_C:  DNA damage re  37.6      14 0.00031   24.0   0.5   23    4-26     13-37  (65)
 15 PRK11718 anti-RNA polymerase s  36.8      22 0.00047   26.5   1.5   12   76-87     50-61  (161)
 16 cd08776 DED_Caspase-like_repea  32.8      29 0.00063   22.4   1.4   18   70-87     10-27  (71)
 17 PF02877 PARP_reg:  Poly(ADP-ri  26.2 1.1E+02  0.0024   21.1   3.5   38   22-59     66-107 (133)
 18 cd02639 R3H_RRM R3H domain of   25.5      78  0.0017   19.7   2.4   23   67-89     21-43  (60)
 19 cd04388 RhoGAP_p85 RhoGAP_p85:  24.5      97  0.0021   23.2   3.2   18   25-42     70-87  (200)
 20 PF09832 DUF2059:  Uncharacteri  24.3      57  0.0012   19.3   1.6   19   66-84     11-29  (64)
 21 cd04398 RhoGAP_fRGD1 RhoGAP_fR  22.5 1.8E+02   0.004   20.6   4.2   54   25-88     77-139 (192)
 22 cd04393 RhoGAP_FAM13A1a RhoGAP  22.3 1.6E+02  0.0035   21.0   3.8   17   26-42     77-93  (189)
 23 PRK15441 peptidyl-prolyl cis-t  22.1      67  0.0014   20.5   1.7   36   12-47     46-83  (93)
 24 PF04201 TPD52:  Tumour protein  21.9      70  0.0015   23.9   1.9   16   69-84     23-38  (162)
 25 PF08278 DnaG_DnaB_bind:  DNA p  21.9      63  0.0014   21.3   1.6   13   70-82    113-125 (127)
 26 PF13035 DUF3896:  Protein of u  20.7      57  0.0012   20.8   1.1   18   71-88     29-46  (61)
 27 cd04386 RhoGAP_nadrin RhoGAP_n  20.2 2.3E+02  0.0051   20.4   4.4   19   24-42     77-95  (203)
 28 PF12368 DUF3650:  Protein of u  20.0      77  0.0017   17.4   1.4   10   70-79     14-23  (28)

No 1  
>PF06297 PET:  PET Domain;  InterPro: IPR010442 The PET domain is a ~110 amino acid motif in the N-terminal part of LIM domain proteins. The domain was described in Drosophila proteins involved in cell differentiation and is named after Prickle, Espinas and Testin. PET domain proteins contain about three zinc-binding LIM domains (see PDOC00382 from INTERPRO, IPR001781 from INTERPRO) and are found among metazoans. The PET domain has been suggested to play a role in protein-protein interactions with proteins involved in planar polarity signalling or organisation of the cytoskeleton []. Some proteins known to contain a PET domain:   Mammalian testin protein (Q9UGI8 from SWISSPROT), which may function as a tumour suppressor. Mammalian LIM domain only protein 6 (LMO6/Prickle3, O43900 from SWISSPROT). Fruit fly prickle (A1Z6W3 from SWISSPROT) and espinas (Q9U1I1 from SWISSPROT) proteins encoded by the tissue polarity gene prickle (pk), involved in the control of orientation of bristles and hairs.  Mammalian prickle-like proteins 1 (Q96MT3 from SWISSPROT) and 2 (Q7Z3G6 from SWISSPROT).   ; GO: 0008270 zinc ion binding
Probab=99.97  E-value=5.8e-31  Score=181.69  Aligned_cols=71  Identities=35%  Similarity=0.525  Sum_probs=67.9

Q ss_pred             cchhhhhcHHHHHHHHhcCCCCCCCCCCChhHHHHHHHHHHhcCCCCCChhhhcCCCHHHHHHHHHhhhhh
Q psy15166         17 ALYRRQQLEKQAAEYMQQLPAGKLPISGSDGALYRRQQLEKQVPLHDLNANLCHNLTADEIKCEKMECQHM   87 (90)
Q Consensus        17 ~l~~kqQl~e~v~~Ym~~LP~~kvP~~gS~Ge~~R~kQL~~QLP~hD~d~~yC~~LseeE~kel~~~~~~~   87 (90)
                      +|+++...+++|++||++||+++||++||+||+||++||++|||+||+|++||++||++|++++++|+...
T Consensus        22 ~WvPpgl~~~~v~~Ym~~LP~~~vP~~gS~Ge~~R~~QL~~QLP~hD~d~~~C~~Lse~E~k~l~~F~~~r   92 (106)
T PF06297_consen   22 AWVPPGLSPELVEQYMSCLPEEKVPVVGSPGEKYRRRQLLYQLPPHDLDPRYCHSLSEEEKKELEDFVKQR   92 (106)
T ss_pred             eecCCCCChHHHHHHHHhCCCcCCCCCCCHHHHHHHHHHHHcCCcccCCHHHHhhCCHHHHHHHHHHHHHH
Confidence            67888888999999999999999999999999999999999999999999999999999999999999754


No 2  
>PF06297 PET:  PET Domain;  InterPro: IPR010442 The PET domain is a ~110 amino acid motif in the N-terminal part of LIM domain proteins. The domain was described in Drosophila proteins involved in cell differentiation and is named after Prickle, Espinas and Testin. PET domain proteins contain about three zinc-binding LIM domains (see PDOC00382 from INTERPRO, IPR001781 from INTERPRO) and are found among metazoans. The PET domain has been suggested to play a role in protein-protein interactions with proteins involved in planar polarity signalling or organisation of the cytoskeleton []. Some proteins known to contain a PET domain:   Mammalian testin protein (Q9UGI8 from SWISSPROT), which may function as a tumour suppressor. Mammalian LIM domain only protein 6 (LMO6/Prickle3, O43900 from SWISSPROT). Fruit fly prickle (A1Z6W3 from SWISSPROT) and espinas (Q9U1I1 from SWISSPROT) proteins encoded by the tissue polarity gene prickle (pk), involved in the control of orientation of bristles and hairs.  Mammalian prickle-like proteins 1 (Q96MT3 from SWISSPROT) and 2 (Q7Z3G6 from SWISSPROT).   ; GO: 0008270 zinc ion binding
Probab=94.02  E-value=0.014  Score=40.46  Aligned_cols=26  Identities=50%  Similarity=0.778  Sum_probs=23.4

Q ss_pred             CCCCCCCCCCCCCCCccchhhhhcHH
Q psy15166          1 MQQLPAGKLPISGSDGALYRRQQLEK   26 (90)
Q Consensus         1 ~~~l~~~~~p~~gSD~~l~~kqQl~e   26 (90)
                      |++|+.-+||+.||+|+..|+.||..
T Consensus        37 m~~LP~~~vP~~gS~Ge~~R~~QL~~   62 (106)
T PF06297_consen   37 MSCLPEEKVPVVGSPGEKYRRRQLLY   62 (106)
T ss_pred             HHhCCCcCCCCCCCHHHHHHHHHHHH
Confidence            68899999999999999999988754


No 3  
>cd06536 CIDE_N_ICAD CIDE_N domain of ICAD. The CIDE_N  (cell death-inducing DFF45-like effector, N-terminal) domain is found at the N-terminus of the CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD (DFF45). These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of the CAD/DFF40 and ICAD/DFF45 during apoptosis. In normal cells, DFF exists in the nucleus as a heterodimer composed of CAD/DFF40 as a latent nuclease and its chaperone and inhibitor subunit ICAD/DFF45. Apoptotic activation of caspase-3 results in the cleavage of DFF45/ICAD and release of active DFF40/CAD nuclease.
Probab=78.09  E-value=0.59  Score=31.21  Aligned_cols=24  Identities=13%  Similarity=0.231  Sum_probs=21.7

Q ss_pred             HHHHHhcCCCCCCCCCCChhHHHH
Q psy15166         28 AAEYMQQLPAGKLPISGSDGALYR   51 (90)
Q Consensus        28 v~~Ym~~LP~~kvP~~gS~Ge~~R   51 (90)
                      =++||.+||.+-+=++=.+|++|+
T Consensus        56 dEeyF~tLp~nT~l~~L~~gq~W~   79 (80)
T cd06536          56 DEDYFLCLPPNTKFVLLAENEKWA   79 (80)
T ss_pred             cHHHHhhCCCCcEEEEECCCCccC
Confidence            379999999999999999999885


No 4  
>cd06535 CIDE_N_CAD CIDE_N domain of CAD nuclease. The CIDE_N (cell death-inducing DFF45-like effector, N-terminal) domain is found at the N-terminus of CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD(DFF45). These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of CAD/DFF40 and ICAD/DFF45 during apoptosis. In normal cells, DFF exists in the nucleus as a heterodimer composed of CAD/DFF40 as a latent nuclease and its chaperone and inhibitor subunit ICAD/DFF45. Apoptotic activation of caspase-3 results in the cleavage of DFF45/ICAD and the release of active DFF40/CAD nuclease.
Probab=78.09  E-value=0.58  Score=31.12  Aligned_cols=42  Identities=26%  Similarity=0.404  Sum_probs=28.7

Q ss_pred             CCCCCCCCccchhhhhcHHHHHHHHhcCCCCCCCCCCChhHHHH
Q psy15166          8 KLPISGSDGALYRRQQLEKQAAEYMQQLPAGKLPISGSDGALYR   51 (90)
Q Consensus         8 ~~p~~gSD~~l~~kqQl~e~v~~Ym~~LP~~kvP~~gS~Ge~~R   51 (90)
                      +||..++-..|.-=+.--+  ++||.+||.+-+=++=.+|++|+
T Consensus        35 ~l~~~~~~l~L~eDGTeVt--EeyF~tLp~nT~lmvL~~gq~W~   76 (77)
T cd06535          35 QLPCAGSRLCLYEDGTEVT--EEYFPTLPDNTELVLLTPGQSWQ   76 (77)
T ss_pred             CCCCCCcEEEEecCCcEeh--HHHHhcCCCCcEEEEEcCCCccC
Confidence            3444444444433333332  79999999999999999999885


No 5  
>cd06539 CIDE_N_A CIDE_N domain of CIDE-A proteins. The CIDE_N (cell death-inducing DFF45-like effector, N-terminal) domain is found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins. These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of the CAD/DFF40, ICAD/DFF45, and CIDE nucleases during apoptosis. The CIDE protein family includes 3 members: CIDE-A, CIDE-B, and FSP27(CIDE-C).  Based on sequence similarity with DFF40 and DFF45, the CIDE proteins were initially characterized as mitochondrial activators of apoptosis. However, strong metabolic phenotypes of mice lacking CIDE-A and CIDE-B indicated that this family may play critical roles in energy balance.
Probab=75.25  E-value=0.77  Score=30.59  Aligned_cols=43  Identities=12%  Similarity=0.060  Sum_probs=28.7

Q ss_pred             CCCCCCCCccchhhhhcHHHHHHHHhcCCCCCCCCCCChhHHHH
Q psy15166          8 KLPISGSDGALYRRQQLEKQAAEYMQQLPAGKLPISGSDGALYR   51 (90)
Q Consensus         8 ~~p~~gSD~~l~~kqQl~e~v~~Ym~~LP~~kvP~~gS~Ge~~R   51 (90)
                      +||.+++-..|.-=+.--+ =++||.+||.+.+=++=..|++|+
T Consensus        35 ~~~~~~~~lvL~eDGT~Vd-~EeyF~~LpdnT~lm~L~~gq~W~   77 (78)
T cd06539          35 VITSGLVTLVLEEDGTVVD-TEEFFQTLGDNTHFMVLEKGQKWT   77 (78)
T ss_pred             CCCCCCcEEEEeCCCCEEc-cHHHHhhCCCCCEEEEECCCCccC
Confidence            4454444444433322221 379999999999999999999885


No 6  
>cd06538 CIDE_N_FSP27 CIDE_N domain of FSP27 proteins. The CIDE-N (cell death-inducing DFF45-like effector, N-terminal) domain is found in the FSP27/CIDE-C protein, which has been identified as a n adipocyte lipid droplet protein that negatively regulates lipolysis and promotes triglyceride accumulation. The CIDE protein family includes 3 members: CIDE-A, CIDE-B, and FSP27(CIDE-C). Based on sequence similarity with DFF40 and DFF45, CIDE proteins were initially characterized as mitochondrial activators of apoptosis. The CIDE-N domain of FSP27 is sufficient to increase apoptosis in vitro when overexpressed.
Probab=73.23  E-value=0.93  Score=30.23  Aligned_cols=24  Identities=17%  Similarity=0.328  Sum_probs=21.8

Q ss_pred             HHHHhcCCCCCCCCCCChhHHHHH
Q psy15166         29 AEYMQQLPAGKLPISGSDGALYRR   52 (90)
Q Consensus        29 ~~Ym~~LP~~kvP~~gS~Ge~~R~   52 (90)
                      ++||.+||.+.+=++=.+|++|+.
T Consensus        54 EeyF~tLp~nt~l~vL~~gq~W~p   77 (79)
T cd06538          54 EEFFQALADNTVFMVLGKGQKWKP   77 (79)
T ss_pred             HHHHhhCCCCcEEEEECCCCccCC
Confidence            789999999999999999999863


No 7  
>cd06537 CIDE_N_B CIDE_N domain of CIDE-B proteins. The CIDE_N (cell death-inducing DFF45-like effector, N-terminal) domain is found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins. These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of the CAD/DFF40,  ICAD/DFF45 and CIDE nucleases during apoptosis. The CIDE protein family includes 3 members: CIDE-A, CIDE-B, and FSP27(CIDE-C).  Based on sequence similarity with DFF40 and DFF45, CIDE proteins were initially characterized as mitochondrial activators of apoptosis. However, strong metabolic phenotypes of mice lacking CIDE-A and CIDE-B indicated that this family may play critical roles in energy balance.
Probab=73.20  E-value=0.96  Score=30.37  Aligned_cols=24  Identities=8%  Similarity=0.205  Sum_probs=22.0

Q ss_pred             HHHHhcCCCCCCCCCCChhHHHHH
Q psy15166         29 AEYMQQLPAGKLPISGSDGALYRR   52 (90)
Q Consensus        29 ~~Ym~~LP~~kvP~~gS~Ge~~R~   52 (90)
                      ++||.+||.+-+=++=..|++|+.
T Consensus        54 EeyF~tLpdnT~lm~L~~gq~W~p   77 (81)
T cd06537          54 EDFFELLEDDTCLMVLEQGQSWSP   77 (81)
T ss_pred             HHHHhhCCCCCEEEEECCCCccCC
Confidence            789999999999999999999874


No 8  
>smart00266 CAD Domains present in proteins implicated in post-mortem DNA fragmentation.
Probab=72.04  E-value=1.1  Score=29.46  Aligned_cols=23  Identities=26%  Similarity=0.445  Sum_probs=19.8

Q ss_pred             HHHHHhcCCCCCCCCCCChhHHH
Q psy15166         28 AAEYMQQLPAGKLPISGSDGALY   50 (90)
Q Consensus        28 v~~Ym~~LP~~kvP~~gS~Ge~~   50 (90)
                      =++||.+||.+-+=++=.+|++|
T Consensus        52 dEeyF~tLp~nt~l~~L~~gq~W   74 (74)
T smart00266       52 DEEYFQTLPDNTELMALEKGEKW   74 (74)
T ss_pred             cHHHHhcCCCCcEEEEEcCCCCC
Confidence            37899999999998888888875


No 9  
>cd01615 CIDE_N CIDE_N domain, found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins, as well as CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD(DFF45). These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of ICAD/DFF45, and the CAD/DFF40 and CIDE nucleases during apoptosis. The CIDE-N domain is also found in the FSP27/CIDE-C protein.
Probab=71.23  E-value=1.1  Score=29.66  Aligned_cols=23  Identities=26%  Similarity=0.446  Sum_probs=20.8

Q ss_pred             HHHHhcCCCCCCCCCCChhHHHH
Q psy15166         29 AEYMQQLPAGKLPISGSDGALYR   51 (90)
Q Consensus        29 ~~Ym~~LP~~kvP~~gS~Ge~~R   51 (90)
                      ++||.+||.+-+=++-.+|++|.
T Consensus        55 EeYF~tLp~nT~l~~l~~gq~W~   77 (78)
T cd01615          55 EEYFQTLPDNTVLMLLEPGQKWT   77 (78)
T ss_pred             HHHHhcCCCCcEEEEECCCCCcC
Confidence            78999999999999999998874


No 10 
>PF11304 DUF3106:  Protein of unknown function (DUF3106);  InterPro: IPR021455  Some members in this family of proteins are annotated as transmembrane proteins however this cannot be confirmed. Currently no function is known. 
Probab=56.07  E-value=9.5  Score=25.92  Aligned_cols=26  Identities=19%  Similarity=0.239  Sum_probs=20.1

Q ss_pred             HHHhcCCCCCC------hhhhcCCCHHHHHHHH
Q psy15166         55 LEKQVPLHDLN------ANLCHNLTADEIKCEK   81 (90)
Q Consensus        55 L~~QLP~hD~d------~~yC~~LseeE~kel~   81 (90)
                      -+.+||+.+..      -.| ..|+++|++.|+
T Consensus        73 ~~~~Lpp~qR~~lr~~w~~y-q~l~~eeR~~l~  104 (107)
T PF11304_consen   73 RFKQLPPEQRQALRARWEAY-QQLPPEERQALR  104 (107)
T ss_pred             HHHcCCHHHHHHHHHHHHHH-HcCCHHHHHHHH
Confidence            35688888777      344 799999999986


No 11 
>PF04353 Rsd_AlgQ:  Regulator of RNA polymerase sigma(70) subunit, Rsd/AlgQ;  InterPro: IPR007448 This family includes bacterial transcriptional regulators that are thought to act through an interaction with the conserved region 4 of the sigma(70) subunit of RNA polymerase. The Pseudomonas aeruginosa homologue, AlgQ, positively regulates virulence gene expression and is associated with the mucoid phenotype observed in P. aeruginosa isolates from cystic fibrosis patients.; GO: 0006355 regulation of transcription, DNA-dependent; PDB: 2P7V_A.
Probab=51.42  E-value=14  Score=27.12  Aligned_cols=14  Identities=14%  Similarity=0.195  Sum_probs=8.6

Q ss_pred             HHHHHHHHHhhhhh
Q psy15166         74 ADEIKCEKMECQHM   87 (90)
Q Consensus        74 eeE~kel~~~~~~~   87 (90)
                      .-..++|+-|||+.
T Consensus        48 ~~~~~~l~~FCq~L   61 (153)
T PF04353_consen   48 LPSEEALQNFCQQL   61 (153)
T ss_dssp             ----HHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHH
Confidence            34678899999974


No 12 
>PF02017 CIDE-N:  CIDE-N domain;  InterPro: IPR003508 This domain consists of caspase-activated (CAD) nucleases, which induce DNA fragmentation and chromatin condensation during apoptosis, and the cell death activator proteins CIDE-A and CIDE-B, which are inhibitors of CAD nuclease. The two proteins interact through the region defined by the method signatures.; GO: 0006915 apoptosis, 0005622 intracellular; PDB: 1IBX_A 2EEL_A 1F2R_I 1C9F_A 1D4B_A.
Probab=46.74  E-value=1.7  Score=28.72  Aligned_cols=23  Identities=26%  Similarity=0.466  Sum_probs=17.9

Q ss_pred             HHHHhcCCCCCCCCCCChhHHHH
Q psy15166         29 AEYMQQLPAGKLPISGSDGALYR   51 (90)
Q Consensus        29 ~~Ym~~LP~~kvP~~gS~Ge~~R   51 (90)
                      ++||.+||.+-+=++=..|++|+
T Consensus        55 EeyF~tLp~nT~lm~L~~ge~W~   77 (78)
T PF02017_consen   55 EEYFQTLPDNTVLMLLEKGEKWT   77 (78)
T ss_dssp             CHHHCCSSSSEEEEEEESSS--S
T ss_pred             HHHHhhCCCCCEEEEECCCCccC
Confidence            47999999998888888888774


No 13 
>PF06394 Pepsin-I3:  Pepsin inhibitor-3-like repeated domain;  InterPro: IPR010480 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  The members of this group of proteins belong to MEROPS inhibitor family I33, clan IR; the nematode aspartyl protease inhibitors or Aspins. They are restricted to parasitic nematode species. Structural features common to the nematode Aspins include the presence of a signal peptide sequence and the conservation of all four cysteine residues in the mature protein. The Y[V.A]RDLT sequence motif has been suggested as being of crucial functional importance in several filarial nematode inhibitors [], this sequence is not conserved in Tco-API-1 from Trichostrongylus colubriformis (Black scour worm) and it has been demonstrated that Tco-API-1, is not an Aspin as it does not inhibit porcine pepsin []. Related inhibitors from Onchocerca volvulus, Ov33 [] and Ascaris suum (Pig roundworm), PI-3 [] inhibit the in vitro activity of aspartyl proteases such as pepsin and cathepsin E (MEROPS peptidase family A1).  Aspin may facilitate the safe passage of the eggs of Ascaris through the host stomach without digestion by pepsin [, ]. The other parasitic nematodes known to express homologous proteins do not pass through the stomach of their hosts []. Several proteins in the family are potent allergens in mammals. The three-dimensional structures of pepsin inhibitor-3 (PI-3) from A. suum and of the complex between PI-3 and porcine pepsin at 1. 75 A and 2.45 A resolution, respectively, have revealed the mechanism of aspartic protease inhibition. PI-3 has a new fold consisting of two identical domains, each comprising an antiparallel beta-sheet flanked by an alpha-helix. In the enzyme-inhibitor complex, the N-terminal beta-strand of PI-3 pairs with one strand of the 'active site flap' (residues 70-82) of pepsin, thus forming an eight-stranded beta-sheet that spans the two proteins. PI-3 has a novel mode of inhibition, using its N-terminal residues to occupy and therefore block the first three binding pockets in pepsin for substrate residues C-terminal to the scissile bond (S1'-S3') [].; PDB: 1F32_A 1F34_B.
Probab=39.37  E-value=19  Score=23.77  Aligned_cols=21  Identities=24%  Similarity=0.227  Sum_probs=15.4

Q ss_pred             hhhcCCCHHHHHHHHHhhhhh
Q psy15166         67 NLCHNLTADEIKCEKMECQHM   87 (90)
Q Consensus        67 ~yC~~LseeE~kel~~~~~~~   87 (90)
                      .|-+.||++|++||+.|-.-+
T Consensus        35 ~~~R~Lt~~E~~eL~~y~~~v   55 (76)
T PF06394_consen   35 KYARDLTPDEQQELKTYQKKV   55 (76)
T ss_dssp             CEEEE--HHHHHHHHHHHHHH
T ss_pred             EeeccCCHHHHHHHHHHHHHH
Confidence            456789999999999987654


No 14 
>PF08599 Nbs1_C:  DNA damage repair protein Nbs1;  InterPro: IPR013908  This C-terminal region of the DNA damage repair protein Nbs1 has been identified to be necessary for the binding of Mre11 and Tel1 []. 
Probab=37.63  E-value=14  Score=24.00  Aligned_cols=23  Identities=35%  Similarity=0.346  Sum_probs=17.5

Q ss_pred             CCCCCCC--CCCCCccchhhhhcHH
Q psy15166          4 LPAGKLP--ISGSDGALYRRQQLEK   26 (90)
Q Consensus         4 l~~~~~p--~~gSD~~l~~kqQl~e   26 (90)
                      -|+..+|  ++|||.+-.-+..+.+
T Consensus        13 pGa~~lP~IIGGSDLi~h~~~knse   37 (65)
T PF08599_consen   13 PGAGGLPHIIGGSDLIAHHAGKNSE   37 (65)
T ss_pred             CCCCCCCeeecchhhhhcccccccc
Confidence            4777888  8999998776665554


No 15 
>PRK11718 anti-RNA polymerase sigma 70 factor; Provisional
Probab=36.77  E-value=22  Score=26.51  Aligned_cols=12  Identities=25%  Similarity=0.218  Sum_probs=8.6

Q ss_pred             HHHHHHHhhhhh
Q psy15166         76 EIKCEKMECQHM   87 (90)
Q Consensus        76 E~kel~~~~~~~   87 (90)
                      ..+.|+-|||+.
T Consensus        50 ~~~~l~~FC~~L   61 (161)
T PRK11718         50 NEKALDDFCQLL   61 (161)
T ss_pred             CHHHHHHHHHHH
Confidence            456788888863


No 16 
>cd08776 DED_Caspase-like_repeat1 Death effector domain, repeat 1, of initator caspase-like proteins. Death Effector Domain (DED), first repeat, found in initator caspase-like proteins, like caspase-8 and -10 and c-FLIP. Caspases are aspartate-specific cysteine proteases with functions in apoptosis and immune signaling. Initiator caspases are the first to be activated following death- or inflammation-inducing signals. Caspase-8 and -10 are the initiators of death receptor mediated apoptosis. Together with FADD and the pseudo-caspase c-FLIP, they form the death-inducing signaling complex (DISC), whose formation is triggered by the activation of type 1 tumor necrosis factor (TNF) receptors such as Fas, TNF receptor 1, and TRAIL receptor. Caspase-8 and -10 also play important functions in cell adhesion and motility. c-FLIP is a catalytically inactive homolog of the initator procaspases-8 and -10. It negatively influences apoptotic signaling by interfering with the efficient formation of DI
Probab=32.82  E-value=29  Score=22.42  Aligned_cols=18  Identities=17%  Similarity=0.086  Sum_probs=15.9

Q ss_pred             cCCCHHHHHHHHHhhhhh
Q psy15166         70 HNLTADEIKCEKMECQHM   87 (90)
Q Consensus        70 ~~LseeE~kel~~~~~~~   87 (90)
                      .+|+++|...++-+|.|.
T Consensus        10 ~~L~~~e~~~lkFLC~d~   27 (71)
T cd08776          10 EKLGTDEREVLLFLLNVF   27 (71)
T ss_pred             HHcCHHHHHHHHHHcccc
Confidence            479999999999999874


No 17 
>PF02877 PARP_reg:  Poly(ADP-ribose) polymerase, regulatory domain;  InterPro: IPR004102 Poly(ADP-ribose) polymerase catalyses the covalent attachment of ADP-ribose units from NAD+ to itself and to a limited number of other DNA binding proteins, which decreases their affinity for DNA. Poly(ADP-ribose) polymerase is a regulatory component induced by DNA damage. The regulatory domain of the polymerase is almost always associated with the C-terminal catalytic domain (see IPR001290 from INTERPRO). This domain consists of a duplication of two helix-loop-helix structural repeats [].; GO: 0003950 NAD+ ADP-ribosyltransferase activity, 0006471 protein ADP-ribosylation; PDB: 1GS0_B 3FHB_A 3C49_A 3CE0_A 3C4H_A 3KCZ_B 3KJD_B 3L3M_A 3GJW_A 1UK1_A ....
Probab=26.16  E-value=1.1e+02  Score=21.06  Aligned_cols=38  Identities=13%  Similarity=0.378  Sum_probs=26.0

Q ss_pred             hhcHHHHHHHHhcCCCC----CCCCCCChhHHHHHHHHHHhc
Q psy15166         22 QQLEKQAAEYMQQLPAG----KLPISGSDGALYRRQQLEKQV   59 (90)
Q Consensus        22 qQl~e~v~~Ym~~LP~~----kvP~~gS~Ge~~R~kQL~~QL   59 (90)
                      ..+.++-.+||+.+|-.    ..|+.+|.-.-.++.+|+.-|
T Consensus        66 ~~i~~lsn~fYtlIPh~fg~~~~~~I~~~~~l~~k~~lle~L  107 (133)
T PF02877_consen   66 SKIEDLSNRFYTLIPHNFGRSRPPVIDTEEKLKEKLELLEAL  107 (133)
T ss_dssp             HHHHHHHHHHHHHSTB-STTS-S--STSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCcccCCCCCCcCCHHHHHHHHHHHHHH
Confidence            44566788999999976    778888888887777776544


No 18 
>cd02639 R3H_RRM R3H domain of mainly fungal proteins which are associated with a RNA recognition motif (RRM) domain. Present in this group is the RNA-binding post-transcriptional regulator Cip2 (Csx1-interacting protein 2) involved in counteracting Csx1 function. Csx1 plays a central role in controlling gene expression during oxidative stress. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=25.46  E-value=78  Score=19.68  Aligned_cols=23  Identities=9%  Similarity=0.182  Sum_probs=19.1

Q ss_pred             hhhcCCCHHHHHHHHHhhhhhcc
Q psy15166         67 NLCHNLTADEIKCEKMECQHMEM   89 (90)
Q Consensus        67 ~yC~~LseeE~kel~~~~~~~~~   89 (90)
                      .+=.+||++|++-+...|+.|-+
T Consensus        21 ~Fp~~ls~~eRriih~la~~lGL   43 (60)
T cd02639          21 AFPSSLSPAERRIVHLLASRLGL   43 (60)
T ss_pred             EcCCCCCHHHHHHHHHHHHHcCC
Confidence            34468999999999999998754


No 19 
>cd04388 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in the p85 isoforms of the regulatory subunit of the class IA PI3K (phosphatidylinositol 3'-kinase). This domain is also called Bcr (breakpoint cluster region protein) homology (BH) domain. Class IA PI3Ks are heterodimers, containing a regulatory subunit (p85) and a catalytic subunit (p110) and are activated by growth factor receptor tyrosine kinases (RTKs); this activation is mediated by the p85 subunit. p85 isoforms, alpha and beta, contain a C-terminal p110-binding domain flanked by two SH2 domains, an N-terminal SH3 domain, and a RhoGAP domain flanked by two proline-rich regions. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell p
Probab=24.48  E-value=97  Score=23.22  Aligned_cols=18  Identities=22%  Similarity=0.493  Sum_probs=15.4

Q ss_pred             HHHHHHHHhcCCCCCCCC
Q psy15166         25 EKQAAEYMQQLPAGKLPI   42 (90)
Q Consensus        25 ~e~v~~Ym~~LP~~kvP~   42 (90)
                      -..+..||..||+--+|.
T Consensus        70 a~~LK~ylReLPePLip~   87 (200)
T cd04388          70 ADALKRYLLDLPNPVIPA   87 (200)
T ss_pred             HHHHHHHHHhCCCccCCH
Confidence            446889999999999995


No 20 
>PF09832 DUF2059:  Uncharacterized protein conserved in bacteria (DUF2059);  InterPro: IPR018637  This entry contains proteins that have no known function. ; PDB: 2X3O_B 3OAO_A.
Probab=24.28  E-value=57  Score=19.30  Aligned_cols=19  Identities=11%  Similarity=0.078  Sum_probs=15.3

Q ss_pred             hhhhcCCCHHHHHHHHHhh
Q psy15166         66 ANLCHNLTADEIKCEKMEC   84 (90)
Q Consensus        66 ~~yC~~LseeE~kel~~~~   84 (90)
                      ..|..++|++|.+.+--|=
T Consensus        11 ~~y~~~ft~~El~~i~~FY   29 (64)
T PF09832_consen   11 PIYAEHFTEEELDAILAFY   29 (64)
T ss_dssp             HHHHHHS-HHHHHHHHHHH
T ss_pred             HHHHHHCCHHHHHHHHHHH
Confidence            5689999999999988773


No 21 
>cd04398 RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins. Yeast Rgd1 is a GAP protein for Rho3 and Rho4 and plays a role in low-pH response. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=22.46  E-value=1.8e+02  Score=20.55  Aligned_cols=54  Identities=17%  Similarity=0.228  Sum_probs=31.5

Q ss_pred             HHHHHHHHhcCCCCCCCCC---------CChhHHHHHHHHHHhcCCCCCChhhhcCCCHHHHHHHHHhhhhhc
Q psy15166         25 EKQAAEYMQQLPAGKLPIS---------GSDGALYRRQQLEKQVPLHDLNANLCHNLTADEIKCEKMECQHME   88 (90)
Q Consensus        25 ~e~v~~Ym~~LP~~kvP~~---------gS~Ge~~R~kQL~~QLP~hD~d~~yC~~LseeE~kel~~~~~~~~   88 (90)
                      -..+..||..||+.-+|..         ...+...|..++.          ..+..|...-+..|+-++.|+.
T Consensus        77 a~~LK~fLreLp~pLi~~~~~~~~~~~~~~~~~~~~~~~l~----------~li~~LP~~n~~~L~~l~~~L~  139 (192)
T cd04398          77 ASLLKLFFRELPEPLLTKALSREFIEAAKIEDESRRRDALH----------GLINDLPDANYATLRALMFHLA  139 (192)
T ss_pred             HHHHHHHHHhCCCccCCHHHHHHHHHHHhCCCHHHHHHHHH----------HHHHHCCHHHHHHHHHHHHHHH
Confidence            3468899999999888852         1111222222111          2355666667777777777653


No 22 
>cd04393 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins. The function of FAM13A1a is unknown. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by up several orders of magnitude.
Probab=22.32  E-value=1.6e+02  Score=21.04  Aligned_cols=17  Identities=29%  Similarity=0.626  Sum_probs=14.5

Q ss_pred             HHHHHHHhcCCCCCCCC
Q psy15166         26 KQAAEYMQQLPAGKLPI   42 (90)
Q Consensus        26 e~v~~Ym~~LP~~kvP~   42 (90)
                      ..+..||..||+.-+|.
T Consensus        77 ~~lK~flr~Lp~pLi~~   93 (189)
T cd04393          77 SLLRLFLQELPEGLIPA   93 (189)
T ss_pred             HHHHHHHHhCCCccCCH
Confidence            47889999999988875


No 23 
>PRK15441 peptidyl-prolyl cis-trans isomerase C; Provisional
Probab=22.09  E-value=67  Score=20.47  Aligned_cols=36  Identities=19%  Similarity=0.249  Sum_probs=26.6

Q ss_pred             CCCCccchhhhhcHHHHHHHHhcCCCCCC--CCCCChh
Q psy15166         12 SGSDGALYRRQQLEKQAAEYMQQLPAGKL--PISGSDG   47 (90)
Q Consensus        12 ~gSD~~l~~kqQl~e~v~~Ym~~LP~~kv--P~~gS~G   47 (90)
                      .|-|.-|....+++..+.+....||...+  |+...-|
T Consensus        46 ~gG~lg~~~~~~l~~~f~~a~~~l~~G~vs~Pi~t~~G   83 (93)
T PRK15441         46 RGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFG   83 (93)
T ss_pred             cCccceeecccccCHHHHHHHHhCCCCCcCCcEEcCCE
Confidence            34466777788888888888888998887  6654433


No 24 
>PF04201 TPD52:  Tumour protein D52 family;  InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma. Cloning of D52 homologues from other species has indicated that D52 may play roles in calcium-mediated signal transduction and cell proliferation. Two human homologues of hD52, hD53 and hD54, have also been identified, demonstrating the existence of a novel gene/protein family []. These proteins have an N-terminal coiled-coil that allows members to form homo- and heterodimers with each other [].
Probab=21.94  E-value=70  Score=23.93  Aligned_cols=16  Identities=19%  Similarity=0.127  Sum_probs=13.4

Q ss_pred             hcCCCHHHHHHHHHhh
Q psy15166         69 CHNLTADEIKCEKMEC   84 (90)
Q Consensus        69 C~~LseeE~kel~~~~   84 (90)
                      +..|||+|+.|||.+-
T Consensus        23 ~~~LsEeE~eeLr~EL   38 (162)
T PF04201_consen   23 EEGLSEEEREELRSEL   38 (162)
T ss_pred             cccCCHHHHHHHHHHH
Confidence            4689999999998764


No 25 
>PF08278 DnaG_DnaB_bind:  DNA primase DnaG DnaB-binding ;  InterPro: IPR013173 Eubacterial DnaG primases interact with several factors to form the replisome. One of these factors is DnaB, a helicase. This domain has been demonstrated to be responsible for the interaction between DnaG and DnaB []. This domain has a multi-helical structure that forms an orthogonal bundle [].; GO: 0003896 DNA primase activity, 0006269 DNA replication, synthesis of RNA primer; PDB: 2HAJ_A 1T3W_B.
Probab=21.91  E-value=63  Score=21.28  Aligned_cols=13  Identities=23%  Similarity=0.158  Sum_probs=8.6

Q ss_pred             cCCCHHHHHHHHH
Q psy15166         70 HNLTADEIKCEKM   82 (90)
Q Consensus        70 ~~LseeE~kel~~   82 (90)
                      ..||++|+++|+.
T Consensus       113 ~~Lt~eEk~el~~  125 (127)
T PF08278_consen  113 GGLTDEEKQELRR  125 (127)
T ss_dssp             T---HHHHHHHHH
T ss_pred             CCcCHHHHHHHHH
Confidence            6799999999875


No 26 
>PF13035 DUF3896:  Protein of unknown function (DUF3896)
Probab=20.65  E-value=57  Score=20.80  Aligned_cols=18  Identities=28%  Similarity=0.344  Sum_probs=14.7

Q ss_pred             CCCHHHHHHHHHhhhhhc
Q psy15166         71 NLTADEIKCEKMECQHME   88 (90)
Q Consensus        71 ~LseeE~kel~~~~~~~~   88 (90)
                      .||++|+..++++-...|
T Consensus        29 ~ls~~er~qi~~eidnye   46 (61)
T PF13035_consen   29 HLSEKEREQIKLEIDNYE   46 (61)
T ss_pred             ccCHHHHHHHHhhhhhHH
Confidence            688999999999876554


No 27 
>cd04386 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins. Nadrin, also named Rich-1, has been shown to be involved in the regulation of Ca2+-dependent exocytosis in neurons and recently has been implicated in tight junction maintenance in mammalian epithelium. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=20.23  E-value=2.3e+02  Score=20.42  Aligned_cols=19  Identities=21%  Similarity=0.441  Sum_probs=15.3

Q ss_pred             cHHHHHHHHhcCCCCCCCC
Q psy15166         24 LEKQAAEYMQQLPAGKLPI   42 (90)
Q Consensus        24 l~e~v~~Ym~~LP~~kvP~   42 (90)
                      .-..+..|+..||+.-+|.
T Consensus        77 va~~lK~fLreLp~pli~~   95 (203)
T cd04386          77 VASALKSYLRELPDPLLTY   95 (203)
T ss_pred             HHHHHHHHHHhCCCccCCH
Confidence            3457889999999988876


No 28 
>PF12368 DUF3650:  Protein of unknown function (DUF3650) ;  InterPro: IPR022111  This domain family is found in bacteria, and is approximately 30 amino acids in length. The family is found in association with PF00581 from PFAM. There is a single completely conserved residue N that may be functionally important. 
Probab=20.05  E-value=77  Score=17.42  Aligned_cols=10  Identities=30%  Similarity=0.597  Sum_probs=7.8

Q ss_pred             cCCCHHHHHH
Q psy15166         70 HNLTADEIKC   79 (90)
Q Consensus        70 ~~LseeE~ke   79 (90)
                      |+||++|..+
T Consensus        14 h~ls~ee~~~   23 (28)
T PF12368_consen   14 HGLSEEEVAE   23 (28)
T ss_pred             cCCCHHHHHH
Confidence            6799988764


Done!