Query         psy15178
Match_columns 103
No_of_seqs    116 out of 369
Neff          6.1 
Searched_HMMs 46136
Date          Fri Aug 16 22:31:38 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15178.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15178hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PHA02748 viral inexin-like pro 100.0 6.8E-40 1.5E-44  259.6   6.6   97    1-99     33-129 (360)
  2 PF00876 Innexin:  Innexin;  In 100.0 2.8E-36   6E-41  236.7   6.5   92    1-100    14-108 (348)
  3 PF08038 Tom7:  TOM7 family;  I  55.6     8.7 0.00019   21.9   1.5   16   72-87     11-26  (42)
  4 KOG4449|consensus               48.2     9.5  0.0002   22.8   0.9   15   73-87     19-33  (53)
  5 PF05640 NKAIN:  Na,K-Atpase In  23.9      55  0.0012   24.6   1.7   16   78-93     32-47  (200)
  6 PF12306 PixA:  Inclusion body   21.7      27 0.00058   25.1  -0.3   14   71-84    156-169 (172)
  7 PF08115 Toxin_28:  SFI toxin f  21.5      25 0.00054   19.2  -0.4    8   34-41      7-14  (35)
  8 COG1981 Predicted membrane pro  21.4      63  0.0014   23.2   1.5   17   83-99     18-34  (149)
  9 PF02404 SCF:  Stem cell factor  17.4      52  0.0011   25.9   0.4   39    3-41     16-72  (273)
 10 PF05283 MGC-24:  Multi-glycosy  16.7   1E+02  0.0022   22.8   1.8   21   75-95    161-181 (186)

No 1  
>PHA02748 viral inexin-like protein; Provisional
Probab=100.00  E-value=6.8e-40  Score=259.56  Aligned_cols=97  Identities=37%  Similarity=0.701  Sum_probs=88.0

Q ss_pred             ChhhHHHHHHhhhhhcCCCcccccCCCCChhhhhhhhhhheeeEEeccccccccccccCCCCCCCCCCcccceeeeeccc
Q psy15178          1 MILIAFSLIVTTRQYVGNPIDCVHTKDIPEDVLNTYCWIHSTYTIRAAFKKKVGVAVPYPGVDNSRGKVEDRKTYGYYHL   80 (103)
Q Consensus         1 ~iL~~~s~Lvt~kqy~G~PI~C~~~~~~~~~y~~~yCwi~~Ty~v~~~~~~~~~~~~p~pg~~~~~~~~~~~~~~~YYQW   80 (103)
                      +||++||+|+|+|||||+||+||.| +.+++|+|+||||||||+++++.+...++++|+||++. +.+++++++++||||
T Consensus        33 ~iL~~~silvs~kQy~G~PI~C~~p-~~~~~~~n~yCwi~~Ty~v~~~~~~~~~~~~~~~~~~~-~~~~~~~~~i~YYQW  110 (360)
T PHA02748         33 IILLAFSLLVTSRQYFGDPIDCDFP-DYPNGSLNTYCYVQSTFLVERKVTHTVNSTVPDPGVSG-DTEEDELRYYGYYQW  110 (360)
T ss_pred             HHHHHHHHHHHHHHHCCCCeEeccC-CCccchhhceeeeeeEEEeecccccccccccCCCCCCC-CccccceeEeceeeH
Confidence            4899999999999999999999976 56688999999999999999988888888888888874 356678899999999


Q ss_pred             hhHHHHHHHHHhhhchhhe
Q psy15178         81 SCTKGYLASFYAGNTCSSV   99 (103)
Q Consensus        81 VpfvL~lQA~lf~~P~~~~   99 (103)
                      |||+|++||++||+|+++|
T Consensus       111 VpfvL~lQA~lFYiP~~iW  129 (360)
T PHA02748        111 VFITLFLQAVFFYIPHYIW  129 (360)
T ss_pred             HHHHHHHHHHHHHchHHHH
Confidence            9999999999999999998


No 2  
>PF00876 Innexin:  Innexin;  InterPro: IPR000990 The pannexin family combines invertebrate gap junction proteins and their vertebrate homologs. These proteins have been named innexins []. Gap junctions are composed of membrane proteins, which form a channel permeable for ions and small molecules connecting cytoplasm of adjacent cells. Although gap junctions provide similar functions in all multicellular organisms, until recently it was believed that vertebrates and invertebrates use unrelated proteins for this purpose. While the connexins family of gap junction proteins is well- characterised in vertebrates, no homologs have been found in invertebrates. In turn, gap junction molecules with no sequence homology to connexins have been identified in insects and nematodes. It has been suggested that these proteins are specific invertebrate gap junctions, and they were thus named innexins (invertebrate analog of connexins) []. As innexin homologs were recently identified in other taxonomic groups including vertebrates, indicating their ubiquitous distribution in the animal kingdom, they were called pannexins (from the Latin pan-all, throughout, and nexus-connection, bond) [, , ]. Genomes of vertebrates carry probably a conserved set of 3 pannexin paralogs (PANX1, PANX2 and PANX3). Invertebrate genomes may contain more than a dozen pannexin (innexin) genes. Vinnexins, viral homologs of pannexins/innexins, were identified in Polydnaviruses that occur in obligate symbiotic associations with parasitoid wasps. It was suggested that virally encoded vinnexin proteins may function to alter gap junction proteins in infected host cells, possibly modifying cell-cell communication during encapsulation responses in parasitized insects [, ]. Structurally pannexins are simillar to connexins. Both types of protein consist of a cytoplasmic N-terminal domain, followed by four transmembrane segments that delimit two extracellular and one cytoplasmic loops; the C- terminal domain is cytoplasmic.; GO: 0005921 gap junction
Probab=100.00  E-value=2.8e-36  Score=236.74  Aligned_cols=92  Identities=26%  Similarity=0.498  Sum_probs=78.7

Q ss_pred             ChhhHHHHHHhhhhhcCCCcccccCCCCC---hhhhhhhhhhheeeEEeccccccccccccCCCCCCCCCCcccceeeee
Q psy15178          1 MILIAFSLIVTTRQYVGNPIDCVHTKDIP---EDVLNTYCWIHSTYTIRAAFKKKVGVAVPYPGVDNSRGKVEDRKTYGY   77 (103)
Q Consensus         1 ~iL~~~s~Lvt~kqy~G~PI~C~~~~~~~---~~y~~~yCwi~~Ty~v~~~~~~~~~~~~p~pg~~~~~~~~~~~~~~~Y   77 (103)
                      ++|+++|+|+++|||||+||+||+|++++   ++|+|+|||++|||+++.+      +++|.+  ++...+.+++++++|
T Consensus        14 ~lL~~~a~lv~~kqy~G~PI~C~~P~~f~~~~~~y~~~yCwi~~Ty~v~~~------~~~~~~--~~~~~~~~~~~~i~Y   85 (348)
T PF00876_consen   14 ILLLFFALLVSAKQYFGSPIQCWVPAEFTGSWEEYANSYCWIQNTYFVPMN------EDVPGT--DPEWRREREKREISY   85 (348)
T ss_pred             HHHHHHHHHHHHHHhcCCCceeeCCCCCCcchHhHHHhhhcccceEecccc------ccCCCC--ccccccccccceEee
Confidence            37999999999999999999999999884   9999999999999999876      455522  211123457899999


Q ss_pred             ccchhHHHHHHHHHhhhchhhee
Q psy15178         78 YHLSCTKGYLASFYAGNTCSSVL  100 (103)
Q Consensus        78 YQWVpfvL~lQA~lf~~P~~~~~  100 (103)
                      ||||||+|++||+|||+|+++|=
T Consensus        86 YQWVPfiL~lQA~lfylP~~iW~  108 (348)
T PF00876_consen   86 YQWVPFILLLQAILFYLPHLIWR  108 (348)
T ss_pred             ehhhHHHHHHHHHHHHhHHHHHH
Confidence            99999999999999999999984


No 3  
>PF08038 Tom7:  TOM7 family;  InterPro: IPR012621 This family consists of TOM7 family of mitochondrial import receptors. TOM7 forms part of the translocase of the outer mitochondrial membrane (TOM) complex and it appears to function as a modulator of the dynamics of the mitochondrial protein transport machinery by promoting the dissociation of subunits of the outer membrane translocase [].; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0006886 intracellular protein transport, 0005741 mitochondrial outer membrane
Probab=55.58  E-value=8.7  Score=21.86  Aligned_cols=16  Identities=31%  Similarity=0.087  Sum_probs=13.5

Q ss_pred             ceeeeeccchhHHHHH
Q psy15178         72 RKTYGYYHLSCTKGYL   87 (103)
Q Consensus        72 ~~~~~YYQWVpfvL~l   87 (103)
                      .+..-.|-|+|+||.+
T Consensus        11 ~k~~~HyGfIP~Ilyl   26 (42)
T PF08038_consen   11 AKTVFHYGFIPLILYL   26 (42)
T ss_pred             heeeEEeeehHHHHHH
Confidence            4668899999999976


No 4  
>KOG4449|consensus
Probab=48.24  E-value=9.5  Score=22.81  Aligned_cols=15  Identities=27%  Similarity=-0.033  Sum_probs=12.4

Q ss_pred             eeeeeccchhHHHHH
Q psy15178         73 KTYGYYHLSCTKGYL   87 (103)
Q Consensus        73 ~~~~YYQWVpfvL~l   87 (103)
                      +...-|-|+||||-+
T Consensus        19 ~~vih~G~IP~VlyL   33 (53)
T KOG4449|consen   19 KFVIHYGWIPLVLYL   33 (53)
T ss_pred             heeeeechhhHHHHh
Confidence            557789999999976


No 5  
>PF05640 NKAIN:  Na,K-Atpase Interacting protein;  InterPro: IPR008516 NKAIN (Na,K-Atpase INteracting) proteins are a family of evolutionary conserved transmembrane proteins that localise to neurons, that are critical for neuronal function, and that interact with the beta subunits, beta1 in vertebrates and beta in Drosophila, of Na,K-ATPase. NKAINs have highly conserved trans-membrane domains but otherwise no other characterised domains. NKAINs may function as subunits of pore or channel structures in neurons or they may affect the function of other membrane proteins. They are likely to function within the membrane bilayer [].
Probab=23.93  E-value=55  Score=24.61  Aligned_cols=16  Identities=6%  Similarity=-0.039  Sum_probs=10.7

Q ss_pred             ccchhHHHHHHHHHhh
Q psy15178         78 YHLSCTKGYLASFYAG   93 (103)
Q Consensus        78 YQWVpfvL~lQA~lf~   93 (103)
                      |||+|++.=+--+++.
T Consensus        32 yqWaPIl~NF~hIi~v   47 (200)
T PF05640_consen   32 YQWAPILANFLHIIFV   47 (200)
T ss_pred             hhHHHHHHHHHHHHHH
Confidence            6999998755444443


No 6  
>PF12306 PixA:  Inclusion body protein;  InterPro: IPR021087  This entry represents bacterial proteins that are typically between 173 and 191 amino acids in length. PixA is thought to be specifically produced in Xenorhabdus nematophila. It is an inclusion body protein []. This signature also identifies AidA. 
Probab=21.71  E-value=27  Score=25.12  Aligned_cols=14  Identities=36%  Similarity=0.532  Sum_probs=10.6

Q ss_pred             cceeeeeccchhHH
Q psy15178         71 DRKTYGYYHLSCTK   84 (103)
Q Consensus        71 ~~~~~~YYQWVpfv   84 (103)
                      +.+-.+||+|=|+|
T Consensus       156 ~~~l~GY~~wDp~I  169 (172)
T PF12306_consen  156 DQKLMGYYSWDPFI  169 (172)
T ss_pred             CCcEEeEEEeceEE
Confidence            45678899998764


No 7  
>PF08115 Toxin_28:  SFI toxin family;  InterPro: IPR012633 This family consists of the SFI family of spider toxins. This family of toxins might share structural, evolutionary and functional relationships with other small, highly structurally constrained spider neurotoxins. These toxins are highly selective agonists/antagonists of different voltage-dependent calcium channels and are extremely valuable reagents in the analysis of neuromuscular function.; GO: 0009405 pathogenesis, 0005576 extracellular region
Probab=21.46  E-value=25  Score=19.15  Aligned_cols=8  Identities=50%  Similarity=1.198  Sum_probs=5.5

Q ss_pred             hhhhhhhe
Q psy15178         34 NTYCWIHS   41 (103)
Q Consensus        34 ~~yCwi~~   41 (103)
                      ++.|+||+
T Consensus         7 etvcyi~n   14 (35)
T PF08115_consen    7 ETVCYIHN   14 (35)
T ss_pred             CcEEEEec
Confidence            56777775


No 8  
>COG1981 Predicted membrane protein [Function unknown]
Probab=21.35  E-value=63  Score=23.24  Aligned_cols=17  Identities=6%  Similarity=-0.504  Sum_probs=13.3

Q ss_pred             HHHHHHHHHhhhchhhe
Q psy15178         83 TKGYLASFYAGNTCSSV   99 (103)
Q Consensus        83 fvL~lQA~lf~~P~~~~   99 (103)
                      ++..--|.+||+|++.|
T Consensus        18 avisWmAglfYLPRlFV   34 (149)
T COG1981          18 AVISWMAGLFYLPRLFV   34 (149)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34556799999999876


No 9  
>PF02404 SCF:  Stem cell factor;  InterPro: IPR003452 Stem cell factor (SCF) is a homodimer involved in hematopoiesis. SCF binds to and activates the SCF receptor (SCFR), a receptor tyrosine kinase. SCF stimulates the proliferation of mast cells and is able to augment the proliferation of both myeloid and lymphoid hematopoietic progenitors in bone marrow culture. It also mediates cell-cell adhesion and acts synergistically with other cytokines. SCF is a type I membrane protein, but is also found in a secretable, soluble form. The crystal structure of human SCF has been resolved and a potential receptor-binding site identified [].; GO: 0005173 stem cell factor receptor binding, 0007155 cell adhesion, 0016020 membrane; PDB: 1EXZ_A 1SCF_D 2E9W_C 2O26_A 2O27_A.
Probab=17.36  E-value=52  Score=25.85  Aligned_cols=39  Identities=38%  Similarity=0.662  Sum_probs=14.7

Q ss_pred             hhHHHHHHhhhhhcCCCcccc----------cCCCC--C------hhhhhhhhhhhe
Q psy15178          3 LIAFSLIVTTRQYVGNPIDCV----------HTKDI--P------EDVLNTYCWIHS   41 (103)
Q Consensus         3 L~~~s~Lvt~kqy~G~PI~C~----------~~~~~--~------~~y~~~yCwi~~   41 (103)
                      |+.|.-|+.++..+|+|+.=.          .|.|+  +      .+.+-..||++-
T Consensus        16 Lll~~~lv~~~~~~gnpvTDdv~~i~~L~~NiP~DY~i~l~Yvp~~d~lp~~CWl~l   72 (273)
T PF02404_consen   16 LLLFNPLVKTSGICGNPVTDDVKDISKLVANIPKDYKIPLKYVPKMDGLPGHCWLHL   72 (273)
T ss_dssp             -------------SGGGS-CCHHHHHHHHHTS-TT--EEEEE-TTTTTS-HHHCHHH
T ss_pred             HHHhcchhhhcCccCCcCchhhHHHHHHHcCCCcccEeeeecccCCCCCCCceeeee
Confidence            677888899999999999743          35554  1      234557899983


No 10 
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=16.69  E-value=1e+02  Score=22.83  Aligned_cols=21  Identities=0%  Similarity=-0.393  Sum_probs=15.7

Q ss_pred             eeeccchhHHHHHHHHHhhhc
Q psy15178         75 YGYYHLSCTKGYLASFYAGNT   95 (103)
Q Consensus        75 ~~YYQWVpfvL~lQA~lf~~P   95 (103)
                      -+|--=+.++|.+||+.|++=
T Consensus       161 ~SFiGGIVL~LGv~aI~ff~~  181 (186)
T PF05283_consen  161 ASFIGGIVLTLGVLAIIFFLY  181 (186)
T ss_pred             hhhhhHHHHHHHHHHHHHHHh
Confidence            345555678899999999863


Done!