Query         psy15180
Match_columns 131
No_of_seqs    188 out of 1349
Neff          7.0 
Searched_HMMs 46136
Date          Fri Aug 16 22:35:36 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15180.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15180hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0537|consensus              100.0 1.9E-33 4.1E-38  198.7   6.1   84    1-84      3-86  (124)
  2 PF00173 Cyt-b5:  Cytochrome b5  99.9 1.1E-25 2.4E-30  145.2   4.7   75    4-78      1-76  (76)
  3 KOG0536|consensus               99.9   3E-24 6.6E-29  151.8   6.1   76    4-79     69-144 (145)
  4 COG5274 CYB5 Cytochrome b invo  99.8 7.1E-22 1.5E-26  144.6   5.2   79    2-80     49-127 (164)
  5 PLN03198 delta6-acyl-lipid des  99.8   3E-21 6.5E-26  163.9   6.8   77    3-81    104-180 (526)
  6 PLN03199 delta6-acyl-lipid des  99.8 1.2E-20 2.6E-25  158.9   7.6   77    3-82     24-100 (485)
  7 PLN02252 nitrate reductase [NA  99.8 1.7E-20 3.8E-25  166.9   6.5   81    3-84    518-598 (888)
  8 KOG4232|consensus               99.6 2.7E-16 5.9E-21  129.2   3.2   79    3-83      8-88  (430)
  9 KOG4576|consensus               99.5 2.9E-15 6.3E-20  106.7   2.9   79    3-83     80-162 (167)
 10 COG4892 Predicted heme/steroid  98.7 3.5E-08 7.5E-13   63.2   4.7   75    3-80      2-78  (81)
 11 KOG1110|consensus               98.1 2.3E-05 4.9E-10   58.6   8.3   82    4-87     57-163 (183)
 12 KOG1108|consensus               96.7  0.0008 1.7E-08   52.4   1.8   52    4-58     61-117 (281)
 13 PF14901 Jiv90:  Cleavage induc  88.9    0.22 4.8E-06   33.6   1.2   14   22-35     60-73  (94)
 14 PF05283 MGC-24:  Multi-glycosy  81.2     2.3   5E-05   32.1   3.7   25  107-131   161-185 (186)
 15 COG3197 FixS Uncharacterized p  75.5       3 6.4E-05   25.7   2.3   20  111-130     4-23  (58)
 16 PHA02844 putative transmembran  74.3     5.6 0.00012   25.7   3.4   19  106-124    44-62  (75)
 17 PHA02819 hypothetical protein;  71.5       7 0.00015   25.0   3.3   18  107-124    43-60  (71)
 18 PHA03054 IMV membrane protein;  66.5      11 0.00023   24.2   3.4   18  107-124    45-62  (72)
 19 KOG0720|consensus               64.6     3.6 7.8E-05   35.2   1.3   17   19-35    379-395 (490)
 20 PF11698 V-ATPase_H_C:  V-ATPas  64.0    0.73 1.6E-05   32.4  -2.5   28   27-54     65-92  (119)
 21 PF15361 RIC3:  Resistance to i  60.8      13 0.00027   27.1   3.5   24  107-130    78-102 (152)
 22 PHA02650 hypothetical protein;  60.8      15 0.00033   24.0   3.4   17  107-123    46-62  (81)
 23 PF03597 CcoS:  Cytochrome oxid  54.0      21 0.00045   20.7   2.9   19  111-129     3-21  (45)
 24 cd00256 VATPase_H VATPase_H, r  52.0       4 8.7E-05   34.6  -0.4   36   16-53    366-401 (429)
 25 TIGR00847 ccoS cytochrome oxid  51.0      22 0.00049   21.2   2.8   19  111-129     4-22  (51)
 26 PHA02975 hypothetical protein;  48.7      30 0.00065   22.0   3.2   12  108-119    42-53  (69)
 27 PF14002 YniB:  YniB-like prote  47.1      20 0.00043   26.6   2.6   25  107-131   141-165 (166)
 28 PRK06549 acetyl-CoA carboxylas  46.6      14 0.00029   26.3   1.6   13   19-31      5-17  (130)
 29 PF02419 PsbL:  PsbL protein;    44.5      36 0.00078   19.0   2.7   22  110-131    16-37  (37)
 30 PHA02692 hypothetical protein;  43.8      52  0.0011   21.0   3.8    9  108-116    43-51  (70)
 31 CHL00038 psbL photosystem II p  43.7      59  0.0013   18.2   3.7   21  111-131    18-38  (38)
 32 PF12575 DUF3753:  Protein of u  42.0      50  0.0011   21.2   3.5   17  108-124    46-62  (72)
 33 PF04375 HemX:  HemX;  InterPro  41.5      86  0.0019   25.9   5.8   15  115-129    35-49  (372)
 34 PF14283 DUF4366:  Domain of un  41.1      26 0.00056   27.1   2.5   22  109-130   159-180 (218)
 35 PRK10920 putative uroporphyrin  40.6      68  0.0015   26.9   5.1   24  107-130    34-57  (390)
 36 TIGR03147 cyt_nit_nrfF cytochr  40.0      37 0.00081   24.1   3.0   19  106-124    98-116 (126)
 37 PF06682 DUF1183:  Protein of u  39.9      39 0.00085   27.6   3.5   21  110-130   156-176 (318)
 38 PHA03240 envelope glycoprotein  39.7      31 0.00067   27.0   2.7   18  111-128   213-230 (258)
 39 PHA02131 hypothetical protein   39.4      23  0.0005   21.8   1.6   30    3-32      2-45  (70)
 40 PRK00753 psbL photosystem II r  38.8      73  0.0016   17.9   3.5   21  111-131    19-39  (39)
 41 PRK10144 formate-dependent nit  37.2      44 0.00096   23.7   3.0   19  106-124    98-116 (126)
 42 PF09125 COX2-transmemb:  Cytoc  35.6      42  0.0009   18.8   2.1   22  109-130    15-36  (38)
 43 PF06024 DUF912:  Nucleopolyhed  33.4      30 0.00064   23.3   1.6   11  119-129    74-84  (101)
 44 PLN00027 aquaporin TIP; Provis  32.0      46 0.00099   26.0   2.7   23  108-130   215-237 (252)
 45 PLN00184 aquaporin NIP1; Provi  32.0      46 0.00099   26.8   2.7   23  108-130   249-271 (296)
 46 PRK05420 aquaporin Z; Provisio  31.8      36 0.00077   26.2   2.0   23  108-130   204-226 (231)
 47 COG3424 BcsA Predicted naringe  31.7      20 0.00044   29.5   0.7   14   36-49    276-289 (356)
 48 PLN00166 aquaporin TIP2; Provi  30.5      51  0.0011   25.8   2.7   23  108-130   213-235 (250)
 49 PF12652 CotJB:  CotJB protein;  30.4      16 0.00035   23.7  -0.1   20   27-46     15-34  (78)
 50 PTZ00016 aquaglyceroporin; Pro  30.3      39 0.00085   27.1   2.1   23  108-130   266-288 (294)
 51 PRK06764 hypothetical protein;  28.7      57  0.0012   21.8   2.3   21   13-33     80-101 (105)
 52 TIGR02148 Fibro_Slime fibro-sl  28.4      29 0.00062   23.3   0.8   25    9-33     20-45  (90)
 53 PF10855 DUF2648:  Protein of u  28.1      27 0.00057   19.0   0.5   16  115-130     6-21  (33)
 54 KOG2759|consensus               28.0      17 0.00036   31.0  -0.4   43   17-63    380-422 (442)
 55 PF02797 Chal_sti_synt_C:  Chal  27.7      27 0.00059   25.2   0.7   14   35-48     64-77  (151)
 56 PF15168 TRIQK:  Triple QxxK/R   27.2      80  0.0017   20.5   2.7   17  114-130    55-71  (79)
 57 PF03918 CcmH:  Cytochrome C bi  27.2      23  0.0005   25.6   0.2   19  107-125    99-117 (148)
 58 PF05521 Phage_H_T_join:  Phage  27.0      66  0.0014   19.9   2.4   17   17-33     65-81  (95)
 59 PRK14750 kdpF potassium-transp  26.8   1E+02  0.0022   16.2   2.6   13  119-131    13-25  (29)
 60 cd00333 MIP Major intrinsic pr  26.6      62  0.0013   24.5   2.5   24  107-130   205-228 (228)
 61 COG3088 CcmH Uncharacterized p  26.1      72  0.0016   23.4   2.6   20  107-126   103-122 (153)
 62 PRK10862 SoxR reducing system   23.6      78  0.0017   22.9   2.5   20  108-127    77-97  (154)
 63 PLN00182 putative aquaporin NI  23.5      79  0.0017   25.3   2.7   23  108-130   230-252 (283)
 64 PLN00026 aquaporin  NIP; Provi  23.5      79  0.0017   25.5   2.7   23  108-130   258-280 (298)
 65 PF07533 BRK:  BRK domain;  Int  23.2      14  0.0003   21.5  -1.2   14   26-39     26-39  (46)
 66 PF11027 DUF2615:  Protein of u  21.8 1.6E+02  0.0035   20.1   3.6   19  110-128    53-71  (103)
 67 PLN00183 putative aquaporin NI  21.5      94   0.002   24.7   2.7   23  108-130   232-254 (274)
 68 PF10618 Tail_tube:  Phage tail  21.2      76  0.0016   22.0   1.9   25   17-41      7-31  (119)
 69 PF06692 MNSV_P7B:  Melon necro  21.1 1.4E+02  0.0029   18.3   2.7   14  112-125    12-25  (61)
 70 PF08078 PsaX:  PsaX family;  I  21.0 1.6E+02  0.0035   16.2   2.8    9  121-129    26-34  (37)
 71 PF04246 RseC_MucC:  Positive r  20.4   1E+02  0.0022   21.4   2.5   19  108-126    70-88  (135)
 72 PF14453 ThiS-like:  ThiS-like   20.1 1.1E+02  0.0023   18.7   2.2   22    5-26     16-37  (57)

No 1  
>KOG0537|consensus
Probab=100.00  E-value=1.9e-33  Score=198.74  Aligned_cols=84  Identities=44%  Similarity=0.776  Sum_probs=79.8

Q ss_pred             CCCcCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHHHHHHhhcCceeeccCC
Q psy15180          1 MSKEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTEARELMKKYKVGTISDP   80 (131)
Q Consensus         1 m~~~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~L~~~~VG~l~~~   80 (131)
                      |.++|+++||++||+++||||+|+|+|||||+|+++||||.++|+.+||+|+|+.|++++||.+|++||++|+||.+.+.
T Consensus         3 ~~k~~~~~EV~kHn~~~d~Wvii~gkVYDvT~Fl~eHPGG~~vLl~~AGkDaT~~F~~~gHS~~A~~ml~~y~ig~~~~~   82 (124)
T KOG0537|consen    3 DLKYYTLSEVAKHNKKDDCWVIIHGKVYDVTSFLDEHPGGEDVLLEYAGKDATEAFEDVGHSKDAREMLEEYYIGEVPTT   82 (124)
T ss_pred             ccccccHHHHHhhcCCCCeEEEECCEEEeccchhhhCCChHHHHHHHhchhhHHhccccCCcHHHHHHhhhcccccccCC
Confidence            34889999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             CCCC
Q psy15180         81 ENIP   84 (131)
Q Consensus        81 ~~~~   84 (131)
                      +...
T Consensus        83 ~~~~   86 (124)
T KOG0537|consen   83 ARPV   86 (124)
T ss_pred             Cccc
Confidence            6543


No 2  
>PF00173 Cyt-b5:  Cytochrome b5-like Heme/Steroid binding domain This prints entry is a subset of the Pfam entry;  InterPro: IPR001199 Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts []. The microsomal and mitochondrial variants are membrane-bound, while those from erythrocytes and other animal tissues are water-soluble [, ]. The 3D structure of bovine cyt b5 is known, the fold belonging to the alpha+beta class, with 5 strands and 5 short helices forming a framework for supporting a central haem group []. The cytochrome b5 domain is similar to that of a number of oxidoreductases, such as plant and fungal nitrate reductases, sulphite oxidase, yeast flavocytochrome b2 (L-lactate dehydrogenase) and plant cyt b5/acyl lipid desaturase fusion protein.; GO: 0020037 heme binding; PDB: 2I96_A 3KS0_A 1KBI_B 1KBJ_B 1LTD_A 1SZG_B 1SZF_A 1LDC_B 2OZ0_B 1LCO_A ....
Probab=99.92  E-value=1.1e-25  Score=145.16  Aligned_cols=75  Identities=37%  Similarity=0.686  Sum_probs=69.8

Q ss_pred             cCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHHHHHHhhc-Cceeecc
Q psy15180          4 EFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTEARELMKK-YKVGTIS   78 (131)
Q Consensus         4 ~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~L~~-~~VG~l~   78 (131)
                      +||++||++|+.+++||++|+|+|||||+|+..||||.+++..++|+|+|+.|....|+..+.++|++ |+||.|+
T Consensus         1 ~~t~~el~~h~~~~~~~v~i~g~VYDvt~~~~~hpgg~~~~~~~aG~D~T~~f~~~~h~~~~~~~l~~~~~vG~ld   76 (76)
T PF00173_consen    1 VYTWEELAKHNKKGDCWVIIDGKVYDVTDFLDRHPGGADILKKYAGRDATDAFEEAFHSWWAEKCLEKYYKVGYLD   76 (76)
T ss_dssp             EEEHHHHTTTEETTEEEEEETTEEEECTTTTTTSTTTSHHHHTTTTSBTHHHHHHHTHHHHHHHHHHGCGEEEEE-
T ss_pred             CCCHHHHhhhCCCCCEEEEECCEEcccccccccccchhHHHHHhccccccHHHhhccCcHHHHHHccCCCEEEEeC
Confidence            48999999999999999999999999999999999999999999999999999445699999999998 9999985


No 3  
>KOG0536|consensus
Probab=99.90  E-value=3e-24  Score=151.82  Aligned_cols=76  Identities=36%  Similarity=0.562  Sum_probs=72.0

Q ss_pred             cCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHHHHHHhhcCceeeccC
Q psy15180          4 EFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTEARELMKKYKVGTISD   79 (131)
Q Consensus         4 ~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~L~~~~VG~l~~   79 (131)
                      .+|.+||++||+.+|||++|+|+|||||.|++.||||.+.|+.++|+|+|..|+.+|-..+-.++|+.++||.+.+
T Consensus        69 ~vt~~El~KH~~~dDcW~~i~G~VYnVt~Yl~fHPgG~d~lmk~aGrD~T~~Fnk~H~WVN~e~LL~~c~VGvl~d  144 (145)
T KOG0536|consen   69 PVTAEELKKHNKKDDCWIAIRGKVYNVTAYLDFHPGGVDELMKHAGRDATKLFNKYHAWVNYEELLKKCFVGVLVD  144 (145)
T ss_pred             ccCHHHHHhhCCccceEEEEcCEEEecccccccCCCCHHHHHHhcCcchHHHHHHHHHHhcHHHHHhhceeeeecc
Confidence            5789999999999999999999999999999999999999999999999999999866778889999999998875


No 4  
>COG5274 CYB5 Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism]
Probab=99.85  E-value=7.1e-22  Score=144.61  Aligned_cols=79  Identities=38%  Similarity=0.648  Sum_probs=75.5

Q ss_pred             CCcCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHHHHHHhhcCceeeccCC
Q psy15180          2 SKEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTEARELMKKYKVGTISDP   80 (131)
Q Consensus         2 ~~~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~L~~~~VG~l~~~   80 (131)
                      .+.++.+||.+|+++++||++|+|+|||||.|+++||||++++..++|+|+|+.|+..+|+..+.++|+.++||.+...
T Consensus        49 ~~~~~~eev~~h~~~~d~~ivi~g~VyDvs~fl~~HPGGe~ii~~~~g~Dat~~f~~~~~~~~~~~llk~~yv~~v~r~  127 (164)
T COG5274          49 PKPITAEEVAKHNKSEDCWIVINGKVYDVSQFLDEHPGGEDIIKDTAGKDATKAFNFLHHSHQIGNLLKDVYVDQVHRP  127 (164)
T ss_pred             cccccHHHHHHhcCccceEEEEcCEEEEhhhccccCCCcceeehhccCchhhhhhcccccchhHHhhhhceeeecccCc
Confidence            4778999999999999999999999999999999999999999999999999999999999999899999999998765


No 5  
>PLN03198 delta6-acyl-lipid desaturase; Provisional
Probab=99.84  E-value=3e-21  Score=163.88  Aligned_cols=77  Identities=30%  Similarity=0.572  Sum_probs=72.9

Q ss_pred             CcCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHHHHHHhhcCceeeccCCC
Q psy15180          3 KEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTEARELMKKYKVGTISDPE   81 (131)
Q Consensus         3 ~~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~L~~~~VG~l~~~~   81 (131)
                      +.||++||++|++++|||++|+|+|||||+|+++||||+ +|..++|+|+|+.|+.. |+..+.++|++|+||+++..+
T Consensus       104 ~~~t~~ev~~H~~~~d~Wivi~gkVYDvT~fl~~HPGG~-~i~~~aG~DaT~~F~~~-H~~~~~~~l~~~~IG~l~~~~  180 (526)
T PLN03198        104 KSHLLSEVAAHNKPNDCWIVIKNKVYDVSDFAAEHPGGS-VISTYFGRDGTDAFSSF-HAASTWKILQDFYIGDVDNVE  180 (526)
T ss_pred             CcCCHHHHHhhCCCCCeEEEECCEEEecHHHHHhCCCch-HHHHhcCCcHhHHHHHh-cCHHHHHHHhhCcceecCCcc
Confidence            689999999999999999999999999999999999998 89999999999999996 999999999999999998644


No 6  
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional
Probab=99.83  E-value=1.2e-20  Score=158.91  Aligned_cols=77  Identities=26%  Similarity=0.581  Sum_probs=71.7

Q ss_pred             CcCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHHHHHHhhcCceeeccCCCC
Q psy15180          3 KEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTEARELMKKYKVGTISDPEN   82 (131)
Q Consensus         3 ~~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~L~~~~VG~l~~~~~   82 (131)
                      +.+|++||++|+++++||++|+|+|||||+|+ +||||+ +|..++|+|+|+.|+.. |+..++++|++|+||++++++.
T Consensus        24 ~~~s~~ev~~h~~~~~~wi~i~g~vYDvt~f~-~HPGG~-~i~~~aG~DaT~~F~~~-H~~~~~~~l~~~~iG~l~~~~~  100 (485)
T PLN03199         24 QKISWQEVKKHASPDDAWIIHQNKVYDVSNWH-DHPGGA-VIFTHAGDDMTDIFAAF-HAPGSQALMKKFYIGDLIPEST  100 (485)
T ss_pred             CccCHHHHHhhCCCCCeEEEECCEEEcCCCcC-cCCCch-HHHhhCCCChhHHHHHh-cCHHHHHHHHhccccccccccc
Confidence            68999999999999999999999999999997 899998 78899999999999986 9999999999999999976553


No 7  
>PLN02252 nitrate reductase [NADPH]
Probab=99.81  E-value=1.7e-20  Score=166.94  Aligned_cols=81  Identities=31%  Similarity=0.683  Sum_probs=76.3

Q ss_pred             CcCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHHHHHHhhcCceeeccCCCC
Q psy15180          3 KEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTEARELMKKYKVGTISDPEN   82 (131)
Q Consensus         3 ~~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~L~~~~VG~l~~~~~   82 (131)
                      +.||++||++|++.++||++|+|+|||+|+|++.||||.++|+.++|+|+|+.|+.. |+..|+++|++|+||.|+....
T Consensus       518 ~~~t~~ev~~h~~~~~~Wivi~g~VYDvT~fl~~HPGG~~~I~~~aG~DaT~~F~~~-Hs~~a~~~L~~~~IG~l~~~~~  596 (888)
T PLN02252        518 KQYTMSEVRKHNSEDSCWIVVHGHVYDCTRFLKDHPGGADSILINAGTDCTEEFDAI-HSDKAKKMLEDYRIGELVTTGA  596 (888)
T ss_pred             ceeCHHHHHhhCcCCCeEEEECCEEEeCHHHHHHCCChHHHHHhhcCCCcHHHHhhh-hhHHHHHHHHhCcCCccccccc
Confidence            789999999999999999999999999999999999999999999999999999986 9999999999999999987654


Q ss_pred             CC
Q psy15180         83 IP   84 (131)
Q Consensus        83 ~~   84 (131)
                      ..
T Consensus       597 ~~  598 (888)
T PLN02252        597 AA  598 (888)
T ss_pred             cc
Confidence            43


No 8  
>KOG4232|consensus
Probab=99.61  E-value=2.7e-16  Score=129.16  Aligned_cols=79  Identities=28%  Similarity=0.519  Sum_probs=70.9

Q ss_pred             CcCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHH--HHHHhhcCceeeccCC
Q psy15180          3 KEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTE--ARELMKKYKVGTISDP   80 (131)
Q Consensus         3 ~~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~--a~~~L~~~~VG~l~~~   80 (131)
                      ++++++++++|++.++.|++|+| |||+|+|++.||||+.+|.+++|+|+|++|+.. |...  +...|+...+|...++
T Consensus         8 ~~~~we~~~~~~~~~~~W~~id~-vYd~s~~~~~HPGG~~~I~~~~g~DaTdaF~Af-H~~~~~~~~~l~~l~~~~~~pe   85 (430)
T KOG4232|consen    8 TTFSWEGKRKHDKAEGLWLVIDG-VYDISDWIKRHPGGSRVIEHYAGQDATDAFEAF-HPGTAFAYKHLKPLLIGELSPE   85 (430)
T ss_pred             eeeeccchhhccCCCceEEEeec-cccHHHHHHhCCCchhHHHHhcCCccchHHHHh-CCChHHHHHHHHHHHcCCcCcc
Confidence            46889999999999999999999 999999999999999999999999999999985 7554  7778899999998876


Q ss_pred             CCC
Q psy15180         81 ENI   83 (131)
Q Consensus        81 ~~~   83 (131)
                      ...
T Consensus        86 ~~~   88 (430)
T KOG4232|consen   86 IPS   88 (430)
T ss_pred             ccc
Confidence            543


No 9  
>KOG4576|consensus
Probab=99.54  E-value=2.9e-15  Score=106.74  Aligned_cols=79  Identities=27%  Similarity=0.523  Sum_probs=64.5

Q ss_pred             CcCCHHHHhccCCCC-CeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhc---CCCHHHHHHhhcCceeecc
Q psy15180          3 KEFTYKEVVESTDKT-ANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDV---GHSTEARELMKKYKVGTIS   78 (131)
Q Consensus         3 ~~~t~~ev~~h~~~~-~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~---~Hs~~a~~~L~~~~VG~l~   78 (131)
                      ..|+.+||.+|+++. +.||.+..-|||||+|++.||||.++|+. ||.- -+.|+..   +....++++|+.|+||+|+
T Consensus        80 ~iY~~EEV~~H~s~e~rIWVTyg~gVyDVTdFv~~HPGGdKillA-AG~a-~dPFWalY~qHnt~eVlElLegyrIG~L~  157 (167)
T KOG4576|consen   80 HIYTKEEVSSHTSPETRIWVTYGSGVYDVTDFVDLHPGGDKILLA-AGGA-LDPFWALYAQHNTSEVLELLEGYRIGELN  157 (167)
T ss_pred             cchhHHHHHhcCCCccceEEEecCcceeHHHHHHhCCCcceeeee-cCCC-cCcHHHHHHHhhHHHHHHHHhhcccccCC
Confidence            679999999999875 58999999999999999999999887664 4443 3344433   5567899999999999999


Q ss_pred             CCCCC
Q psy15180         79 DPENI   83 (131)
Q Consensus        79 ~~~~~   83 (131)
                      +.+..
T Consensus       158 ~~dv~  162 (167)
T KOG4576|consen  158 PEDVV  162 (167)
T ss_pred             hhhcc
Confidence            87653


No 10 
>COG4892 Predicted heme/steroid binding protein [General function prediction only]
Probab=98.68  E-value=3.5e-08  Score=63.16  Aligned_cols=75  Identities=23%  Similarity=0.381  Sum_probs=54.7

Q ss_pred             CcCCHHHHhccCCCC-CeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhh-cCCCHHHHHHhhcCceeeccCC
Q psy15180          3 KEFTYKEVVESTDKT-ANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFED-VGHSTEARELMKKYKVGTISDP   80 (131)
Q Consensus         3 ~~~t~~ev~~h~~~~-~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~-~~Hs~~a~~~L~~~~VG~l~~~   80 (131)
                      +.||++|+.+.|+++ ..+|.++|.||||+.-. ..-+|..-=..-+|+|.|+.|++ ..|..+..+.++  .||.|..+
T Consensus         2 refTLEELs~ynG~nGpaYiA~~G~VYDvS~s~-~W~dGtHqglhsaG~DLs~~~~~~aphg~eil~~~P--vVG~L~k~   78 (81)
T COG4892           2 REFTLEELSKYNGENGPAYIAVNGTVYDVSLSP-SWGDGTHQGLHSAGKDLSSEFNSCAPHGMEILTSLP--VVGALIKE   78 (81)
T ss_pred             ceecHHHHHhhcCCCCCeEEEECCEEEeeccCc-ccCCCccccccccchhHHHHHhhcCCchhHHHhcCc--hhheeecc
Confidence            679999999999764 68999999999997531 23344444445699999999984 356665555554  67777643


No 11 
>KOG1110|consensus
Probab=98.10  E-value=2.3e-05  Score=58.57  Aligned_cols=82  Identities=26%  Similarity=0.362  Sum_probs=55.8

Q ss_pred             cCCHHHHhccCCCC---CeEEEEcCeEeeccccCc-cCCChHHHHHhcCCCcchHHHhhc---------CC---CHHHHH
Q psy15180          4 EFTYKEVVESTDKT---ANLIVIKGVVYNVAPFLN-EHPGGEEVLLDQRGQNATEHFEDV---------GH---STEARE   67 (131)
Q Consensus         4 ~~t~~ev~~h~~~~---~~wvii~g~VYDvT~f~~-~HPGG~~~l~~~aG~D~T~~f~~~---------~H---s~~a~~   67 (131)
                      .||.+|+++.++.+   ..++.|+|+|||||.=.. .-|||.  -..+||+|++..+...         -+   +..-++
T Consensus        57 dfT~eEL~~ydGs~~d~~Il~AI~G~VYDVT~Gr~FYGp~Gp--Y~~fAG~DASR~La~~s~d~~d~~ddlsdL~a~e~e  134 (183)
T KOG1110|consen   57 DFTVEELRQYDGSDPDKPILLAINGKVYDVTRGREFYGPGGP--YSLFAGKDASRGLAKMSFDLSDETDDLSDLTAEELE  134 (183)
T ss_pred             ccCHHHHHhcCCCCCCCceEEEecceEEEecCCccccCCCCC--chhhcccchHHHHHhcccchhhccccccccCHHHHH
Confidence            68999999999755   478999999999985322 478887  4568999999765432         12   222111


Q ss_pred             --------HhhcC-ceeeccCCCCCCCCC
Q psy15180         68 --------LMKKY-KVGTISDPENIPESS   87 (131)
Q Consensus        68 --------~L~~~-~VG~l~~~~~~~~~~   87 (131)
                              ...+| +||+|......+...
T Consensus       135 al~eWE~~fk~KY~~VG~L~~~~~e~~~~  163 (183)
T KOG1110|consen  135 ALNEWETKFKAKYPVVGRLVKKGEENEEY  163 (183)
T ss_pred             HHHHHHHHHhhcCceeEEeecCCcccccC
Confidence                    22234 899998876655443


No 12 
>KOG1108|consensus
Probab=96.72  E-value=0.0008  Score=52.37  Aligned_cols=52  Identities=23%  Similarity=0.321  Sum_probs=41.9

Q ss_pred             cCCHHHHhccCCCCC---eEEEEcCeEeeccccCccC--CChHHHHHhcCCCcchHHHhh
Q psy15180          4 EFTYKEVVESTDKTA---NLIVIKGVVYNVAPFLNEH--PGGEEVLLDQRGQNATEHFED   58 (131)
Q Consensus         4 ~~t~~ev~~h~~~~~---~wvii~g~VYDvT~f~~~H--PGG~~~l~~~aG~D~T~~f~~   58 (131)
                      .||++|+++.|+.++   .++.|-|.||||+.=. +|  ||+.  -..++|+|++.+|-.
T Consensus        61 lFtpeeLa~fnGt~e~~piyLaiLGsVfdVs~gk-~hYgsG~s--YnhFaGRDASrAFvs  117 (281)
T KOG1108|consen   61 LFTPEELAKFNGTEEGRPIYLAILGSVFDVSRGK-KHYGSGCS--YNHFAGRDASRAFVS  117 (281)
T ss_pred             eeCHHHHhhccCCCCCCceeeeeeceeeeccCCe-eeeCCCCC--cccccccccchheec
Confidence            799999999997643   7899999999998643 34  5555  678999999998854


No 13 
>PF14901 Jiv90:  Cleavage inducing molecular chaperone
Probab=88.89  E-value=0.22  Score=33.63  Aligned_cols=14  Identities=21%  Similarity=0.653  Sum_probs=11.9

Q ss_pred             EEcCeEeeccccCc
Q psy15180         22 VIKGVVYNVAPFLN   35 (131)
Q Consensus        22 ii~g~VYDvT~f~~   35 (131)
                      ..+|+|||||+|+.
T Consensus        60 c~~g~VyDiTeWA~   73 (94)
T PF14901_consen   60 CMDGKVYDITEWAT   73 (94)
T ss_pred             EcCceEEehhhhhh
Confidence            46999999999963


No 14 
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=81.22  E-value=2.3  Score=32.12  Aligned_cols=25  Identities=16%  Similarity=0.293  Sum_probs=21.5

Q ss_pred             CCCcchHHHHHHHHHHHHHHHHhcC
Q psy15180        107 ESGMPSWVVPLVFGLLVVLVYQYFQ  131 (131)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~~  131 (131)
                      .+++..++|.+.++.+++++|||+.
T Consensus       161 ~SFiGGIVL~LGv~aI~ff~~KF~k  185 (186)
T PF05283_consen  161 ASFIGGIVLTLGVLAIIFFLYKFCK  185 (186)
T ss_pred             hhhhhHHHHHHHHHHHHHHHhhhcc
Confidence            4677888999999999999999984


No 15 
>COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism]
Probab=75.48  E-value=3  Score=25.71  Aligned_cols=20  Identities=15%  Similarity=0.124  Sum_probs=16.0

Q ss_pred             chHHHHHHHHHHHHHHHHhc
Q psy15180        111 PSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~  130 (131)
                      .++++|+++++++++++-|+
T Consensus         4 l~~Lipvsi~l~~v~l~~fl   23 (58)
T COG3197           4 LYILIPVSILLGAVGLGAFL   23 (58)
T ss_pred             eeeHHHHHHHHHHHHHHHHH
Confidence            47899999988888776664


No 16 
>PHA02844 putative transmembrane protein; Provisional
Probab=74.32  E-value=5.6  Score=25.71  Aligned_cols=19  Identities=16%  Similarity=0.518  Sum_probs=9.7

Q ss_pred             CCCCcchHHHHHHHHHHHH
Q psy15180        106 EESGMPSWVVPLVFGLLVV  124 (131)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~  124 (131)
                      ++..|.+|++.++++++++
T Consensus        44 ~~~~~~~~ii~i~~v~~~~   62 (75)
T PHA02844         44 CSSSTKIWILTIIFVVFAT   62 (75)
T ss_pred             CChhHHHHHHHHHHHHHHH
Confidence            3455656666555434333


No 17 
>PHA02819 hypothetical protein; Provisional
Probab=71.48  E-value=7  Score=25.00  Aligned_cols=18  Identities=17%  Similarity=0.025  Sum_probs=8.5

Q ss_pred             CCCcchHHHHHHHHHHHH
Q psy15180        107 ESGMPSWVVPLVFGLLVV  124 (131)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~  124 (131)
                      +..|.++++.++++++++
T Consensus        43 ~~~~~~~ii~l~~~~~~~   60 (71)
T PHA02819         43 SFLRYYLIIGLVTIVFVI   60 (71)
T ss_pred             ChhHHHHHHHHHHHHHHH
Confidence            445555555554433333


No 18 
>PHA03054 IMV membrane protein; Provisional
Probab=66.47  E-value=11  Score=24.18  Aligned_cols=18  Identities=11%  Similarity=0.113  Sum_probs=8.6

Q ss_pred             CCCcchHHHHHHHHHHHH
Q psy15180        107 ESGMPSWVVPLVFGLLVV  124 (131)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~  124 (131)
                      +..|.++++.++++++++
T Consensus        45 ~~~~~~~ii~l~~v~~~~   62 (72)
T PHA03054         45 CWGWYWLIIIFFIVLILL   62 (72)
T ss_pred             CchHHHHHHHHHHHHHHH
Confidence            445555555554433333


No 19 
>KOG0720|consensus
Probab=64.63  E-value=3.6  Score=35.23  Aligned_cols=17  Identities=18%  Similarity=0.430  Sum_probs=13.7

Q ss_pred             eEEEEcCeEeeccccCc
Q psy15180         19 NLIVIKGVVYNVAPFLN   35 (131)
Q Consensus        19 ~wvii~g~VYDvT~f~~   35 (131)
                      .++.-+|+|||+|+|..
T Consensus       379 yy~c~DgkVYDITeWA~  395 (490)
T KOG0720|consen  379 YYACMDGKVYDITEWAI  395 (490)
T ss_pred             eeeecCCceEeehhhhh
Confidence            34457999999999983


No 20 
>PF11698 V-ATPase_H_C:  V-ATPase subunit H;  InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins []. This entry represents the C-terminal domain of subunit H (also known as Vma13p) found in the V1 complex of V-ATPases. This subunit has a regulatory function, being responsible for activating ATPase activity and coupling ATPase activity to proton flow []. The yeast enzyme contains five motifs similar to the HEAT or Armadillo repeats seen in the importins, and can be divided into two distinct domains: a large N-terminal domain consisting of stacked alpha helices, and a smaller C-terminal alpha-helical domain with a similar superhelical topology to an armadillo repeat []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0015991 ATP hydrolysis coupled proton transport, 0000221 vacuolar proton-transporting V-type ATPase, V1 domain; PDB: 1HO8_A.
Probab=64.00  E-value=0.73  Score=32.41  Aligned_cols=28  Identities=11%  Similarity=0.330  Sum_probs=23.4

Q ss_pred             EeeccccCccCCChHHHHHhcCCCcchH
Q psy15180         27 VYNVAPFLNEHPGGEEVLLDQRGQNATE   54 (131)
Q Consensus        27 VYDvT~f~~~HPGG~~~l~~~aG~D~T~   54 (131)
                      -+|+..|++.||.|..++....+++.-=
T Consensus        65 c~Dig~~vr~~p~gr~ii~~lg~K~~vM   92 (119)
T PF11698_consen   65 CHDIGEFVRHYPNGRNIIEKLGAKERVM   92 (119)
T ss_dssp             HHHHHHHHHH-GGGHHHHHHHSHHHHHH
T ss_pred             hcchHHHHHHChhHHHHHHhcChHHHHH
Confidence            3899999999999999999998887543


No 21 
>PF15361 RIC3:  Resistance to inhibitors of cholinesterase homologue 3
Probab=60.83  E-value=13  Score=27.13  Aligned_cols=24  Identities=25%  Similarity=0.732  Sum_probs=18.2

Q ss_pred             CCCcchHHHHHH-HHHHHHHHHHhc
Q psy15180        107 ESGMPSWVVPLV-FGLLVVLVYQYF  130 (131)
Q Consensus       107 ~~~~~~~~~~~~-~~~~~~~~~~~~  130 (131)
                      +.++..+++|+= +.++++++|+++
T Consensus        78 ~~g~~~~imPlYtiGI~~f~lY~l~  102 (152)
T PF15361_consen   78 GKGLMGQIMPLYTIGIVLFILYTLF  102 (152)
T ss_pred             CCchhhhHhHHHHHHHHHHHHHHHH
Confidence            456677899885 677788888876


No 22 
>PHA02650 hypothetical protein; Provisional
Probab=60.80  E-value=15  Score=24.04  Aligned_cols=17  Identities=6%  Similarity=-0.003  Sum_probs=7.9

Q ss_pred             CCCcchHHHHHHHHHHH
Q psy15180        107 ESGMPSWVVPLVFGLLV  123 (131)
Q Consensus       107 ~~~~~~~~~~~~~~~~~  123 (131)
                      +..|.++++.+++++++
T Consensus        46 ~~~~~~~ii~i~~v~i~   62 (81)
T PHA02650         46 WFNGQNFIFLIFSLIIV   62 (81)
T ss_pred             CchHHHHHHHHHHHHHH
Confidence            44455555554443333


No 23 
>PF03597 CcoS:  Cytochrome oxidase maturation protein cbb3-type;  InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. 
Probab=54.01  E-value=21  Score=20.74  Aligned_cols=19  Identities=11%  Similarity=0.223  Sum_probs=13.0

Q ss_pred             chHHHHHHHHHHHHHHHHh
Q psy15180        111 PSWVVPLVFGLLVVLVYQY  129 (131)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~  129 (131)
                      .++++|+++++++++++-|
T Consensus         3 l~~lip~sl~l~~~~l~~f   21 (45)
T PF03597_consen    3 LYILIPVSLILGLIALAAF   21 (45)
T ss_pred             hhHHHHHHHHHHHHHHHHH
Confidence            4788899877766655443


No 24 
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses  ATP to actively transport protons into organelles and extracellular compartments. The topology is that of a superhelical spiral, in part the geometry is similar to superhelices composed of armadillo repeat motifs, as found in importins for example.
Probab=51.95  E-value=4  Score=34.60  Aligned_cols=36  Identities=11%  Similarity=0.360  Sum_probs=29.9

Q ss_pred             CCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcch
Q psy15180         16 KTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNAT   53 (131)
Q Consensus        16 ~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T   53 (131)
                      .+..++.|-  -+|+..|++.||.|..++....||+..
T Consensus       366 ~d~~~laVA--c~Dige~vr~~P~gr~i~~~lg~K~~v  401 (429)
T cd00256         366 VDPIILAVA--CHDIGEYVRHYPRGKDVVEQLGGKQRV  401 (429)
T ss_pred             CCcceeehh--hhhHHHHHHHCccHHHHHHHcCcHHHH
Confidence            455666665  499999999999999999999998764


No 25 
>TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type. CcoS from Rhodobacter capsulatus has been shown essential for incorporation of redox-active prosthetic groups (heme, Cu) into cytochrome cbb(3) oxidase. FixS of Bradyrhizobium japonicum appears to have the same function. Members of this family are found so far in organisms with a cbb3-type cytochrome oxidase, including Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Caulobacter crescentus, Bradyrhizobium japonicum, and Rhodobacter capsulatus.
Probab=50.96  E-value=22  Score=21.22  Aligned_cols=19  Identities=16%  Similarity=0.181  Sum_probs=13.1

Q ss_pred             chHHHHHHHHHHHHHHHHh
Q psy15180        111 PSWVVPLVFGLLVVLVYQY  129 (131)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~  129 (131)
                      .++++|+++++++++++-|
T Consensus         4 l~~LIpiSl~l~~~~l~~f   22 (51)
T TIGR00847         4 LTILIPISLLLGGVGLVAF   22 (51)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4788899887776655443


No 26 
>PHA02975 hypothetical protein; Provisional
Probab=48.71  E-value=30  Score=21.99  Aligned_cols=12  Identities=17%  Similarity=0.185  Sum_probs=5.4

Q ss_pred             CCcchHHHHHHH
Q psy15180        108 SGMPSWVVPLVF  119 (131)
Q Consensus       108 ~~~~~~~~~~~~  119 (131)
                      ..|.++++.+++
T Consensus        42 ~~~~~~ii~i~~   53 (69)
T PHA02975         42 SLSIILIIFIIF   53 (69)
T ss_pred             chHHHHHHHHHH
Confidence            344445554443


No 27 
>PF14002 YniB:  YniB-like protein
Probab=47.06  E-value=20  Score=26.60  Aligned_cols=25  Identities=8%  Similarity=0.404  Sum_probs=21.3

Q ss_pred             CCCcchHHHHHHHHHHHHHHHHhcC
Q psy15180        107 ESGMPSWVVPLVFGLLVVLVYQYFQ  131 (131)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~~  131 (131)
                      .+.++.|++|+.++++.+++.|++.
T Consensus       141 ~Q~f~LYi~Piiv~vigyf~lkllg  165 (166)
T PF14002_consen  141 LQFFPLYILPIIVAVIGYFILKLLG  165 (166)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            4678899999999999999988763


No 28 
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=46.63  E-value=14  Score=26.31  Aligned_cols=13  Identities=38%  Similarity=0.373  Sum_probs=11.4

Q ss_pred             eEEEEcCeEeecc
Q psy15180         19 NLIVIKGVVYNVA   31 (131)
Q Consensus        19 ~wvii~g~VYDvT   31 (131)
                      .-|.|||++|||+
T Consensus         5 ~~itvng~~y~V~   17 (130)
T PRK06549          5 FKITIDGKEYLVE   17 (130)
T ss_pred             EEEEECCEEEEEE
Confidence            5678999999996


No 29 
>PF02419 PsbL:  PsbL protein;  InterPro: IPR003372 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbL found in PSII. PsbL is located in a gene cluster with PsbE, PsbF and PsbJ (PsbEFJL). Both PsbL and PsbJ (IPR002682 from INTERPRO) are essential for proper assembly of the OEC. Mutations in PsbL prevent the formation of both PSII core dimers and PSII-light harvesting complex []. In addition, both PsbL and PsbJ are involved in the unidirectional flow of electrons, where PsbJ regulates the forward electron flow from D2 (Qa) to the plastoquinone pool, and PsbL prevents the reduction of PSII by back electron flow from plastoquinol protecting PSII from photo-inactivation [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_L 3A0B_l 3ARC_l 1S5L_l 2AXT_l 3BZ2_L 4FBY_L 3PRQ_L 3PRR_L 3KZI_L ....
Probab=44.51  E-value=36  Score=18.97  Aligned_cols=22  Identities=27%  Similarity=0.513  Sum_probs=10.7

Q ss_pred             cchHHHHHHHHHHHHHHHHhcC
Q psy15180        110 MPSWVVPLVFGLLVVLVYQYFQ  131 (131)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~  131 (131)
                      ..||-+.+++++++.+--||+|
T Consensus        16 SLY~GLllifvl~vLFssyffN   37 (37)
T PF02419_consen   16 SLYWGLLLIFVLAVLFSSYFFN   37 (37)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH-
T ss_pred             hHHHHHHHHHHHHHHhhhhhcC
Confidence            3455555555444444555554


No 30 
>PHA02692 hypothetical protein; Provisional
Probab=43.82  E-value=52  Score=21.02  Aligned_cols=9  Identities=0%  Similarity=-0.193  Sum_probs=4.1

Q ss_pred             CCcchHHHH
Q psy15180        108 SGMPSWVVP  116 (131)
Q Consensus       108 ~~~~~~~~~  116 (131)
                      ..|..+++.
T Consensus        43 ~~~~~~ii~   51 (70)
T PHA02692         43 VPWTTVFLI   51 (70)
T ss_pred             cchHHHHHH
Confidence            344445444


No 31 
>CHL00038 psbL photosystem II protein L
Probab=43.73  E-value=59  Score=18.18  Aligned_cols=21  Identities=29%  Similarity=0.567  Sum_probs=10.5

Q ss_pred             chHHHHHHHHHHHHHHHHhcC
Q psy15180        111 PSWVVPLVFGLLVVLVYQYFQ  131 (131)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~  131 (131)
                      .||-+-++.++++.+--||+|
T Consensus        18 Ly~GLLlifvl~vlfssyffN   38 (38)
T CHL00038         18 LYWGLLLIFVLAVLFSNYFFN   38 (38)
T ss_pred             HHHHHHHHHHHHHHHHHHhcC
Confidence            355555544444445555554


No 32 
>PF12575 DUF3753:  Protein of unknown function (DUF3753);  InterPro: IPR009175 This group represents an uncharacterised conserved protein belonging to poxvirus family I2.
Probab=41.97  E-value=50  Score=21.22  Aligned_cols=17  Identities=18%  Similarity=0.413  Sum_probs=7.2

Q ss_pred             CCcchHHHHHHHHHHHH
Q psy15180        108 SGMPSWVVPLVFGLLVV  124 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~~  124 (131)
                      .+|..+++.++++++++
T Consensus        46 ~~~~~~ii~ii~v~ii~   62 (72)
T PF12575_consen   46 FNWIILIISIIFVLIIV   62 (72)
T ss_pred             chHHHHHHHHHHHHHHH
Confidence            34434454444433333


No 33 
>PF04375 HemX:  HemX;  InterPro: IPR007470 The majority of proteins in this family are annotated as uroporphyrin-III C-methyltransferase (2.1.1.107 from EC) []; however, there is no direct evidence to support this annotation for these proteins, which come from mainly pathogenic Gram-negative organisms. There is some evidence to suggest that the proteins are membrane anchored as they have a predicted N-terminal signal peptide and transmembrane domain and may be involved in haem transport []. 
Probab=41.47  E-value=86  Score=25.85  Aligned_cols=15  Identities=20%  Similarity=0.186  Sum_probs=5.8

Q ss_pred             HHHHHHHHHHHHHHh
Q psy15180        115 VPLVFGLLVVLVYQY  129 (131)
Q Consensus       115 ~~~~~~~~~~~~~~~  129 (131)
                      +.+++++++.+++++
T Consensus        35 lalll~~alg~~~~~   49 (372)
T PF04375_consen   35 LALLLALALGAGGWY   49 (372)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            333333333344433


No 34 
>PF14283 DUF4366:  Domain of unknown function (DUF4366)
Probab=41.13  E-value=26  Score=27.07  Aligned_cols=22  Identities=36%  Similarity=0.535  Sum_probs=10.7

Q ss_pred             CcchHHHHHHHHHHHHHHHHhc
Q psy15180        109 GMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      ++..+++.+++++++..+|+||
T Consensus       159 ~~g~ll~lllv~l~gGGa~yYf  180 (218)
T PF14283_consen  159 GMGSLLLLLLVALIGGGAYYYF  180 (218)
T ss_pred             chHHHHHHHHHHHhhcceEEEE
Confidence            3334454455545555555554


No 35 
>PRK10920 putative uroporphyrinogen III C-methyltransferase; Provisional
Probab=40.63  E-value=68  Score=26.95  Aligned_cols=24  Identities=17%  Similarity=0.188  Sum_probs=15.1

Q ss_pred             CCCcchHHHHHHHHHHHHHHHHhc
Q psy15180        107 ESGMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      +.++..++|.+++++++..++||+
T Consensus        34 ~~g~~l~~~aili~la~g~g~y~~   57 (390)
T PRK10920         34 RTGLVLSAVAIAIALAAGAGLYYH   57 (390)
T ss_pred             CccHHHHHHHHHHHHHHhhHHHHH
Confidence            445556677777666666666664


No 36 
>TIGR03147 cyt_nit_nrfF cytochrome c nitrite reductase, accessory protein NrfF.
Probab=40.00  E-value=37  Score=24.05  Aligned_cols=19  Identities=21%  Similarity=0.513  Sum_probs=13.4

Q ss_pred             CCCCcchHHHHHHHHHHHH
Q psy15180        106 EESGMPSWVVPLVFGLLVV  124 (131)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~  124 (131)
                      ++.+|..|+.|++++++..
T Consensus        98 ~~~t~~LW~~P~lll~~G~  116 (126)
T TIGR03147        98 KWQTLLLWLLPVLLLLLAF  116 (126)
T ss_pred             CcchHHHHHHHHHHHHHHH
Confidence            3456789999988655544


No 37 
>PF06682 DUF1183:  Protein of unknown function (DUF1183);  InterPro: IPR009567 This family consists of several eukaryotic proteins of around 360 residues in length. The function of this family is unknown.
Probab=39.86  E-value=39  Score=27.63  Aligned_cols=21  Identities=19%  Similarity=0.248  Sum_probs=13.4

Q ss_pred             cchHHHHHHHHHHHHHHHHhc
Q psy15180        110 MPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      +..+++.++++++++++|+++
T Consensus       156 ~~~lf~ii~l~vla~ivY~~~  176 (318)
T PF06682_consen  156 GSWLFWIIFLLVLAFIVYSLF  176 (318)
T ss_pred             cchhhhHHHHHHHHHHHHHHH
Confidence            333444455667888888875


No 38 
>PHA03240 envelope glycoprotein M; Provisional
Probab=39.69  E-value=31  Score=26.98  Aligned_cols=18  Identities=11%  Similarity=0.573  Sum_probs=11.5

Q ss_pred             chHHHHHHHHHHHHHHHH
Q psy15180        111 PSWVVPLVFGLLVVLVYQ  128 (131)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~  128 (131)
                      ..|+|++++++++++++.
T Consensus       213 ~~WIiilIIiIiIIIL~c  230 (258)
T PHA03240        213 IAWIFIAIIIIIVIILFF  230 (258)
T ss_pred             HhHHHHHHHHHHHHHHHH
Confidence            367777777666665553


No 39 
>PHA02131 hypothetical protein
Probab=39.37  E-value=23  Score=21.85  Aligned_cols=30  Identities=10%  Similarity=0.113  Sum_probs=20.3

Q ss_pred             CcCCHHHHhccCC------------CC-CeEEEE-cCeEeeccc
Q psy15180          3 KEFTYKEVVESTD------------KT-ANLIVI-KGVVYNVAP   32 (131)
Q Consensus         3 ~~~t~~ev~~h~~------------~~-~~wvii-~g~VYDvT~   32 (131)
                      +.|.++.+++-|+            .+ .||+.. +|+|-|+|=
T Consensus         2 kiyhpqhiakvngitkvdmirgh~~~g~~c~imfk~~~v~dctf   45 (70)
T PHA02131          2 KIYHPQHIAKVNGITKVDMIRGHYRFGISCWIMFKNDQVIDCTF   45 (70)
T ss_pred             cccchhHhhhhcCceEEEEeccceecceEEEEEEcCCCEEEeee
Confidence            3455666665554            22 599988 889999984


No 40 
>PRK00753 psbL photosystem II reaction center L; Provisional
Probab=38.79  E-value=73  Score=17.87  Aligned_cols=21  Identities=24%  Similarity=0.273  Sum_probs=9.7

Q ss_pred             chHHHHHHHHHHHHHHHHhcC
Q psy15180        111 PSWVVPLVFGLLVVLVYQYFQ  131 (131)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~  131 (131)
                      .||-+-++.++++.+--||+|
T Consensus        19 Ly~GlLlifvl~vLFssYffN   39 (39)
T PRK00753         19 LYLGLLLVFVLGILFSSYFFN   39 (39)
T ss_pred             HHHHHHHHHHHHHHHHhhccC
Confidence            355444444344444445554


No 41 
>PRK10144 formate-dependent nitrite reductase complex subunit NrfF; Provisional
Probab=37.17  E-value=44  Score=23.70  Aligned_cols=19  Identities=26%  Similarity=0.585  Sum_probs=13.1

Q ss_pred             CCCCcchHHHHHHHHHHHH
Q psy15180        106 EESGMPSWVVPLVFGLLVV  124 (131)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~  124 (131)
                      ++.+|..|+.|++++++..
T Consensus        98 ~~~t~~LW~~P~~lll~g~  116 (126)
T PRK10144         98 TGQTLVLWALPVVLLLLMA  116 (126)
T ss_pred             CcchHHHHHHHHHHHHHHH
Confidence            3457789999987655443


No 42 
>PF09125 COX2-transmemb:  Cytochrome C oxidase subunit II, transmembrane;  InterPro: IPR015209 This N-terminal domain forms the transmembrane region in subunit II of cytochrome c oxidase from Thermus thermophilus. This domain adopts a tertiary structure consisting of two antiparallel transmembrane helices, in a transmembrane helix hairpin fold []. ; PDB: 1EHK_B 2QPE_B 3S8F_B 4EV3_B 3BVD_B 3S8G_B 3EH3_B 3S3C_B 3S39_B 3QJQ_B ....
Probab=35.65  E-value=42  Score=18.79  Aligned_cols=22  Identities=9%  Similarity=0.398  Sum_probs=12.6

Q ss_pred             CcchHHHHHHHHHHHHHHHHhc
Q psy15180        109 GMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      +|..|-+..+++.++.++|...
T Consensus        15 ~Wi~F~l~mi~vFi~li~ytl~   36 (38)
T PF09125_consen   15 GWIAFALAMILVFIALIGYTLA   36 (38)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHh
Confidence            4555555555555666677543


No 43 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=33.35  E-value=30  Score=23.29  Aligned_cols=11  Identities=9%  Similarity=0.455  Sum_probs=5.2

Q ss_pred             HHHHHHHHHHh
Q psy15180        119 FGLLVVLVYQY  129 (131)
Q Consensus       119 ~~~~~~~~~~~  129 (131)
                      ++++.++.|||
T Consensus        74 IlVily~IyYF   84 (101)
T PF06024_consen   74 ILVILYAIYYF   84 (101)
T ss_pred             HHHHHhhheEE
Confidence            33444455555


No 44 
>PLN00027 aquaporin TIP; Provisional
Probab=32.01  E-value=46  Score=25.97  Aligned_cols=23  Identities=30%  Similarity=0.508  Sum_probs=19.9

Q ss_pred             CCcchHHHHHHHHHHHHHHHHhc
Q psy15180        108 SGMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      ..|.+|+-|++.++++.++|+++
T Consensus       215 ~~wvy~vgP~~Ga~laa~~y~~l  237 (252)
T PLN00027        215 NHWVYWAGPLIGGGIAGLVYELI  237 (252)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHH
Confidence            46889999999999999999876


No 45 
>PLN00184 aquaporin NIP1; Provisional
Probab=31.95  E-value=46  Score=26.81  Aligned_cols=23  Identities=17%  Similarity=0.050  Sum_probs=20.2

Q ss_pred             CCcchHHHHHHHHHHHHHHHHhc
Q psy15180        108 SGMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      ..|.+|+-|++.++++.++|+++
T Consensus       249 ~~WVy~vgPilGa~laal~y~~l  271 (296)
T PLN00184        249 GIWIYIVAPTLGAIAGAWVYNTV  271 (296)
T ss_pred             ccchHHhHHHHHHHHHHHHHHHH
Confidence            47889999999999999999876


No 46 
>PRK05420 aquaporin Z; Provisional
Probab=31.81  E-value=36  Score=26.22  Aligned_cols=23  Identities=26%  Similarity=0.492  Sum_probs=20.2

Q ss_pred             CCcchHHHHHHHHHHHHHHHHhc
Q psy15180        108 SGMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      ..|.+|+-|++.++++.++|+++
T Consensus       204 ~~wvy~vgP~~Ga~laa~~y~~l  226 (231)
T PRK05420        204 QLWLFWVAPIVGAIIGGLIYRLL  226 (231)
T ss_pred             ceEEeehHHHHHHHHHHHHHHHH
Confidence            46889999999999999999886


No 47 
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=31.72  E-value=20  Score=29.49  Aligned_cols=14  Identities=36%  Similarity=0.605  Sum_probs=11.4

Q ss_pred             cCCChHHHHHhcCC
Q psy15180         36 EHPGGEEVLLDQRG   49 (131)
Q Consensus        36 ~HPGG~~~l~~~aG   49 (131)
                      -||||.++|..+.+
T Consensus       276 ~HPGG~KVida~~~  289 (356)
T COG3424         276 VHPGGPKVIDAYEE  289 (356)
T ss_pred             eCCCCchHHHHHHH
Confidence            59999999987653


No 48 
>PLN00166 aquaporin TIP2; Provisional
Probab=30.49  E-value=51  Score=25.77  Aligned_cols=23  Identities=39%  Similarity=0.460  Sum_probs=19.7

Q ss_pred             CCcchHHHHHHHHHHHHHHHHhc
Q psy15180        108 SGMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      ..|.+|+-|++.++++.++|+++
T Consensus       213 ~~wvywvgPi~Ga~~aa~~y~~l  235 (250)
T PLN00166        213 QIWIYWVGPLVGGALAGLIYGDV  235 (250)
T ss_pred             ccchhhHHHHHHHHHHHHHHHHH
Confidence            56899999999989988888765


No 49 
>PF12652 CotJB:  CotJB protein;  InterPro: IPR024207 The cotJ operon proteins affect spore coat composition, and is controlled by sigma E. The genes, which include CotJB, are either required for the normal formation of the inner layers of the coat or are themselves structural components of the coat []. CotJB has been identified as a spore coat protein [].
Probab=30.36  E-value=16  Score=23.71  Aligned_cols=20  Identities=30%  Similarity=0.542  Sum_probs=16.1

Q ss_pred             EeeccccCccCCChHHHHHh
Q psy15180         27 VYNVAPFLNEHPGGEEVLLD   46 (131)
Q Consensus        27 VYDvT~f~~~HPGG~~~l~~   46 (131)
                      +.|++=|++.||.-.+.|..
T Consensus        15 ~~dl~LyLDTHP~d~~Al~~   34 (78)
T PF12652_consen   15 VVDLNLYLDTHPDDQEALEY   34 (78)
T ss_pred             HHHHHHHhcCCCCcHHHHHH
Confidence            56888999999998876653


No 50 
>PTZ00016 aquaglyceroporin; Provisional
Probab=30.33  E-value=39  Score=27.08  Aligned_cols=23  Identities=26%  Similarity=0.336  Sum_probs=19.9

Q ss_pred             CCcchHHHHHHHHHHHHHHHHhc
Q psy15180        108 SGMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      ..|.+|+-|++.++++.++|+++
T Consensus       266 ~~WVy~vgP~vGa~~aally~~l  288 (294)
T PTZ00016        266 YFWVPLVAPFVGAVLGMFLYDKF  288 (294)
T ss_pred             eeeeeehHHHHHHHHHHHHHHHH
Confidence            35888999999999999999886


No 51 
>PRK06764 hypothetical protein; Provisional
Probab=28.71  E-value=57  Score=21.84  Aligned_cols=21  Identities=29%  Similarity=0.524  Sum_probs=15.7

Q ss_pred             cCCCCCeEEEEcCeEee-cccc
Q psy15180         13 STDKTANLIVIKGVVYN-VAPF   33 (131)
Q Consensus        13 h~~~~~~wvii~g~VYD-vT~f   33 (131)
                      .++++...+.+||.+|| |-.|
T Consensus        80 f~kpg~yvirvngciy~dvytf  101 (105)
T PRK06764         80 FSKPGKYVIRVNGCIYNDVYTF  101 (105)
T ss_pred             ecCCccEEEEEccEEeeeeEEE
Confidence            45678888899999996 3444


No 52 
>TIGR02148 Fibro_Slime fibro-slime domain. This model represents a conserved region of about 90 amino acids, shared in at least 4 distinct large putative proteins from the slime mold Dictyostelium discoideum and 10 proteins from the rumen bacterium Fibrobacter succinogenes, and in no other species so far. We propose here the name fibro-slime domain
Probab=28.35  E-value=29  Score=23.26  Aligned_cols=25  Identities=12%  Similarity=0.126  Sum_probs=17.9

Q ss_pred             HHhccCCCCCeEEEEcCe-Eeecccc
Q psy15180          9 EVVESTDKTANLIVIKGV-VYNVAPF   33 (131)
Q Consensus         9 ev~~h~~~~~~wvii~g~-VYDvT~f   33 (131)
                      |.=+..+.+|.||-|||+ |-|+-.-
T Consensus        20 e~F~F~GDDDvWVFIn~kLv~DlGG~   45 (90)
T TIGR02148        20 QYFEFRGDDDVWVFINNKLVVDIGGQ   45 (90)
T ss_pred             cEEEEEcCCeEEEEECCEEEEEccCc
Confidence            344456789999999885 6676653


No 53 
>PF10855 DUF2648:  Protein of unknown function (DUF2648);  InterPro: IPR022561  This family of proteins with unknown function appears to be restricted to eubacteia. 
Probab=28.08  E-value=27  Score=18.98  Aligned_cols=16  Identities=13%  Similarity=0.357  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHHHhc
Q psy15180        115 VPLVFGLLVVLVYQYF  130 (131)
Q Consensus       115 ~~~~~~~~~~~~~~~~  130 (131)
                      +.++++.+++++|+-+
T Consensus         6 i~L~l~ga~f~~fKKy   21 (33)
T PF10855_consen    6 IILILGGAAFYGFKKY   21 (33)
T ss_pred             ehhhhhhHHHHHHHHH
Confidence            3455567777888765


No 54 
>KOG2759|consensus
Probab=28.04  E-value=17  Score=30.98  Aligned_cols=43  Identities=12%  Similarity=0.346  Sum_probs=32.6

Q ss_pred             CCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCH
Q psy15180         17 TANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHST   63 (131)
Q Consensus        17 ~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~   63 (131)
                      +..|+.+-  -.|++.|++.||-|..++.++.||..-  |+-..|..
T Consensus       380 Dp~iL~VA--c~DIge~Vr~yP~gk~vv~k~ggKe~v--M~Llnh~d  422 (442)
T KOG2759|consen  380 DPIILCVA--CHDIGEYVRHYPEGKAVVEKYGGKERV--MNLLNHED  422 (442)
T ss_pred             CCceeehh--hhhHHHHHHhCchHhHHHHHhchHHHH--HHHhcCCC
Confidence            45666664  479999999999999999999998543  44444543


No 55 
>PF02797 Chal_sti_synt_C:  Chalcone and stilbene synthases, C-terminal domain;  InterPro: IPR012328 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2.3.1.74 from EC) and stilbene synthases (STS) (formerly known as resveratrol synthases) are related plant enzymes. CHS is an important enzyme in flavanoid biosynthesis and STS is a key enzyme in stilbene-type phyloalexin biosynthesis. Both enzymes catalyze the addition of three molecules of malonyl-CoA to a starter CoA ester (a typical example is 4-coumaroyl-CoA), producing either a chalcone (with CHS) or stilbene (with STS) []. These enzymes have a conserved cysteine residue, located in the central section of the protein sequence, which is essential for the catalytic activity of both enzymes and probably represents the binding site for the 4-coumaryl-CoA group []. This domain of chalcone synthase is reported to be structurally similar to domains in thiolase and beta-ketoacyl synthase. The differences in activity are accounted for by differences in the N-terminal domain. ; GO: 0016746 transferase activity, transferring acyl groups; PDB: 3OV2_A 3OV3_B 1Z1F_A 1Z1E_A 3ALE_C 3OIT_A 2H84_A 1TEE_D 1TED_A 2P0U_A ....
Probab=27.75  E-value=27  Score=25.20  Aligned_cols=14  Identities=36%  Similarity=0.665  Sum_probs=10.1

Q ss_pred             ccCCChHHHHHhcC
Q psy15180         35 NEHPGGEEVLLDQR   48 (131)
Q Consensus        35 ~~HPGG~~~l~~~a   48 (131)
                      .-||||.++|....
T Consensus        64 avHPGG~~ILd~v~   77 (151)
T PF02797_consen   64 AVHPGGRKILDAVE   77 (151)
T ss_dssp             EEE-SSHHHHHHHH
T ss_pred             eecCChHHHHHHHH
Confidence            46999999888654


No 56 
>PF15168 TRIQK:  Triple QxxK/R motif-containing protein family
Probab=27.19  E-value=80  Score=20.53  Aligned_cols=17  Identities=18%  Similarity=0.454  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHHHHHHhc
Q psy15180        114 VVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       114 ~~~~~~~~~~~~~~~~~  130 (131)
                      +..++++++++.+|.|+
T Consensus        55 l~ail~lL~a~Ya~fyl   71 (79)
T PF15168_consen   55 LAAILVLLLAFYAFFYL   71 (79)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44444445555555554


No 57 
>PF03918 CcmH:  Cytochrome C biogenesis protein;  InterPro: IPR005616 Members of this family include NrfF, CcmH, CycL, Ccl2.; PDB: 2KW0_A 2HL7_A.
Probab=27.17  E-value=23  Score=25.62  Aligned_cols=19  Identities=21%  Similarity=0.209  Sum_probs=0.0

Q ss_pred             CCCcchHHHHHHHHHHHHH
Q psy15180        107 ESGMPSWVVPLVFGLLVVL  125 (131)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~  125 (131)
                      +.+|..|+.|++++++..+
T Consensus        99 ~~~~~lW~~P~~~l~~g~~  117 (148)
T PF03918_consen   99 GFTWLLWLGPFLLLLLGGA  117 (148)
T ss_dssp             -------------------
T ss_pred             ccHHHHHHHHHHHHHHHHH
Confidence            4567789999987655554


No 58 
>PF05521 Phage_H_T_join:  Phage head-tail joining protein ;  InterPro: IPR008767  This entry describes the head-tail adaptor protein of bacteriophage SPP1 and related proteins in other bacteriophage and prophage regions of bacterial genomes. Homologues are also found in Gene Transfer Agents (GTA) [], including ORFg7 (RCAP_rcc01689) of the GTA of Rhodobacter capsulatus (Rhodopseudomonas capsulata) [see Fig.1, in ].; PDB: 2KCA_A 2KZ4_A.
Probab=26.96  E-value=66  Score=19.93  Aligned_cols=17  Identities=29%  Similarity=0.423  Sum_probs=12.6

Q ss_pred             CCeEEEEcCeEeecccc
Q psy15180         17 TANLIVIKGVVYNVAPF   33 (131)
Q Consensus        17 ~~~wvii~g~VYDvT~f   33 (131)
                      .+..+.++|++|+|...
T Consensus        65 ~~~ri~~~g~~y~I~~i   81 (95)
T PF05521_consen   65 PDMRIKYDGKVYNIKSI   81 (95)
T ss_dssp             TTEEEEECTEEEEE-S-
T ss_pred             cceEEEECCEEEEEEEE
Confidence            45668889999999884


No 59 
>PRK14750 kdpF potassium-transporting ATPase subunit F; Provisional
Probab=26.84  E-value=1e+02  Score=16.24  Aligned_cols=13  Identities=46%  Similarity=0.613  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHhcC
Q psy15180        119 FGLLVVLVYQYFQ  131 (131)
Q Consensus       119 ~~~~~~~~~~~~~  131 (131)
                      ++++.+++|..+|
T Consensus        13 ~lLl~YLvYAL~n   25 (29)
T PRK14750         13 LLLLGYLVYALFN   25 (29)
T ss_pred             HHHHHHHHHHHcC
Confidence            3456667776654


No 60 
>cd00333 MIP Major intrinsic protein (MIP) superfamily. Members of the MIP superfamily function as membrane channels that selectively transport water, small neutral molecules, and ions out of and between cells. The channel proteins share a common fold: the N-terminal cytosolic portion followed by six transmembrane helices, which might have arisen through gene duplication. On the basis of sequence similarity and functional characteristics, the superfamily can be subdivided into two major groups: water-selective channels called aquaporins (AQPs) and glycerol uptake facilitators (GlpFs). AQPs are found in all three kingdoms of life, while GlpFs have been characterized only within microorganisms.
Probab=26.63  E-value=62  Score=24.55  Aligned_cols=24  Identities=33%  Similarity=0.491  Sum_probs=20.4

Q ss_pred             CCCcchHHHHHHHHHHHHHHHHhc
Q psy15180        107 ESGMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      ...|.||+-|++.++++.++|+++
T Consensus       205 ~~~~vy~vap~lGai~aa~l~~~~  228 (228)
T cd00333         205 HYFWVYWVGPLIGAIAGALVYDYV  228 (228)
T ss_pred             ceeehhhhHHHHHHHHHHHHHHhC
Confidence            357889999999999999999874


No 61 
>COG3088 CcmH Uncharacterized protein involved in biosynthesis of c-type cytochromes [Posttranslational modification, protein turnover, chaperones]
Probab=26.06  E-value=72  Score=23.41  Aligned_cols=20  Identities=25%  Similarity=0.414  Sum_probs=14.6

Q ss_pred             CCCcchHHHHHHHHHHHHHH
Q psy15180        107 ESGMPSWVVPLVFGLLVVLV  126 (131)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~  126 (131)
                      ..+|..|.+|++++++.+.+
T Consensus       103 ~~T~lLW~~Pv~llllG~~~  122 (153)
T COG3088         103 GQTLLLWGLPVVLLLLGGVL  122 (153)
T ss_pred             hhHHHHHHhHHHHHHHHHHH
Confidence            45678999999876666543


No 62 
>PRK10862 SoxR reducing system protein RseC; Provisional
Probab=23.63  E-value=78  Score=22.88  Aligned_cols=20  Identities=30%  Similarity=0.310  Sum_probs=13.9

Q ss_pred             CCcchHHHHHHHHHHH-HHHH
Q psy15180        108 SGMPSWVVPLVFGLLV-VLVY  127 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~-~~~~  127 (131)
                      ..+..|++|++.+++. .+++
T Consensus        77 aa~lvYllPLl~li~ga~l~~   97 (154)
T PRK10862         77 SALLVYMTPLVGLFLGAALFQ   97 (154)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            4567899999977754 3443


No 63 
>PLN00182 putative aquaporin NIP4; Provisional
Probab=23.49  E-value=79  Score=25.29  Aligned_cols=23  Identities=22%  Similarity=0.041  Sum_probs=19.6

Q ss_pred             CCcchHHHHHHHHHHHHHHHHhc
Q psy15180        108 SGMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      ..|.||+-|++.++++.++|+++
T Consensus       230 ~~wvY~vap~lGA~lgally~~l  252 (283)
T PLN00182        230 GIWVYIVGPFVGIIAGGFVYNLI  252 (283)
T ss_pred             ceeHHHHHHHHHHHHHHHHHHHH
Confidence            46889999999989998888875


No 64 
>PLN00026 aquaporin  NIP; Provisional
Probab=23.48  E-value=79  Score=25.53  Aligned_cols=23  Identities=17%  Similarity=-0.023  Sum_probs=19.7

Q ss_pred             CCcchHHHHHHHHHHHHHHHHhc
Q psy15180        108 SGMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      ..|.+|+-|++.++++.++|+++
T Consensus       258 ~~wVy~vaPilGAilga~ly~~~  280 (298)
T PLN00026        258 AIWIYLVAPTLGALAGAGTYTAV  280 (298)
T ss_pred             heeHHHHHHHHHHHHHHHHHHHH
Confidence            46889999999989988899876


No 65 
>PF07533 BRK:  BRK domain;  InterPro: IPR006576 BRK is a domain of unknown function found only in the metazoa and in association with CHROMO domain (IPR000953 from INTERPRO) and DEAD/DEAH box helicase domain (IPR011545 from INTERPRO).; GO: 0005515 protein binding, 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2DL6_A 2CKA_A 2V0F_A 2V0E_A 2CKC_A.
Probab=23.16  E-value=14  Score=21.53  Aligned_cols=14  Identities=36%  Similarity=0.774  Sum_probs=9.8

Q ss_pred             eEeeccccCccCCC
Q psy15180         26 VVYNVAPFLNEHPG   39 (131)
Q Consensus        26 ~VYDvT~f~~~HPG   39 (131)
                      +.=|+..|+..|||
T Consensus        26 ~~~~L~~WL~~~P~   39 (46)
T PF07533_consen   26 KLKELEEWLEEHPG   39 (46)
T ss_dssp             BCCCHHHHHHH-TT
T ss_pred             CHHHHHHHHHHCcC
Confidence            34578888889997


No 66 
>PF11027 DUF2615:  Protein of unknown function (DUF2615);  InterPro: IPR020309 This entry represents a group of uncharacterised protein from the Metazoa, including CD034 (or C4orf34) and YQF4 (or C34C12.4).
Probab=21.82  E-value=1.6e+02  Score=20.14  Aligned_cols=19  Identities=11%  Similarity=0.356  Sum_probs=11.4

Q ss_pred             cchHHHHHHHHHHHHHHHH
Q psy15180        110 MPSWVVPLVFGLLVVLVYQ  128 (131)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~  128 (131)
                      .+.+++.++.+++|.++|.
T Consensus        53 ~~~~~~~~~w~~~A~~ly~   71 (103)
T PF11027_consen   53 NSMFMMMMLWMVLAMALYL   71 (103)
T ss_pred             ccHHHHHHHHHHHHHHHHH
Confidence            4456666666566666654


No 67 
>PLN00183 putative aquaporin NIP7; Provisional
Probab=21.45  E-value=94  Score=24.70  Aligned_cols=23  Identities=9%  Similarity=0.072  Sum_probs=20.0

Q ss_pred             CCcchHHHHHHHHHHHHHHHHhc
Q psy15180        108 SGMPSWVVPLVFGLLVVLVYQYF  130 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~  130 (131)
                      ..|.+|+-|++.++++.++|+++
T Consensus       232 ~~wvy~vapilGailaa~l~~~l  254 (274)
T PLN00183        232 DIWIYITAPTIGAVAGALMFHLL  254 (274)
T ss_pred             heehHHHHHHHHHHHHHHHHHHH
Confidence            46889999999999999999875


No 68 
>PF10618 Tail_tube:  Phage tail tube protein;  InterPro: IPR019596  This entry is represented by Bacteriophage Mu, GpM tail tube protein. Bacteriophage Mu has an eicosahedral head and contractile tail. The tail is composed of an outer sheath and an inner tube. 
Probab=21.23  E-value=76  Score=22.00  Aligned_cols=25  Identities=24%  Similarity=0.274  Sum_probs=21.4

Q ss_pred             CCeEEEEcCeEeeccccCccCCChH
Q psy15180         17 TANLIVIKGVVYNVAPFLNEHPGGE   41 (131)
Q Consensus        17 ~~~wvii~g~VYDvT~f~~~HPGG~   41 (131)
                      +.++|.|||+-|++.+=....|||.
T Consensus         7 G~a~i~vdG~~l~~~~g~~~~~gg~   31 (119)
T PF10618_consen    7 GTAYIRVDGQQLPVKGGATYNPGGV   31 (119)
T ss_pred             EEEEEEECCEEEEccCCeEECCCCe
Confidence            5689999999999987677788885


No 69 
>PF06692 MNSV_P7B:  Melon necrotic spot virus P7B protein;  InterPro: IPR009575 This family consists of several Melon necrotic spot virus (MNSV) P7B proteins. The function of this family is unknown.
Probab=21.09  E-value=1.4e+02  Score=18.33  Aligned_cols=14  Identities=14%  Similarity=0.401  Sum_probs=6.8

Q ss_pred             hHHHHHHHHHHHHH
Q psy15180        112 SWVVPLVFGLLVVL  125 (131)
Q Consensus       112 ~~~~~~~~~~~~~~  125 (131)
                      .+..|+++++++++
T Consensus        12 d~~~~lLiliis~~   25 (61)
T PF06692_consen   12 DYSGPLLILIISFV   25 (61)
T ss_pred             cchhHHHHHHHHHH
Confidence            45555555444443


No 70 
>PF08078 PsaX:  PsaX family;  InterPro: IPR012986 This family consists of the PsaX family of photosystem I (PSI) protein subunits. PSI is a large multi-subunit pigment protein complex embedded in the thylakoid membranes of green plants and cyanobacteria. PsaX is one of the 12 protein subunits found in PSI and these subunits are arranged as monomers or trimers within the membrane as shown by the structure of the trimeric complex from Synechococcus elongatus [].; PDB: 3PCQ_X 1JB0_X.
Probab=21.03  E-value=1.6e+02  Score=16.23  Aligned_cols=9  Identities=22%  Similarity=0.530  Sum_probs=4.3

Q ss_pred             HHHHHHHHh
Q psy15180        121 LLVVLVYQY  129 (131)
Q Consensus       121 ~~~~~~~~~  129 (131)
                      =+++.+|||
T Consensus        26 NflVAayYF   34 (37)
T PF08078_consen   26 NFLVAAYYF   34 (37)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHh
Confidence            344455554


No 71 
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=20.42  E-value=1e+02  Score=21.36  Aligned_cols=19  Identities=11%  Similarity=0.287  Sum_probs=13.4

Q ss_pred             CCcchHHHHHHHHHHHHHH
Q psy15180        108 SGMPSWVVPLVFGLLVVLV  126 (131)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~  126 (131)
                      ..+..|++|++++++.+++
T Consensus        70 aa~l~Y~lPll~li~g~~l   88 (135)
T PF04246_consen   70 AAFLVYLLPLLALIAGAVL   88 (135)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4567899999876665543


No 72 
>PF14453 ThiS-like:  ThiS-like ubiquitin 
Probab=20.13  E-value=1.1e+02  Score=18.67  Aligned_cols=22  Identities=18%  Similarity=0.412  Sum_probs=16.3

Q ss_pred             CCHHHHhccCCCCCeEEEEcCe
Q psy15180          5 FTYKEVVESTDKTANLIVIKGV   26 (131)
Q Consensus         5 ~t~~ev~~h~~~~~~wvii~g~   26 (131)
                      -|+.++++..+++.-.+++||-
T Consensus        16 ~tl~~lr~~~k~~~DI~I~NGF   37 (57)
T PF14453_consen   16 TTLFELRKESKPDADIVILNGF   37 (57)
T ss_pred             cCHHHHHHhhCCCCCEEEEcCc
Confidence            4788999877776556688883


Done!