Query         psy15184
Match_columns 160
No_of_seqs    171 out of 404
Neff          5.3 
Searched_HMMs 46136
Date          Fri Aug 16 22:44:38 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15184.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15184hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1616|consensus              100.0 9.5E-43 2.1E-47  296.9   9.7  151    1-160   120-287 (289)
  2 PF04739 AMPKBI:  5'-AMP-activa 100.0 5.2E-37 1.1E-41  226.4   4.6   89   72-160     2-100 (100)
  3 cd02859 AMPKbeta_GBD_like AMP-  99.5   3E-14 6.6E-19  100.0   4.7   41    1-50     39-79  (79)
  4 cd02861 E_set_proteins_like E   98.9 1.3E-09 2.8E-14   76.4   4.7   41    1-49     40-81  (82)
  5 cd02858 Esterase_N_term Estera  96.9  0.0016 3.4E-08   45.9   4.2   23    4-26     48-70  (85)
  6 cd02688 E_set E or "early" set  94.3   0.038 8.1E-07   36.7   2.4   24    3-26     45-69  (83)
  7 PF02922 CBM_48:  Carbohydrate-  70.3     2.6 5.7E-05   28.5   1.4   16    5-20     59-74  (85)
  8 cd05814 CBM20_Prei4 Prei4, N-t  67.4     8.6 0.00019   28.4   3.7   16    2-17     51-67  (120)
  9 cd00503 Frataxin Frataxin is a  65.9     4.5 9.7E-05   29.9   1.9   20    6-26     65-84  (105)
 10 TIGR03422 mito_frataxin fratax  63.8       6 0.00013   29.0   2.2   19    7-26     66-84  (97)
 11 PRK00446 cyaY frataxin-like pr  62.2       6 0.00013   29.3   2.0   20    6-26     64-83  (105)
 12 PF01491 Frataxin_Cyay:  Fratax  61.9     8.1 0.00018   28.6   2.7   20    6-26     67-87  (109)
 13 KOG0045|consensus               58.9     8.5 0.00018   36.7   2.9   23    6-29    115-140 (612)
 14 cd05809 CBM20_beta_amylase Bet  57.2      13 0.00029   26.4   3.1   15    2-16     53-68  (99)
 15 PF01378 IgG_binding_B:  B doma  52.8     6.5 0.00014   26.2   0.7   11   16-26     38-48  (55)
 16 PF00686 CBM_20:  Starch bindin  52.5      10 0.00022   26.6   1.8   15    2-16     53-68  (96)
 17 cd02856 Glycogen_debranching_e  51.9      16 0.00035   26.0   2.8   15    5-20     54-68  (103)
 18 TIGR03421 FeS_CyaY iron donor   51.8      11 0.00024   27.7   2.0   20    6-26     62-81  (102)
 19 smart00230 CysPc Calpain-like   51.4      16 0.00034   31.6   3.1   22    6-28     99-123 (318)
 20 PF00648 Peptidase_C2:  Calpain  51.2      16 0.00034   30.7   3.0   21    7-28     87-110 (298)
 21 cd05820 CBM20_novamyl Novamyl   51.1      26 0.00056   25.2   3.8   15    2-16     55-70  (103)
 22 cd00044 CysPc Calpains, domain  48.9      18  0.0004   30.8   3.1   24    5-29    106-132 (315)
 23 cd05818 CBM20_water_dikinase P  47.1      33 0.00071   24.2   3.7   24    2-25     46-75  (92)
 24 PRK01379 cyaY frataxin-like pr  44.8      13 0.00027   27.7   1.3   18    7-26     66-83  (103)
 25 cd05808 CBM20_alpha_amylase Al  43.6      36 0.00078   23.5   3.4   15    2-16     48-63  (95)
 26 TIGR00481 Raf kinase inhibitor  42.8      17 0.00038   27.9   1.9   11    6-16     94-104 (141)
 27 PF14645 Chibby:  Chibby family  42.0      20 0.00043   27.1   2.0   17    4-21     44-60  (116)
 28 cd05810 CBM20_alpha_MTH Glucan  39.8      50  0.0011   23.5   3.8   15    2-16     49-64  (97)
 29 cd05807 CBM20_CGTase CGTase, C  38.4      29 0.00062   24.7   2.3   15    2-16     55-70  (101)
 30 cd02857 CD_pullulan_degrading_  38.3      48   0.001   23.3   3.5   15    2-16     65-79  (116)
 31 PF13954 PapC_N:  PapC N-termin  37.4      36 0.00079   25.8   2.9   23    4-26     26-48  (146)
 32 PF14121 DUF4289:  Domain of un  34.8      59  0.0013   30.7   4.4   39  114-152   494-535 (614)
 33 PF14347 DUF4399:  Domain of un  33.8      38 0.00083   24.2   2.3   24    2-26     56-79  (87)
 34 cd05815 CBM20_DPE2_repeat1 Dis  33.5      53  0.0012   23.2   3.1   15    2-16     50-65  (101)
 35 PF03072 DUF237:  MG032/MG096/M  31.9      54  0.0012   25.7   3.0   22    7-28     87-111 (137)
 36 PF06573 Churchill:  Churchill   30.6      33 0.00072   26.0   1.6   13    9-21     70-82  (112)
 37 cd05813 CBM20_genethonin_1 Gen  30.5      45 0.00098   23.3   2.2   15    2-16     47-62  (95)
 38 cd05817 CBM20_DSP Dual-specifi  30.1      45 0.00098   23.7   2.2   15    2-16     47-62  (100)
 39 cd05811 CBM20_glucoamylase Glu  30.0      46   0.001   23.6   2.3   15    2-16     58-73  (106)
 40 PF08308 PEGA:  PEGA domain;  I  29.5      59  0.0013   21.2   2.6   16    4-19     31-46  (71)
 41 cd05467 CBM20 The family 20 ca  29.3      50  0.0011   22.6   2.3   15    2-16     48-65  (96)
 42 cd02852 Isoamylase_N_term Isoa  28.9      37 0.00079   24.7   1.6   16    5-21     58-73  (119)
 43 cd02860 Pullulanase_N_term Pul  26.8      62  0.0013   22.7   2.4   20    6-26     57-81  (100)
 44 COG5083 SMP2 Uncharacterized p  26.7      67  0.0014   30.3   3.1   32    3-44    344-385 (580)
 45 cd05816 CBM20_DPE2_repeat2 Dis  26.7      58  0.0012   23.0   2.3   15    2-16     48-64  (99)
 46 PF09829 DUF2057:  Uncharacteri  26.6      62  0.0014   25.6   2.7   24    3-26     30-53  (189)
 47 TIGR03769 P_ac_wall_RPT actino  26.4      82  0.0018   19.4   2.6   14    6-19     11-29  (41)
 48 smart00107 BTK Bruton's tyrosi  25.3      34 0.00074   20.8   0.7   17   10-26      8-24  (36)
 49 PF14321 DUF4382:  Domain of un  24.4      57  0.0012   24.5   2.0   21    3-23     63-85  (139)
 50 COG5227 SMT3 Ubiquitin-like pr  23.7      85  0.0018   23.3   2.7   18   10-28     63-80  (103)
 51 smart00155 PLDc Phospholipase   23.7      98  0.0021   16.9   2.4   15    8-22      3-18  (28)
 52 PF07495 Y_Y_Y:  Y_Y_Y domain;   23.5      64  0.0014   20.4   1.8   20    7-26      5-27  (66)
 53 PF00339 Arrestin_N:  Arrestin   22.3      37  0.0008   24.5   0.5   29    3-43     88-116 (149)
 54 TIGR01160 SUI1_MOF2 translatio  22.0 1.1E+02  0.0023   23.1   3.0   21  135-155    24-44  (110)
 55 cd05806 CBM20_laforin Laforin   20.4      93   0.002   23.2   2.4   15    2-16     56-74  (112)
 56 PRK04517 hypothetical protein;  20.1      97  0.0021   25.5   2.7   24    3-26     54-77  (216)

No 1  
>KOG1616|consensus
Probab=100.00  E-value=9.5e-43  Score=296.91  Aligned_cols=151  Identities=63%  Similarity=1.025  Sum_probs=140.2

Q ss_pred             CEEecCCceEEEEEEECCEEEECCCCccccccccCceeeCCCCCcceEEEcccCC--hhhhhhcccC--------CCCCC
Q psy15184          1 MIIDLPEGEHEYKFLVDGEWKVNPQEVKCIAFLVSPVQENKLGSKNNKLAVKKTD--FEVFEALDVD--------SQDTT   70 (160)
Q Consensus         1 ~i~~Lp~G~h~ykFiVDG~w~~~~~~~p~~~~~~~p~~~d~~G~~nN~i~v~~~d--~e~~~al~~d--------s~~~~   70 (160)
                      ++++||+|.|+|||+|||+|++|++. |        +++|+.|+.||+|+|.+.+  +++++++.++        +.+..
T Consensus       120 ~~~dL~~g~~~~kf~vdge~~~s~~~-p--------ta~d~~Gn~~N~i~v~~~~~v~~~~~~l~~~~~~~~~~~s~e~~  190 (289)
T KOG1616|consen  120 TILDLPPGEHEYKFIVDGEWRHDPDL-P--------TAEDSLGNLNNILEVQDPDEVFEVFQALEEDLPSSNHSESSEVP  190 (289)
T ss_pred             eeEecCCceEEEEEecCCceecCCCC-c--------ccccccCCcccceEecCccccchhhhhhhhhccccccccccccC
Confidence            47899999999999999999999999 7        8999999999999999999  9998888776        33433


Q ss_pred             CC-------CCCCCcccCCCCCCCCCCCCCCCCCcccccccCCCCCCCCCCCCCCCCCCeEEeeeEEEeecCCCEEEEEE
Q psy15184         71 PK-------KDDEYSQVIPPSKPWEKQPGPPILPPHLLQVILNKDTPLSCEPTLLPQPNHVMLNHLYALSIKDGVMVLST  143 (160)
Q Consensus        71 ~~-------~~~~Y~~eip~~~~~~k~~~PP~LPphL~~~iLN~~~~~~~~~~~Lp~P~Hv~LNHLy~~sik~~~~~l~~  143 (160)
                      ..       +.++|+|++|..++++++..||.|||||.++|||+++..+|++..+++|+||+|||||+.+||++++++++
T Consensus       191 ~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~p~lpp~l~~v~lnk~~~~~~~~~~~~~p~hv~lnhl~~~sik~~~~~~~~  270 (289)
T KOG1616|consen  191 NLPEELEAKPLGSYTQEKPAVEDEEKAMAPPVLPPHLLQVILNKDTQVSCDPALLPEPNHVALNHLYALSIKDGVMVLSF  270 (289)
T ss_pred             CCccccccccccccccccchhhcchhcccCCCCCcchheeeccccccccccccccCCccchhhhhhhhhccCCCeeEecc
Confidence            33       38899999999999888888999999999999999999999999999999999999999999999999999


Q ss_pred             eeEecceeEEEEEeeeC
Q psy15184        144 THRYRKKYVTTLLYKPI  160 (160)
Q Consensus       144 T~Ry~~KyvT~vlYkp~  160 (160)
                      ||||++||||+++|||+
T Consensus       271 ~~r~~~k~vt~~lyk~~  287 (289)
T KOG1616|consen  271 THRYKKKYVTTGLYKPL  287 (289)
T ss_pred             eecccccceeEEeeeec
Confidence            99999999999999996


No 2  
>PF04739 AMPKBI:  5'-AMP-activated protein kinase beta subunit, interation domain;  InterPro: IPR006828 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This interaction domain is found in the beta subunit of the 5-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex []. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known []. The isoamylase domain (IPR004193 from INTERPRO) is sometimes found associated with proteins that contain this C-terminal domain.; GO: 0005515 protein binding; PDB: 2QRE_D 2OOY_B 2OOX_B 2QRD_D 2QR1_D 2QRC_D 1Z0N_C 4EAK_B 4EAL_B 4EAG_B ....
Probab=100.00  E-value=5.2e-37  Score=226.40  Aligned_cols=89  Identities=56%  Similarity=0.918  Sum_probs=66.8

Q ss_pred             CCCCCCcccCCCCC----------CCCCCCCCCCCCcccccccCCCCCCCCCCCCCCCCCCeEEeeeEEEeecCCCEEEE
Q psy15184         72 KKDDEYSQVIPPSK----------PWEKQPGPPILPPHLLQVILNKDTPLSCEPTLLPQPNHVMLNHLYALSIKDGVMVL  141 (160)
Q Consensus        72 ~~~~~Y~~eip~~~----------~~~k~~~PP~LPphL~~~iLN~~~~~~~~~~~Lp~P~Hv~LNHLy~~sik~~~~~l  141 (160)
                      +++++|+++||+..          .++..+.||.|||||+++|||+++...++++.||+|+||+|||||+++||+||+|+
T Consensus         2 ~p~~~ys~~iP~~~~~~~~~~~~~~~~~~~~PP~lPp~L~~~iLN~~~~~~~~~~~Lp~P~HV~LNHL~~~~ik~~v~al   81 (100)
T PF04739_consen    2 SPESSYSSEIPENLQDDDEFEEQPEEEFAKEPPSLPPHLQKTILNKPSSSTDDPSVLPIPNHVVLNHLYTSSIKDGVLAL   81 (100)
T ss_dssp             -----EESS--HCCCSCCCCCHHH--TCCCS--BS-GGGCSEECCSCTCHHSHTTB-----GGGTTBEEEEEEBTTEEEE
T ss_pred             CCCcCccccCCccccchhhhhhhhcccccCCCCCCChhhCeeccCCCCcccCccccCCCCCEEEecceEEcccCCCeEEE
Confidence            46788999999974          13455679999999999999998878899999999999999999999999999999


Q ss_pred             EEeeEecceeEEEEEeeeC
Q psy15184        142 STTHRYRKKYVTTLLYKPI  160 (160)
Q Consensus       142 ~~T~Ry~~KyvT~vlYkp~  160 (160)
                      |+|||||+||||+|||||+
T Consensus        82 ~~T~Ryk~KyVT~vlYkP~  100 (100)
T PF04739_consen   82 GTTHRYKSKYVTTVLYKPI  100 (100)
T ss_dssp             EEEEEETTEEEEEEEEEE-
T ss_pred             EEEEEecceEEEEEEecCC
Confidence            9999999999999999996


No 3  
>cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding  domain (GBD). AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as a alpha-beta-gamma heterotrimer. This domain is the glycogen binding domain of the beta subunit.
Probab=99.49  E-value=3e-14  Score=100.03  Aligned_cols=41  Identities=37%  Similarity=0.775  Sum_probs=38.2

Q ss_pred             CEEecCCceEEEEEEECCEEEECCCCccccccccCceeeCCCCCcceEEE
Q psy15184          1 MIIDLPEGEHEYKFLVDGEWKVNPQEVKCIAFLVSPVQENKLGSKNNKLA   50 (160)
Q Consensus         1 ~i~~Lp~G~h~ykFiVDG~w~~~~~~~p~~~~~~~p~~~d~~G~~nN~i~   50 (160)
                      ++++||+|.|+|||+|||+|++|+++ +        ++.|++|+.||+|+
T Consensus        39 ~~~~L~~g~y~YkF~Vdg~w~~d~~~-~--------~~~d~~G~~NN~i~   79 (79)
T cd02859          39 ATLRLPPGKYQYKFIVDGEWRHSPDL-P--------TETDDEGNVNNVID   79 (79)
T ss_pred             EEEEcCCCCEEEEEEECCEEEeCCCC-C--------ccCCCCCcEeeeEC
Confidence            36899999999999999999999999 7        78999999999985


No 4  
>cd02861 E_set_proteins_like E or "early" set-like proteins.  These alpha amylase-like sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies are associated with different types of catalytic domains at  either the N-terminal or C-terminal end.  Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase.
Probab=98.93  E-value=1.3e-09  Score=76.40  Aligned_cols=41  Identities=39%  Similarity=0.810  Sum_probs=36.0

Q ss_pred             CEEecCCceEEEEEEECCEEE-ECCCCccccccccCceeeCCCCCcceEE
Q psy15184          1 MIIDLPEGEHEYKFLVDGEWK-VNPQEVKCIAFLVSPVQENKLGSKNNKL   49 (160)
Q Consensus         1 ~i~~Lp~G~h~ykFiVDG~w~-~~~~~~p~~~~~~~p~~~d~~G~~nN~i   49 (160)
                      +++.|++|.|+|||+|||.|. .||.. ++       ...|++|+.||+|
T Consensus        40 ~~~~l~~G~y~Ykf~vdg~~~~~DP~~-~~-------~~~~~~g~~n~v~   81 (82)
T cd02861          40 VTVELRPGRYEYKFVVDGEWVIVDPNA-AA-------YVDDGFGGKNAVF   81 (82)
T ss_pred             EEEeCCCCcEEEEEEECCEEeeCCCCC-Cc-------eecCCCCccceEc
Confidence            367899999999999999999 89988 43       6899999999987


No 5  
>cd02858 Esterase_N_term Esterase N-terminal domain. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminus of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies.  These domains are associated with different types of catalytic domains at  either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions.  Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase.
Probab=96.88  E-value=0.0016  Score=45.94  Aligned_cols=23  Identities=39%  Similarity=0.683  Sum_probs=21.3

Q ss_pred             ecCCceEEEEEEECCEEEECCCC
Q psy15184          4 DLPEGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         4 ~Lp~G~h~ykFiVDG~w~~~~~~   26 (160)
                      .|.+|.|+|+|+|||.|+.||..
T Consensus        48 ~l~~g~Y~Y~~~vdg~~~~DP~s   70 (85)
T cd02858          48 PLAPGIYTYSFLVDGVRVIDPSN   70 (85)
T ss_pred             CCCCcEEEEEEEECCeEecCCCC
Confidence            47788999999999999999998


No 6  
>cd02688 E_set E or "early" set of sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies.  These domains are associated with different types of catalytic domains at  either the N-terminal or C-terminal end.  Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase.
Probab=94.26  E-value=0.038  Score=36.70  Aligned_cols=24  Identities=33%  Similarity=0.685  Sum_probs=19.9

Q ss_pred             EecCC-ceEEEEEEECCEEEECCCC
Q psy15184          3 IDLPE-GEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         3 ~~Lp~-G~h~ykFiVDG~w~~~~~~   26 (160)
                      +.+.. |.++|||.|||.|..++..
T Consensus        45 v~~~~~~~~~Y~~~v~~~~~~~~~~   69 (83)
T cd02688          45 LPLPSPGKYQYKYVLDGGKGPDEGE   69 (83)
T ss_pred             EcCCCCCCeEEEEEEeCCCCCCCCC
Confidence            45555 8999999999999888776


No 7  
>PF02922 CBM_48:  Carbohydrate-binding module 48 (Isoamylase N-terminal domain);  InterPro: IPR004193 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Enzymes containing this domain belong to family 13 (GH13 from CAZY) of the glycosyl hydrolases. This domain is found in a range of enzymes that act on branched substrates ie. isoamylase, pullulanase and branching enzyme. Isoamylase hydrolyses 1,6-alpha-D-glucosidic branch linkages in glycogen, amylopectin and dextrin; 1,4-alpha-glucan branching enzyme functions in the formation of 1,6-glucosidic linkages of glycogen; and pullulanase is a starch-debranching enzyme.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 2BHZ_A 2BY2_A 2BY3_A 2BXY_A 2BY1_A 2BHY_A 2BHU_A 2BXZ_A 2BY0_A 2FHB_A ....
Probab=70.32  E-value=2.6  Score=28.52  Aligned_cols=16  Identities=44%  Similarity=0.787  Sum_probs=12.5

Q ss_pred             cCCceEEEEEEECCEE
Q psy15184          5 LPEGEHEYKFLVDGEW   20 (160)
Q Consensus         5 Lp~G~h~ykFiVDG~w   20 (160)
                      +++|.++|+|.|||.+
T Consensus        59 ~~~g~~~Y~y~i~~~~   74 (85)
T PF02922_consen   59 LPPGGYYYKYRIDGDD   74 (85)
T ss_dssp             GTTTT-EEEEEEEETT
T ss_pred             cCCCCEEEEEEEEeCC
Confidence            7888899999998764


No 8  
>cd05814 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate-binding module, family 20) domain. Preimplantation protein 4 (Prei4) is a protein of unknown function that is expressed during mouse preimplantation embryogenesis. In addition to the N-terminal CBM20 domain, Prei4 contains a C-terminal glycerophosphoryl diester phosphodiesterase (GDPD) domain. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
Probab=67.36  E-value=8.6  Score=28.42  Aligned_cols=16  Identities=38%  Similarity=1.009  Sum_probs=13.7

Q ss_pred             EEecCCc-eEEEEEEEC
Q psy15184          2 IIDLPEG-EHEYKFLVD   17 (160)
Q Consensus         2 i~~Lp~G-~h~ykFiVD   17 (160)
                      .+.||.| .++|||++.
T Consensus        51 ~v~lp~~~~veYkY~~~   67 (120)
T cd05814          51 SIELPRGVDFQYRYFVA   67 (120)
T ss_pred             EEEECCCCeEEEEEEEE
Confidence            5789988 799999993


No 9  
>cd00503 Frataxin Frataxin is a nuclear-encoded mitochondrial protein implicated in Friedreich's ataxia (FRDA), an human autosomal recessive neurodegenerative disease; Frataxin is found in eukaryotes and in purple bacteria; lack of frataxin causes iron to accumulate in the mitochondrial matrix suggesting that frataxin is involved in mitochondrial iron homeostasis and possibly in iron transport; the domain has an alpha-beta fold consisting of two helices flanking an antiparallel beta sheet.
Probab=65.94  E-value=4.5  Score=29.92  Aligned_cols=20  Identities=15%  Similarity=0.521  Sum_probs=16.3

Q ss_pred             CCceEEEEEEECCEEEECCCC
Q psy15184          6 PEGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         6 p~G~h~ykFiVDG~w~~~~~~   26 (160)
                      |-|-|+|.|. ||+|++..+.
T Consensus        65 p~G~~hf~~~-~~~W~~~r~g   84 (105)
T cd00503          65 KVGGYHFDYK-NGKWICTRSG   84 (105)
T ss_pred             CCCCccceec-CCEEEECCCC
Confidence            5688999995 9999987554


No 10 
>TIGR03422 mito_frataxin frataxin. Frataxin is a mitochondrial protein, mutation of which leads to the disease Friedreich's ataxia. Its orthologs are widely distributed in the bacteria, associated with the ISC system for iron-sulfur cluster assembly, and designated CyaY. This exception-type model allows those examples of frataxin per se that score above the trusted cutoff to the CyaY equivalog-type model (TIGR03421) to be named appropriately.
Probab=63.81  E-value=6  Score=28.99  Aligned_cols=19  Identities=32%  Similarity=0.767  Sum_probs=15.6

Q ss_pred             CceEEEEEEECCEEEECCCC
Q psy15184          7 EGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         7 ~G~h~ykFiVDG~w~~~~~~   26 (160)
                      .|-|+|+| +||+|++..+.
T Consensus        66 sGp~hfd~-~~~~Wi~~r~g   84 (97)
T TIGR03422        66 SGPKRYDY-VNGEWIYLRDG   84 (97)
T ss_pred             CCCcceee-cCCEEEECCCC
Confidence            58899999 59999987654


No 11 
>PRK00446 cyaY frataxin-like protein; Provisional
Probab=62.17  E-value=6  Score=29.33  Aligned_cols=20  Identities=25%  Similarity=0.700  Sum_probs=16.4

Q ss_pred             CCceEEEEEEECCEEEECCCC
Q psy15184          6 PEGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         6 p~G~h~ykFiVDG~w~~~~~~   26 (160)
                      |.|-|+|+|. ||.|+...+-
T Consensus        64 ~sG~~hf~~~-~~~W~~~r~g   83 (105)
T PRK00446         64 KSGGFHFDYK-DGEWICDRSG   83 (105)
T ss_pred             CCCCccceec-CCeEEECCCC
Confidence            5788999996 9999987554


No 12 
>PF01491 Frataxin_Cyay:  Frataxin-like domain;  InterPro: IPR002908 The eukaryotic proteins in this entry include frataxin, the protein that is mutated in Friedreich's ataxia [], and related sequences. Friedreich's ataxia is a progressive neurodegenerative disorder caused by loss of function mutations in the gene encoding frataxin (FRDA). Frataxin mRNA is predominantly expressed in tissues with a high metabolic rate (including liver, kidney, brown fat and heart). Mouse and yeast frataxin homologues contain a potential N-terminal mitochondrial targeting sequence, and human frataxin has been observed to co-localise with a mitochondrial protein. Furthermore, disruption of the yeast gene has been shown to result in mitochondrial dysfunction. Friedreich's ataxia is thus believed to be a mitochondrial disease caused by a mutation in the nuclear genome (specifically, expansion of an intronic GAA triplet repeat) [, , ]. The bacterial proteins in this entry are iron-sulphur cluster (FeS) metabolism CyaY proteins hmologous to eukaryotic frataxin. Partial Phylogenetic Profiling [] suggests that CyaY most likely functions as part of the ISC system for FeS cluster biosynthesis, and is supported by expermimental data in some species [, ]. ; PDB: 1EW4_A 2P1X_A 1SOY_A 2EFF_A 3T3T_B 3S4M_A 3T3K_A 3S5D_A 1LY7_A 3T3X_B ....
Probab=61.94  E-value=8.1  Score=28.56  Aligned_cols=20  Identities=25%  Similarity=0.705  Sum_probs=17.4

Q ss_pred             C-CceEEEEEEECCEEEECCCC
Q psy15184          6 P-EGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         6 p-~G~h~ykFiVDG~w~~~~~~   26 (160)
                      | .|-|+|.|. +|+|++..+.
T Consensus        67 pisG~~hf~~~-~~~W~~~r~g   87 (109)
T PF01491_consen   67 PISGPFHFDYD-DGKWIDTRDG   87 (109)
T ss_dssp             TTTEEEEEEEE-SSSEEETTTT
T ss_pred             ccCCceEEEEc-CCEEEECCCC
Confidence            5 799999999 9999988765


No 13 
>KOG0045|consensus
Probab=58.94  E-value=8.5  Score=36.71  Aligned_cols=23  Identities=22%  Similarity=0.592  Sum_probs=18.0

Q ss_pred             CCceEEEEEEECCEEE---ECCCCccc
Q psy15184          6 PEGEHEYKFLVDGEWK---VNPQEVKC   29 (160)
Q Consensus         6 p~G~h~ykFiVDG~w~---~~~~~~p~   29 (160)
                      ..|.|+|||.++|+|+   .|+-+ ||
T Consensus       115 yaGif~f~~w~~G~W~~VvIDD~L-P~  140 (612)
T KOG0045|consen  115 YAGIFHFRFWQNGEWVEVVIDDRL-PT  140 (612)
T ss_pred             cceEEEEEEEeCCeEEEEEeeeec-ce
Confidence            4799999999999995   34455 63


No 14 
>cd05809 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain.  Beta-amylase has, in addition to its C-terminal CBM20 domain, an N-terminal catalytic domain belonging to glycosyl hydrolase family 14, which hydrolyzes the alpha-1,4-glucosidic bonds of starch, yielding beta-maltose from the nonreducing end of the substrate. Beta-amylase is found in both plants and microorganisms, however the plant members lack a C-terminal CBM20 domain and are not included in this group. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 
Probab=57.24  E-value=13  Score=26.43  Aligned_cols=15  Identities=33%  Similarity=0.678  Sum_probs=13.2

Q ss_pred             EEecCCc-eEEEEEEE
Q psy15184          2 IIDLPEG-EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G-~h~ykFiV   16 (160)
                      .++||.| ..+|||++
T Consensus        53 ~~~lp~~~~veyKyv~   68 (99)
T cd05809          53 TVHLPAGRNIEFKAIK   68 (99)
T ss_pred             EEEecCCCcEEEEEEE
Confidence            5789999 59999999


No 15 
>PF01378 IgG_binding_B:  B domain;  InterPro: IPR000724 This domain is found as a tandem repeat in Streptococcal cell surface proteins, such as the IgG binding proteins G and MIG. These proteins are type I membrane proteins that bind to the constant Fc region of IgG with high affinity. The N terminus of MIG mediates binding to plasma proteinase inhibitor alpha 2-macroglobulin after complex formation with proteases.; GO: 0005618 cell wall; PDB: 1IGC_A 2IGH_A 2NMQ_A 1IGD_A 1PGX_A 2IGD_A 1QKZ_A 1GB4_A 1FCC_D 1FCL_A ....
Probab=52.82  E-value=6.5  Score=26.16  Aligned_cols=11  Identities=45%  Similarity=0.990  Sum_probs=9.6

Q ss_pred             ECCEEEECCCC
Q psy15184         16 VDGEWKVNPQE   26 (160)
Q Consensus        16 VDG~w~~~~~~   26 (160)
                      |||+|.+|+.-
T Consensus        38 v~gew~yd~at   48 (55)
T PF01378_consen   38 VDGEWSYDDAT   48 (55)
T ss_dssp             TTSEEEEETTT
T ss_pred             CCCccccccch
Confidence            79999999876


No 16 
>PF00686 CBM_20:  Starch binding domain;  InterPro: IPR002044 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. This domain binds to starch, and is found often at the C terminus of a variety of glycosyl hydrolases acting on polysaccharides more rapidly than on oligosaccharides. Reations include: the hydrolysis of terminal 1,4-linked alpha-D-glucose residues successively from non-reducing ends of the chains with release of beta-D-glucose, the degradation of starch to cyclodextrins by formation of a 1,4-alpha-D-glucosidic bond, and hydrolysis of 1,4-alpha-glucosidic linkages in polysaccharides to remove successive maltose units from the non-reducing ends of the chains.; GO: 0003824 catalytic activity, 0005975 carbohydrate metabolic process; PDB: 1KUL_A 1ACZ_A 1AC0_A 1KUM_A 2Z0B_C 9CGT_A 3CGT_A 6CGT_A 4CGT_A 1CGT_A ....
Probab=52.54  E-value=10  Score=26.62  Aligned_cols=15  Identities=47%  Similarity=1.096  Sum_probs=12.9

Q ss_pred             EEecCCc-eEEEEEEE
Q psy15184          2 IIDLPEG-EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G-~h~ykFiV   16 (160)
                      .+.||.| .++|||++
T Consensus        53 ~v~lp~~~~~eYKy~i   68 (96)
T PF00686_consen   53 TVDLPAGTPFEYKYVI   68 (96)
T ss_dssp             EEEEETTSEEEEEEEE
T ss_pred             EEECcCCCEEEEEEEE
Confidence            5788888 59999998


No 17 
>cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain.  Glycogen debranching enzymes have both 4-alpha-glucanotransferase and amylo-1,6-glucosidase activities. As a transferase it transfers a segment of a 1,4-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or another 1,4-alpha-D-glucan. As a glucosidase it catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues.  The N-terminus of the glycogen debranching enzyme may be related to the immunoglobulin and/or fibronectin type III superfamilies.  These domains are associated with different types of catalytic domains at  either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions.  Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase.
Probab=51.90  E-value=16  Score=25.96  Aligned_cols=15  Identities=33%  Similarity=0.809  Sum_probs=11.1

Q ss_pred             cCCceEEEEEEECCEE
Q psy15184          5 LPEGEHEYKFLVDGEW   20 (160)
Q Consensus         5 Lp~G~h~ykFiVDG~w   20 (160)
                      +.+|. .|+|.|||.|
T Consensus        54 ~~~g~-~Y~y~i~g~~   68 (103)
T cd02856          54 IKAGQ-RYGFRVHGPY   68 (103)
T ss_pred             CCCCC-EEEEEECCcc
Confidence            45565 7999999953


No 18 
>TIGR03421 FeS_CyaY iron donor protein CyaY. Members of this protein family are the iron-sulfur cluster (FeS) metabolism protein CyaY, a homolog of eukaryotic frataxin. ISC is one of several bacterial systems for FeS assembly; we find by Partial Phylogenetic Profiling vs. the ISC system that CyaY most like work with the ISC system for FeS cluster biosynthesis. A study of of cyaY mutants in Salmonella enterica bears this out. Although the trusted cutoff is set low enough to include eukaryotic frataxin sequences, a narrower, exception-type model (TIGR03421) identifies identifies members of that specific set.
Probab=51.79  E-value=11  Score=27.70  Aligned_cols=20  Identities=15%  Similarity=0.468  Sum_probs=16.2

Q ss_pred             CCceEEEEEEECCEEEECCCC
Q psy15184          6 PEGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         6 p~G~h~ykFiVDG~w~~~~~~   26 (160)
                      |.|-|+|.|. ||+|++..+.
T Consensus        62 psG~~hF~~~-~~~Wi~~r~g   81 (102)
T TIGR03421        62 KSGGFHFDYD-GGAWIDTRDG   81 (102)
T ss_pred             CCCCccceec-CCEEEECCCC
Confidence            5788999994 8999977665


No 19 
>smart00230 CysPc Calpain-like thiol protease family. Calpain-like thiol protease family (peptidase family C2). Calcium activated neutral protease (large subunit).
Probab=51.41  E-value=16  Score=31.60  Aligned_cols=22  Identities=18%  Similarity=0.481  Sum_probs=18.4

Q ss_pred             CCceEEEEEEECCEEE---ECCCCcc
Q psy15184          6 PEGEHEYKFLVDGEWK---VNPQEVK   28 (160)
Q Consensus         6 p~G~h~ykFiVDG~w~---~~~~~~p   28 (160)
                      +.|.|++||..+|+|+   +|+.. |
T Consensus        99 ~~G~y~vrl~~~G~w~~V~VDd~l-P  123 (318)
T smart00230       99 YAGIFHFRFWRFGKWVDVVIDDRL-P  123 (318)
T ss_pred             cCCEEEEEEEECCEEEEEEecCCC-e
Confidence            6799999999999995   46666 6


No 20 
>PF00648 Peptidase_C2:  Calpain family cysteine protease This is family C2 in the peptidase classification. ;  InterPro: IPR001300 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to the MEROPS peptidase family C2 (calpain family, clan CA). A type example is calpain, which is an intracellular protease involved in many important cellular functions that are regulated by calcium []. The protein is a complex of 2 polypeptide chains (light and heavy), with three known forms in mammals [, ]: a highly calcium-sensitive (i.e., micro-molar range) form known as mu-calpain, mu-CANP or calpain I; a form sensitive to calcium in the milli-molar range, known as m-calpain, m-CANP or calpain II; and a third form, known as p94, which is found in skeletal muscle only [].  All forms have identical light but different heavy chains. Both mu- and m-calpain are heterodimers containing an identical 28kDa subunit and an 80kDa subunit that shares 55-65% sequence homology between the two proteases [, ]. The crystallographic structure of m-calpain reveals six "domains" in the 80kDa subunit:    A 19-amino acid NH2-terminal sequence; Active site domain IIa; Active site domain IIb.  Domain 2 shows low levels of sequence similarity to papain; although the catalytic His has not been located by biochemical means, it is likely that calpain and papain are related [].  Domain III; An 18-amino acid extended sequence linking domain III to domain IV; Domain IV, which resembles the penta EF-hand family of polypeptides, binds calcium and regulates activity []. />]. Ca2+-binding causes a rearrangement of the protein backbone, the net effect of which is that a Trp side chain, which acts as a wedge between catalytic domains IIa and IIb in the apo state, moves away from the active site cleft allowing for the proper formation of the catalytic triad [].   Calpain-like mRNAs have been identified in other organisms including bacteria, but the molecules encoded by these mRNAs have not been isolated, so little is known about their properties. How calpain activity is regulated in these organisms cells is still unclear In metazoans, the activity of calpain is controlled by a single proteinase inhibitor, calpastatin (IPR001259 from INTERPRO). The calpastatin gene can produce eight or more calpastatin polypeptides ranging from 17 to 85 kDa by use of different promoters and alternative splicing events. The physiological significance of these different calpastatins is unclear, although all bind to three different places on the calpain molecule; binding to at least two of the sites is Ca2+ dependent. The calpains ostensibly participate in a variety of cellular processes including remodelling of cytoskeletal/membrane attachments, different signal transduction pathways, and apoptosis. Deregulated calpain activity following loss of Ca2+ homeostasis results in tissue damage in response to events such as myocardial infarcts, stroke, and brain trauma [].  Calpains are a family of cytosolic cysteine proteinases (see PDOC00126 from PROSITEDOC). Members of the calpain family are believed to function in various biological processes, including integrin-mediated cell migration, cytoskeletal remodeling, cell differentiation and apoptosis [, ]. The calpain family includes numerous members from C. elegans to mammals and with homologues in yeast and bacteria. The best characterised members are the m- and mu-calpains, both proteins are heterodimer composed of a large catalytic subunit and a small regulatory subunit. The large subunit comprises four domains (dI-dIV) while the small subunit has two domains (dV-dVI). Domain dI is a short region cleaved by autolysis, dII is the catalytic core, dIII is a C2-like domain, dIV consists of five calcium binding EF-hand motifs []. The crystal structure of calpain has been solved [, ]. The catalytic region consists of two distinct structural domains (dIIa and dIIb). dIIa contains a central helix flanked on three faces by a cluster of alpha-helices and is entirely unrelated to the corresponding domain in the typical thiol proteinases. The fold of dIIb is similar to the corresponding domain in other cysteine proteinases and contains two three-stranded anti-parallel beta-sheets. The catalytic triad residues (C,H,N) are located in dIIa and dIIb. The activation of the domain is dependent on the binding of two calcium atoms in two non EF-hand calcium binding sites located in the catalytic core, one close to the Cys active site in dIIa and one at the end of dIIb. Calcium-binding induced conformational changes in the catalytic domain which align the active site [][]. The profile covers the whole catalytic domain.; GO: 0004198 calcium-dependent cysteine-type endopeptidase activity, 0006508 proteolysis, 0005622 intracellular; PDB: 2NQA_A 1KFU_L 1KFX_L 1QXP_B 2R9C_A 1TL9_A 2G8E_A 1KXR_B 2G8J_A 2NQG_A ....
Probab=51.16  E-value=16  Score=30.73  Aligned_cols=21  Identities=24%  Similarity=0.615  Sum_probs=16.8

Q ss_pred             CceEEEEEEECCEEE---ECCCCcc
Q psy15184          7 EGEHEYKFLVDGEWK---VNPQEVK   28 (160)
Q Consensus         7 ~G~h~ykFiVDG~w~---~~~~~~p   28 (160)
                      -|.|++||..||+|+   +|+-. |
T Consensus        87 ~G~y~v~l~~~G~w~~V~VDd~l-P  110 (298)
T PF00648_consen   87 NGIYTVRLFKNGEWREVTVDDRL-P  110 (298)
T ss_dssp             SSEEEEEEEETTEEEEEEEES-E-E
T ss_pred             CceeeEeeccCCeeeeeccchhh-h
Confidence            399999999999996   45655 6


No 21 
>cd05820 CBM20_novamyl Novamyl (also known as acarviose transferase, ATase, maltogenic alpha-amylase, glucan 1,4-alpha-maltohydrolase, and AcbD), C-terminal CBM20 (carbohydrate-binding module, family 20) domain. Novamyl has a five-domain structure similar to that of cyclodextrin glucanotransferase (CGTase). Novamyl has a substrate-binding surface with an open groove which can accommodate both cyclodextrins and linear substrates. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific reco
Probab=51.13  E-value=26  Score=25.21  Aligned_cols=15  Identities=40%  Similarity=0.780  Sum_probs=13.2

Q ss_pred             EEecCCc-eEEEEEEE
Q psy15184          2 IIDLPEG-EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G-~h~ykFiV   16 (160)
                      .++||.| ..+|||++
T Consensus        55 ~~~lp~~~~veyK~v~   70 (103)
T cd05820          55 VASVPAGTYIEFKFLK   70 (103)
T ss_pred             EEEcCCCCcEEEEEEE
Confidence            5789999 59999998


No 22 
>cd00044 CysPc Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like. Functions in cytoskeletal remodeling processes, cell differentiation, apoptosis and signal transduction.
Probab=48.87  E-value=18  Score=30.85  Aligned_cols=24  Identities=21%  Similarity=0.425  Sum_probs=19.1

Q ss_pred             cCCceEEEEEEECCEEEE---CCCCccc
Q psy15184          5 LPEGEHEYKFLVDGEWKV---NPQEVKC   29 (160)
Q Consensus         5 Lp~G~h~ykFiVDG~w~~---~~~~~p~   29 (160)
                      -+-|.|++||..+|+|+.   |+.. ||
T Consensus       106 ~~~G~y~v~l~~~G~w~~V~VDD~l-P~  132 (315)
T cd00044         106 NYAGIYHFRFWKNGEWVEVVIDDRL-PT  132 (315)
T ss_pred             CcCcEEEEEEEECCEEEEEEecCCC-ee
Confidence            467999999999999964   6566 63


No 23 
>cd05818 CBM20_water_dikinase Phosphoglucan water dikinase (also known as alpha-glucan water dikinase), N-terminal CBM20 (carbohydrate-binding module, family 20) domain. This domain is found in the chloroplast-encoded phosphoglucan water dikinase, one of two enzymes involved in the phosphorylation of plant starches. In addition to the CBM20 domain, phosphoglucan water dikinase contains a C-terminal pyruvate binding domain. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognitio
Probab=47.09  E-value=33  Score=24.16  Aligned_cols=24  Identities=38%  Similarity=0.742  Sum_probs=16.7

Q ss_pred             EEecCCc-eEEEEEEE---CC--EEEECCC
Q psy15184          2 IIDLPEG-EHEYKFLV---DG--EWKVNPQ   25 (160)
Q Consensus         2 i~~Lp~G-~h~ykFiV---DG--~w~~~~~   25 (160)
                      .++||.| ..+|||++   ||  .|...++
T Consensus        46 ~~~l~~~~~ieyKy~~~~~~~~v~WE~g~N   75 (92)
T cd05818          46 DLELDGGELVEYKFVIVKRDGSVIWEGGNN   75 (92)
T ss_pred             EEEeCCCCcEEEEEEEEcCCCCEEEEeCCC
Confidence            4678887 69999998   33  4654443


No 24 
>PRK01379 cyaY frataxin-like protein; Provisional
Probab=44.78  E-value=13  Score=27.68  Aligned_cols=18  Identities=28%  Similarity=0.678  Sum_probs=13.8

Q ss_pred             CceEEEEEEECCEEEECCCC
Q psy15184          7 EGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         7 ~G~h~ykFiVDG~w~~~~~~   26 (160)
                      .|-|+|.|. ||.|+ +.+.
T Consensus        66 sG~~hF~y~-~g~W~-~r~g   83 (103)
T PRK01379         66 SGPYHFFYE-QGKWK-NRAG   83 (103)
T ss_pred             CCCcceecC-CCeeE-ECCC
Confidence            588999995 89999 5443


No 25 
>cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain. This domain is found in several bacterial and fungal alpha-amylases including the maltopentaose-forming amylases (G5-amylases). Most alpha-amylases have, in addition to the C-terminal CBM20 domain, an N-terminal catalytic domain belonging to glycosyl hydrolase family 13, which hydrolyzes internal alpha-1,4-glucosidic bonds in starch and related saccharides, yielding maltotriose and maltose. Two types of soluble substrates are used by alpha-amylases including long substrates (e.g. amylose) and short substrates (e.g. maltodextrins or maltooligosaccharides). The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. lafo
Probab=43.63  E-value=36  Score=23.46  Aligned_cols=15  Identities=47%  Similarity=0.977  Sum_probs=12.6

Q ss_pred             EEecCCc-eEEEEEEE
Q psy15184          2 IIDLPEG-EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G-~h~ykFiV   16 (160)
                      .++||.| .++|||++
T Consensus        48 ~v~l~~~~~~eYKy~~   63 (95)
T cd05808          48 TVDLPAGTAIEYKYIK   63 (95)
T ss_pred             EEEeCCCCeEEEEEEE
Confidence            5788887 69999996


No 26 
>TIGR00481 Raf kinase inhibitor-like protein, YbhB/YbcL family.
Probab=42.77  E-value=17  Score=27.92  Aligned_cols=11  Identities=55%  Similarity=1.189  Sum_probs=9.1

Q ss_pred             CCceEEEEEEE
Q psy15184          6 PEGEHEYKFLV   16 (160)
Q Consensus         6 p~G~h~ykFiV   16 (160)
                      |.|.|+|.|.|
T Consensus        94 P~g~HrY~f~v  104 (141)
T TIGR00481        94 PKGDHRYLFTV  104 (141)
T ss_pred             cCCCEEEEEEE
Confidence            46789999986


No 27 
>PF14645 Chibby:  Chibby family
Probab=41.98  E-value=20  Score=27.08  Aligned_cols=17  Identities=35%  Similarity=0.806  Sum_probs=13.8

Q ss_pred             ecCCceEEEEEEECCEEE
Q psy15184          4 DLPEGEHEYKFLVDGEWK   21 (160)
Q Consensus         4 ~Lp~G~h~ykFiVDG~w~   21 (160)
                      .|--|..+|+| .||+|.
T Consensus        44 ~l~Lg~~~l~F-~dG~W~   60 (116)
T PF14645_consen   44 RLNLGDQTLVF-EDGQWT   60 (116)
T ss_pred             eEeECCeEEEE-ECCEEe
Confidence            34457889999 999999


No 28 
>cd05810 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrolase (alpha-MTH), C-terminal CBM20 (carbohydrate-binding module, family 20) domain. Alpha-MTH, also known as maltotetraose-forming exo-amylase or G4-amylase, is an exo-amylase found in bacteria that degrades starch from its non-reducing end. Most alpha-MTHs have, in addition to the C-terminal CBM20 domain, an N-terminal glycosyl hydrolase family 13 catalytic domain. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognitio
Probab=39.78  E-value=50  Score=23.50  Aligned_cols=15  Identities=40%  Similarity=0.578  Sum_probs=12.7

Q ss_pred             EEecCCc-eEEEEEEE
Q psy15184          2 IIDLPEG-EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G-~h~ykFiV   16 (160)
                      .++||.| ..+|||++
T Consensus        49 ~v~lp~~~~veyKyv~   64 (97)
T cd05810          49 SISLPASTNVEWKCLK   64 (97)
T ss_pred             EEEcCCCCeEEEEEEE
Confidence            5788988 59999988


No 29 
>cd05807 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain. CGTase, also known as cyclodextrin glycosyltransferase and cyclodextrin glucanotransferase, catalyzes the formation of various cyclodextrins (alpha-1,4-glucans) from starch. CGTase has, in addition to its C-terminal CBM20 domain, an N-terminal catalytic domain belonging to glycosyl hydrolase family 13 and an IPT domain of unknown function. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific
Probab=38.43  E-value=29  Score=24.69  Aligned_cols=15  Identities=33%  Similarity=0.744  Sum_probs=13.1

Q ss_pred             EEecCCc-eEEEEEEE
Q psy15184          2 IIDLPEG-EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G-~h~ykFiV   16 (160)
                      .++||.| ..+|||++
T Consensus        55 ~~~lp~~~~~eyK~~~   70 (101)
T cd05807          55 DVSVPAGTTIEFKFIK   70 (101)
T ss_pred             EEEcCCCCcEEEEEEE
Confidence            5789999 59999998


No 30 
>cd02857 CD_pullulan_degrading_enzymes_N_term CD and pullulan-degrading enzymes N-terminus domain.  Members of this subgroup include: Cyclomaltodextrinase (CDase), maltogenic amylase, and neopullulanase all of which are capable of hydrolyzing all or two of the following three types of substrates: cyclomaltodextrins (CDs), pullulan, and starch.  These enzymes hydrolyze CDs and starch to maltose and pullulan to panose by cleavage of alpha-1,4 glycosidic bonds whereas alpha-amylases essentially lack activity on CDs and pullulan. They also catalyze transglycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. The N-terminus of the CD and pullulan-degrading enzymes may be related to the immunoglobulin and/or fibronectin type III superfamilies.  These domains are associated with different types of catalytic domains at  either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions.  Members of 
Probab=38.30  E-value=48  Score=23.25  Aligned_cols=15  Identities=27%  Similarity=0.532  Sum_probs=12.3

Q ss_pred             EEecCCceEEEEEEE
Q psy15184          2 IIDLPEGEHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G~h~ykFiV   16 (160)
                      .+.++.|.+.|+|.|
T Consensus        65 ~i~~~~~~~~Y~F~l   79 (116)
T cd02857          65 TLPPPTGRLRYYFEL   79 (116)
T ss_pred             EEecCCcEEEEEEEE
Confidence            456667899999998


No 31 
>PF13954 PapC_N:  PapC N-terminal domain; PDB: 2VQI_B 3FIP_A 3RFZ_E 3OHN_A 1ZDV_A 1ZE3_D 3BWU_D 1ZDX_A.
Probab=37.39  E-value=36  Score=25.84  Aligned_cols=23  Identities=22%  Similarity=0.353  Sum_probs=19.0

Q ss_pred             ecCCceEEEEEEECCEEEECCCC
Q psy15184          4 DLPEGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         4 ~Lp~G~h~ykFiVDG~w~~~~~~   26 (160)
                      .++||+|...-.|+|+|.-..+.
T Consensus        26 ~~~pG~Y~vdv~vN~~~~~~~~i   48 (146)
T PF13954_consen   26 AIPPGEYSVDVYVNGKFIGRYDI   48 (146)
T ss_dssp             SS-SEEEEEEEEETTEEEEEEEE
T ss_pred             CCCCeEEEEEEEECCeeeeeEEE
Confidence            37899999999999999985555


No 32 
>PF14121 DUF4289:  Domain of unknown function (DUF4289)
Probab=34.83  E-value=59  Score=30.70  Aligned_cols=39  Identities=31%  Similarity=0.366  Sum_probs=32.8

Q ss_pred             CCCCCCCCCeEEeeeEEEeec---CCCEEEEEEeeEecceeE
Q psy15184        114 EPTLLPQPNHVMLNHLYALSI---KDGVMVLSTTHRYRKKYV  152 (160)
Q Consensus       114 ~~~~Lp~P~Hv~LNHLy~~si---k~~~~~l~~T~Ry~~Kyv  152 (160)
                      +...|+.|.-++-|.||....   |.-.+-+|++-||.+||-
T Consensus       494 ~~~il~lP~~~~~~~lYy~~~lfkk~L~lq~G~~~~YfT~Y~  535 (614)
T PF14121_consen  494 GEDILPLPEFVTRNNLYYQFKLFKKALFLQTGFDVRYFTKYY  535 (614)
T ss_pred             CCCcCccCeEEEEeEEEEEchhhhhhheeeeeeEEEEeeccc
Confidence            477899999999999999973   334566899999999984


No 33 
>PF14347 DUF4399:  Domain of unknown function (DUF4399)
Probab=33.81  E-value=38  Score=24.22  Aligned_cols=24  Identities=29%  Similarity=0.613  Sum_probs=18.9

Q ss_pred             EEecCCceEEEEEEECCEEEECCCC
Q psy15184          2 IIDLPEGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         2 i~~Lp~G~h~ykFiVDG~w~~~~~~   26 (160)
                      .++|+||+|...-+. |.+.+-+..
T Consensus        56 ~I~L~PG~htLtl~~-~d~~h~~~~   79 (87)
T PF14347_consen   56 NIELPPGKHTLTLQL-GDGDHVPHD   79 (87)
T ss_pred             EEEeCCCCEEEEEEe-CCCCcccCC
Confidence            578999999999877 566666666


No 34 
>cd05815 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 1. DPE2 is a transglucosidase that is essential for the cytosolic metabolism of maltose in plant leaves at night. Maltose is an intermediate on the pathway from starch to sucrose and DPE2 is thought to metabolize the maltose that is exported from the chloroplast. DPE2 has two N-terminal CBM20 starch binding domains as well as a C-terminal amylomaltase (4-alpha-glucanotransferase) catalytic domain. DPE1, the plastid version of this enzyme, has a transglucosidase domain that is similar to that of DPE2 but lacks the N-terminal carbohydrate-binding domains. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabol
Probab=33.55  E-value=53  Score=23.15  Aligned_cols=15  Identities=40%  Similarity=0.864  Sum_probs=12.3

Q ss_pred             EEecCCc-eEEEEEEE
Q psy15184          2 IIDLPEG-EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G-~h~ykFiV   16 (160)
                      .+++|.| ..+|||+|
T Consensus        50 ~v~~~~~~~veYky~v   65 (101)
T cd05815          50 SISVPPGFSSEYNYYV   65 (101)
T ss_pred             EEEeCCCCcEEEEEEE
Confidence            4678877 59999999


No 35 
>PF03072 DUF237:  MG032/MG096/MG288 family 1;  InterPro: IPR004306 This domain is found entirely in Mycoplasma pneumoniae proteins of unknown function. Another related domain (IPR004319 from INTERPRO) is found entirely in mycoplasmal proteins of the MG032/MG096/MG288 family and both domains often occur together.
Probab=31.87  E-value=54  Score=25.75  Aligned_cols=22  Identities=32%  Similarity=0.768  Sum_probs=17.4

Q ss_pred             CceEEEEEEECCE---EEECCCCcc
Q psy15184          7 EGEHEYKFLVDGE---WKVNPQEVK   28 (160)
Q Consensus         7 ~G~h~ykFiVDG~---w~~~~~~~p   28 (160)
                      .|..+-+|+|||+   |.++..+-|
T Consensus        87 kGkm~vk~~~DG~vp~w~~~k~dyp  111 (137)
T PF03072_consen   87 KGKMNVKFIFDGDVPSWIVGKPDYP  111 (137)
T ss_pred             cceEEEEEEEcccccceeecCCCCC
Confidence            4789999999995   888766634


No 36 
>PF06573 Churchill:  Churchill protein;  InterPro: IPR009508 This family consists of several eukaryotic Churchill proteins. This protein contains a novel zinc binding region that mediates FGF signalling during neural development. The slow induction by FGF of a transcription factor (Churchill) in the neural plate in turn induces expression of Sip1 (Smad interacting protein-1), which inhibits mesodermal genes and sensitizes cells to later neural inducing factors [].; GO: 0008270 zinc ion binding, 0007275 multicellular organismal development, 0045893 positive regulation of transcription, DNA-dependent; PDB: 2JOX_A.
Probab=30.56  E-value=33  Score=25.99  Aligned_cols=13  Identities=38%  Similarity=0.813  Sum_probs=11.2

Q ss_pred             eEEEEEEECCEEE
Q psy15184          9 EHEYKFLVDGEWK   21 (160)
Q Consensus         9 ~h~ykFiVDG~w~   21 (160)
                      .|+|+|-|+|+++
T Consensus        70 ~HEYtF~V~~~yQ   82 (112)
T PF06573_consen   70 RHEYTFSVVDDYQ   82 (112)
T ss_dssp             EEEEEEEEETTEE
T ss_pred             eeeEEEEEeccch
Confidence            6999999988765


No 37 
>cd05813 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 (carbohydrate-binding module, family 20) domain.  Genethonin-1 is a human skeletal muscle protein with no known function. It contains a C-terminal CBM20 domain. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
Probab=30.46  E-value=45  Score=23.25  Aligned_cols=15  Identities=33%  Similarity=0.689  Sum_probs=12.9

Q ss_pred             EEecCCce-EEEEEEE
Q psy15184          2 IIDLPEGE-HEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G~-h~ykFiV   16 (160)
                      .++||.|. .+|||++
T Consensus        47 ~v~lp~~~~ieYky~~   62 (95)
T cd05813          47 SVSLPVDTHVEWKFVL   62 (95)
T ss_pred             EEEecCCCcEEEEEEE
Confidence            57889985 9999998


No 38 
>cd05817 CBM20_DSP Dual-specificity phosphatase (DSP), N-terminal CBM20 (carbohydrate-binding module, family 20) domain. This CBM20 domain is located at the N-terminus of a protein tyrosine phosphatase of unknown function found in slime molds and ciliated protozoans. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
Probab=30.10  E-value=45  Score=23.69  Aligned_cols=15  Identities=40%  Similarity=0.756  Sum_probs=12.8

Q ss_pred             EEecCCc-eEEEEEEE
Q psy15184          2 IIDLPEG-EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G-~h~ykFiV   16 (160)
                      .++||.| ..+|||+|
T Consensus        47 ~v~lp~~~~veYKY~i   62 (100)
T cd05817          47 DVGIPESVYIEYKYFV   62 (100)
T ss_pred             EEEECCCCcEEEEEEE
Confidence            5788888 59999998


No 39 
>cd05811 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain. Glucoamylases are inverting, exo-acting starch hydrolases that hydrolyze starch and related polysaccharides by releasing the nonreducing end glucose. They are mainly active on alpha-1,4-glycosidic bonds but also have some activity towards 1,6-glycosidic bonds occurring in natural oligosaccharides. The ability of glucoamylases to cleave 1-6-glycosidic binds is called "debranching activity" and is of importance in industrial applications, where complete degradation of starch to glucose is needed. Most glucoamylases are multidomain proteins containing an N-terminal catalytic domain, a C-terminal CBM20 domain, and a highly O-glycosylated linker region that connects the two. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also
Probab=30.05  E-value=46  Score=23.59  Aligned_cols=15  Identities=53%  Similarity=0.957  Sum_probs=12.4

Q ss_pred             EEecCCce-EEEEEEE
Q psy15184          2 IIDLPEGE-HEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G~-h~ykFiV   16 (160)
                      .++||.|. .+|||+|
T Consensus        58 ~v~lp~~~~veYKy~~   73 (106)
T cd05811          58 TIPLPAGTSFEYKFIR   73 (106)
T ss_pred             EEEeCCCCcEEEEEEE
Confidence            47788884 9999996


No 40 
>PF08308 PEGA:  PEGA domain;  InterPro: IPR013229 This domain is found in both archaea and bacteria and has similarity to S-layer (surface layer) proteins. It is named after the characteristic PEGA sequence motif found in this domain. The secondary structure of this domain is predicted to be beta-strands.
Probab=29.50  E-value=59  Score=21.22  Aligned_cols=16  Identities=44%  Similarity=0.619  Sum_probs=14.5

Q ss_pred             ecCCceEEEEEEECCE
Q psy15184          4 DLPEGEHEYKFLVDGE   19 (160)
Q Consensus         4 ~Lp~G~h~ykFiVDG~   19 (160)
                      +|++|.|++++.=+|-
T Consensus        31 ~l~~G~~~v~v~~~Gy   46 (71)
T PF08308_consen   31 DLPPGEHTVTVEKPGY   46 (71)
T ss_pred             ecCCccEEEEEEECCC
Confidence            4999999999999994


No 41 
>cd05467 CBM20 The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
Probab=29.30  E-value=50  Score=22.57  Aligned_cols=15  Identities=47%  Similarity=0.873  Sum_probs=12.4

Q ss_pred             EEecCC--c-eEEEEEEE
Q psy15184          2 IIDLPE--G-EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~--G-~h~ykFiV   16 (160)
                      .+.||.  | .++|||++
T Consensus        48 ~v~~~~~~~~~~~yKy~~   65 (96)
T cd05467          48 EIPLPAPEGQVIEYKYVI   65 (96)
T ss_pred             EEEecCCCCCeEEEEEEE
Confidence            467888  7 69999998


No 42 
>cd02852 Isoamylase_N_term Isoamylase N-terminus domain. Isoamylase (aka glycogen 6-glucanohydrolase) is one of the starch-debranching enzymes that catalyzes the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen. Isoamylase contains a bound calcium ion, but this is not in the same position as the conserved calcium ion that has been reported in other alpha-amylase family enzymes. The N-terminus of isoamylase may be related to the immunoglobulin and/or fibronectin type III superfamilies.  These domains are associated with different types of catalytic domains at  either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions.  Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase.
Probab=28.95  E-value=37  Score=24.65  Aligned_cols=16  Identities=38%  Similarity=0.771  Sum_probs=11.3

Q ss_pred             cCCceEEEEEEECCEEE
Q psy15184          5 LPEGEHEYKFLVDGEWK   21 (160)
Q Consensus         5 Lp~G~h~ykFiVDG~w~   21 (160)
                      +.+|. .|+|.|||.|.
T Consensus        58 ~~~g~-~Y~y~v~g~~~   73 (119)
T cd02852          58 LKPGQ-LYGYRVDGPFE   73 (119)
T ss_pred             CCCCC-EEEEEECCCCC
Confidence            44565 68899988754


No 43 
>cd02860 Pullulanase_N_term Pullulanase domain N-terminus. Pullulanase (AKA dextrinase; alpha-dextrin endo-1,6-alpha glucosidase) is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen.  The N-terminus of pullulanase may be related to the immunoglobulin and/or fibronectin type III superfamilies.  These domains are associated with different types of catalytic domains at  either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions.  Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase.
Probab=26.77  E-value=62  Score=22.68  Aligned_cols=20  Identities=30%  Similarity=0.234  Sum_probs=12.9

Q ss_pred             CCceEEEEEEECCE-----EEECCCC
Q psy15184          6 PEGEHEYKFLVDGE-----WKVNPQE   26 (160)
Q Consensus         6 p~G~h~ykFiVDG~-----w~~~~~~   26 (160)
                      .+|. .|+|.|||.     .+.||-.
T Consensus        57 ~~g~-~Y~y~i~~~~~~~~~~~DPyA   81 (100)
T cd02860          57 LEGY-YYLYEVKVYKGETNEVVDPYA   81 (100)
T ss_pred             cCCc-EEEEEEEEeceEEEEEcCccc
Confidence            3454 488888876     5666655


No 44 
>COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only]
Probab=26.73  E-value=67  Score=30.28  Aligned_cols=32  Identities=31%  Similarity=0.583  Sum_probs=25.3

Q ss_pred             EecCCceEEEEEEECC----------EEEECCCCccccccccCceeeCCCCC
Q psy15184          3 IDLPEGEHEYKFLVDG----------EWKVNPQEVKCIAFLVSPVQENKLGS   44 (160)
Q Consensus         3 ~~Lp~G~h~ykFiVDG----------~w~~~~~~~p~~~~~~~p~~~d~~G~   44 (160)
                      +.|.+|.++.||-|+|          .||.+...          .+.|-+|+
T Consensus       344 LnLkyGkn~lkf~V~g~~a~~t~~ifvwr~n~ki----------VVsDiDGT  385 (580)
T COG5083         344 LNLKYGKNLLKFYVEGGKAIATMYIFVWRNNKKI----------VVSDIDGT  385 (580)
T ss_pred             ccCccCcceEEEEEcCCccEEEEEEEEEeCCCcE----------EEEecCCc
Confidence            6799999999999998          37766555          56777775


No 45 
>cd05816 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2. DPE2 is a transglucosidase that is essential for the cytosolic metabolism of maltose in plant leaves at night. Maltose is an intermediate on the pathway from starch to sucrose and DPE2 is thought to metabolize the maltose that is exported from the chloroplast. DPE2 has two N-terminal CBM20 domains as well as a C-terminal amylomaltase (4-alpha-glucanotransferase) catalytic domain. DPE1, the plastid version of this enzyme, has a transglucosidase domain that is similar to that of DPE2 but lacks the N-terminal CBM20 domains. Included in this group are PDE2-like proteins from Dictyostelium, Entamoeba, and Bacteroides. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in star
Probab=26.72  E-value=58  Score=23.05  Aligned_cols=15  Identities=33%  Similarity=0.764  Sum_probs=12.1

Q ss_pred             EEecCCc--eEEEEEEE
Q psy15184          2 IIDLPEG--EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G--~h~ykFiV   16 (160)
                      .+++|++  ..+|||++
T Consensus        48 ~v~~p~~~~~ieYKyvi   64 (99)
T cd05816          48 DIDISKDSFPFEYKYII   64 (99)
T ss_pred             EEEeCCCCccEEEEEEE
Confidence            4678876  58999998


No 46 
>PF09829 DUF2057:  Uncharacterized protein conserved in bacteria (DUF2057);  InterPro: IPR018635 The proteins in this entry are functionally uncharacterised.
Probab=26.60  E-value=62  Score=25.59  Aligned_cols=24  Identities=21%  Similarity=0.425  Sum_probs=20.0

Q ss_pred             EecCCceEEEEEEECCEEEECCCC
Q psy15184          3 IDLPEGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         3 ~~Lp~G~h~ykFiVDG~w~~~~~~   26 (160)
                      ++|++|.||.-|.+++.|....+.
T Consensus        30 l~L~~G~~Qiv~ry~~~~~~~~~~   53 (189)
T PF09829_consen   30 LELPPGENQIVFRYSKIFSSGGDH   53 (189)
T ss_pred             EEeCCCcEEEEEEEeEeeccCCCe
Confidence            789999999999999999444444


No 47 
>TIGR03769 P_ac_wall_RPT actinobacterial surface-anchored protein domain. This model describes a repeat domain that one to three times in Actinobacterial proteins, some of which have LPXTG-type sortase recognition motifs for covalent attachment to the Gram-positive cell wall. Where it occurs with duplication in an LPXTG-anchored protein, it tends to be adjacent to the substrate-binding protein of the gene trio of an ABC transporter system, where that substrate-binding protein has a single copy of this same domain. This arrangement suggests a substrate-binding relay system, with the LPXTG protein acting as a substrate receptor.
Probab=26.35  E-value=82  Score=19.41  Aligned_cols=14  Identities=21%  Similarity=0.342  Sum_probs=11.4

Q ss_pred             CCceEEEEEEE-----CCE
Q psy15184          6 PEGEHEYKFLV-----DGE   19 (160)
Q Consensus         6 p~G~h~ykFiV-----DG~   19 (160)
                      .||.|+..|-.     ||+
T Consensus        11 ~PG~Y~l~~~a~~~~~~G~   29 (41)
T TIGR03769        11 KPGTYTLTVQATATLTDGK   29 (41)
T ss_pred             CCeEEEEEEEEEEEeCCCc
Confidence            48999999977     666


No 48 
>smart00107 BTK Bruton's tyrosine kinase Cys-rich motif. Zinc-binding motif containing conserved cysteines and a histidine. Always found C-terminal to PH domains (but not all PH domains are followed by BTK motifs). The crystal structure shows this motif packs against the PH domain. The PH+Btk module pair has been called the Tec homology (TH) region.
Probab=25.32  E-value=34  Score=20.76  Aligned_cols=17  Identities=35%  Similarity=0.597  Sum_probs=12.8

Q ss_pred             EEEEEEECCEEEECCCC
Q psy15184         10 HEYKFLVDGEWKVNPQE   26 (160)
Q Consensus        10 h~ykFiVDG~w~~~~~~   26 (160)
                      |+=.|.+||.|.+--..
T Consensus         8 yHP~~~~~G~W~CC~q~   24 (36)
T smart00107        8 YHPSFWVDGKWLCCQQS   24 (36)
T ss_pred             cCCCceeCCeEccCCCc
Confidence            34478999999886655


No 49 
>PF14321 DUF4382:  Domain of unknown function (DUF4382)
Probab=24.44  E-value=57  Score=24.54  Aligned_cols=21  Identities=24%  Similarity=0.563  Sum_probs=16.5

Q ss_pred             EecCCceE-EEEEEECC-EEEEC
Q psy15184          3 IDLPEGEH-EYKFLVDG-EWKVN   23 (160)
Q Consensus         3 ~~Lp~G~h-~ykFiVDG-~w~~~   23 (160)
                      .+||+|.| +.||.|++ ....+
T Consensus        63 ~~lpaG~Y~~irl~l~~~~v~~~   85 (139)
T PF14321_consen   63 AELPAGTYNQIRLVLDDANVVIN   85 (139)
T ss_pred             cccCCCcEEEEEEEEeCCeEEEC
Confidence            57999998 99999986 44444


No 50 
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones]
Probab=23.71  E-value=85  Score=23.31  Aligned_cols=18  Identities=22%  Similarity=0.630  Sum_probs=13.6

Q ss_pred             EEEEEEECCEEEECCCCcc
Q psy15184         10 HEYKFLVDGEWKVNPQEVK   28 (160)
Q Consensus        10 h~ykFiVDG~w~~~~~~~p   28 (160)
                      -.+||++||+ +.+.++.|
T Consensus        63 ~slRfL~dG~-rI~~dqTP   80 (103)
T COG5227          63 SSLRFLFDGK-RIDLDQTP   80 (103)
T ss_pred             ceeEEEEcce-ecCCCCCh
Confidence            5799999998 46666634


No 51 
>smart00155 PLDc Phospholipase D. Active site motifs. Phosphatidylcholine-hydrolyzing phospholipase D (PLD) isoforms are  activated by ADP-ribosylation factors (ARFs). PLD produces phosphatidic  acid from phosphatidylcholine, which may be essential for the formation  of certain types of transport vesicles or may be constitutive vesicular transport to signal transduction pathways.  PC-hydrolysing PLD is a homologue of cardiolipin synthase, phosphatidylserine synthase, bacterial PLDs, and viral proteins. Each of these appears to  possess a domain duplication which is apparent by the presence of two motifs containing well-conserved histidine, lysine, aspartic acid,  and/or asparagine residues which may contribute to the active site. An E. coli endonuclease (nuc) and similar proteins appear to be PLD homologues but possess only one of these motifs. The profile contained here represents only the putative active site regions, since an accurate multiple alignment of the repeat units has not be
Probab=23.70  E-value=98  Score=16.89  Aligned_cols=15  Identities=33%  Similarity=0.388  Sum_probs=10.1

Q ss_pred             ceEEEE-EEECCEEEE
Q psy15184          8 GEHEYK-FLVDGEWKV   22 (160)
Q Consensus         8 G~h~yk-FiVDG~w~~   22 (160)
                      |..+=| ++|||+|.+
T Consensus         3 ~~~H~K~~v~D~~~~~   18 (28)
T smart00155        3 GVLHTKLMIVDDEIAY   18 (28)
T ss_pred             CcEEeEEEEEcCCEEE
Confidence            555667 557998754


No 52 
>PF07495 Y_Y_Y:  Y_Y_Y domain;  InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators. However they are also found tandemly repeated in Q891H4 from SWISSPROT without other signal conduction domains being present. It is named after the conserved tyrosines found in the alignment. The exact function is not known.; PDB: 3V9F_D 3VA6_B 3OTT_B 4A2M_D 4A2L_B.
Probab=23.49  E-value=64  Score=20.44  Aligned_cols=20  Identities=20%  Similarity=0.441  Sum_probs=14.2

Q ss_pred             CceEEEEEEE---CCEEEECCCC
Q psy15184          7 EGEHEYKFLV---DGEWKVNPQE   26 (160)
Q Consensus         7 ~G~h~ykFiV---DG~w~~~~~~   26 (160)
                      ++..+|+|.+   |++|....+.
T Consensus         5 ~~~~~Y~Y~l~g~d~~W~~~~~~   27 (66)
T PF07495_consen    5 PENIRYRYRLEGFDDEWITLGSY   27 (66)
T ss_dssp             CTTEEEEEEEETTESSEEEESST
T ss_pred             CCceEEEEEEECCCCeEEECCCC
Confidence            4567888855   6789876665


No 53 
>PF00339 Arrestin_N:  Arrestin (or S-antigen), N-terminal domain;  InterPro: IPR011021 G protein-coupled receptors are a large family of signalling molecules that respond to a wide variety of extracellular stimuli. The receptors relay the information encoded by the ligand through the activation of heterotrimeric G proteins and intracellular effector molecules. To ensure the appropriate regulation of the signalling cascade, it is vital to properly inactivate the receptor. This inactivation is achieved, in part, by the binding of a soluble protein, arrestin, which uncouples the receptor from the downstream G protein after the receptors are phosphorylated by G protein-coupled receptor kinases. In addition to the inactivation of G protein-coupled receptors, arrestins have also been implicated in the endocytosis of receptors and cross talk with other signalling pathways. Arrestin (retinal S-antigen) is a major protein of the retinal rod outer segments. It interacts with photo-activated phosphorylated rhodopsin, inhibiting or 'arresting' its ability to interact with transducin []. The protein binds calcium, and shows similarity in its C terminus to alpha-transducin and other purine nucleotide-binding proteins. In mammals, arrestin is associated with autoimmune uveitis. Arrestins comprise a family of closely-related proteins that includes beta-arrestin-1 and -2, which regulate the function of beta-adrenergic receptors by binding to their phosphorylated forms, impairing their capacity to activate G(S) proteins; Cone photoreceptors C-arrestin (arrestin-X) [], which could bind to phosphorylated red/green opsins; and Drosophila phosrestins I and II, which undergo light-induced phosphorylation, and probably play a role in photoreceptor transduction [, , ].  The crystal structure of bovine retinal arrestin comprises two domains of antiparallel beta-sheets connected through a hinge region and one short alpha-helix on the back of the amino-terminal fold []. The binding region for phosphorylated light-activated rhodopsin is located at the N-terminal domain, as indicated by the docking of the photoreceptor to the three-dimensional structure of arrestin.  The N-terminal domain consists of an immunoglobulin-like beta-sandwich structure. This entry represents proteins with immunoglobulin-like domains that are similar to those found in arrestin.; PDB: 1SUJ_A 3UGX_A 1CF1_B 1AYR_A 3UGU_A 3P2D_B 1ZSH_A 2WTR_B 3GC3_A 1G4R_A ....
Probab=22.26  E-value=37  Score=24.54  Aligned_cols=29  Identities=31%  Similarity=0.449  Sum_probs=13.1

Q ss_pred             EecCCceEEEEEEECCEEEECCCCccccccccCceeeCCCC
Q psy15184          3 IDLPEGEHEYKFLVDGEWKVNPQEVKCIAFLVSPVQENKLG   43 (160)
Q Consensus         3 ~~Lp~G~h~ykFiVDG~w~~~~~~~p~~~~~~~p~~~d~~G   43 (160)
                      -.|++|+|+|-|    +.+...++|+        +.....|
T Consensus        88 ~~l~~G~~~fpF----~f~LP~~lP~--------S~~~~~g  116 (149)
T PF00339_consen   88 NILPPGEYEFPF----EFQLPSNLPS--------SFEGSHG  116 (149)
T ss_dssp             ----C-TTEEEE----EE---TTS----------SEEEE-S
T ss_pred             ecccCCCEEEEE----EEECCCCCCc--------eEeccCc
Confidence            358999999988    4555677743        5555666


No 54 
>TIGR01160 SUI1_MOF2 translation initiation factor SUI1, eukaryotic. Alternate name: MOF2. A similar protein family (see TIGRFAMs model TIGR01158) is found in prokaryotes. The human proteins complements a yeast SUI1 mutatation.
Probab=21.96  E-value=1.1e+02  Score=23.06  Aligned_cols=21  Identities=19%  Similarity=0.295  Sum_probs=17.1

Q ss_pred             CCCEEEEEEeeEecceeEEEE
Q psy15184        135 KDGVMVLSTTHRYRKKYVTTL  155 (160)
Q Consensus       135 k~~~~~l~~T~Ry~~KyvT~v  155 (160)
                      +.+++.+....|=.+|+||+|
T Consensus        24 ~~~~I~Iri~qR~grK~VTiI   44 (110)
T TIGR01160        24 TSNYIHIRIQQRNGRKTLTTV   44 (110)
T ss_pred             ccceEEEEEEEccCCccEEEE
Confidence            356788888888888999987


No 55 
>cd05806 CBM20_laforin Laforin protein tyrosine phosphatase, N-terminal CBM20 (carbohydrate-binding module, family 20) domain. Laforin, encoded by the EPM2A gene, is a dual-specificity phosphatase that dephosphorylates complex carbohydrates. Mutations in the gene encoding laforin result in Lafora disease, a fatal autosomal recessive neurodegenerative disorder characterized by the presence of intracellular deposits of insoluble, abnormally branched, glycogen-like polymers, known as Lafora bodies, in neurons, muscle, liver, and other tissues. The molecular basis for the formation of these Lafora bodies is unknown. Laforin is one of the only phosphatases that contains a carbohydrate-binding module. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen
Probab=20.37  E-value=93  Score=23.22  Aligned_cols=15  Identities=40%  Similarity=0.563  Sum_probs=12.6

Q ss_pred             EEecCCc----eEEEEEEE
Q psy15184          2 IIDLPEG----EHEYKFLV   16 (160)
Q Consensus         2 i~~Lp~G----~h~ykFiV   16 (160)
                      .++||.|    ..+|||+.
T Consensus        56 ~v~lp~~~~~~~~eYKfv~   74 (112)
T cd05806          56 EVELSEPGSEDTFWYKFLK   74 (112)
T ss_pred             EEEcCCCCcCceEEEEEEE
Confidence            5788886    69999997


No 56 
>PRK04517 hypothetical protein; Provisional
Probab=20.13  E-value=97  Score=25.47  Aligned_cols=24  Identities=21%  Similarity=0.465  Sum_probs=20.6

Q ss_pred             EecCCceEEEEEEECCEEEECCCC
Q psy15184          3 IDLPEGEHEYKFLVDGEWKVNPQE   26 (160)
Q Consensus         3 ~~Lp~G~h~ykFiVDG~w~~~~~~   26 (160)
                      ++|+.|.||.-|-+++.|+...+.
T Consensus        54 l~L~~G~nQIvfry~~~~~~~~~~   77 (216)
T PRK04517         54 LELPDGENQIVFRYSPYFSQGNDR   77 (216)
T ss_pred             eEeCCCceEEEEEEeEeeccCCCc
Confidence            789999999999999998866543


Done!